F339358

General Info

Members Datasets Scaffolds Average Seq Length
226 149 452 307

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_000387|Ga0500562_000387_2842_3756
Length 304
Sequence MRLAFLGTPDLAVATLAALVEAGHEIACVYSQPPARRGRGQALKPSPVHAFAEDHGLTVRTPESMRDPGVIADFQALDLDAAIVVAFGQILPAAVLDAPRLGSFNLHGSLLPRWRGAAPIQRAIMAGDAETGVQVMRMTEGLDEGPVIATARLPIAPDETAGSLHDRMAVAGAALMTASLADIETGCAAETPQVEDGATYAKKLRPKETRIDWTQPASEIDRKIRGLSPFPGAWFQLGEHRVKALLSTLAEGAGEPGEVLDAALTVACGEGAIRLLRVQREGKGAQDAEVFLRGAAVAPGTTLA

Samples

Sample ID Description Type Environment
1 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
124 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
134 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
139 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
140 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
141 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
142 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
143 2842694124 Methylopila sp. R-72369 Isolate Unclassified
144 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
145 2849560528 Caulobacter zeae 410 Isolate Unclassified
146 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
147 2851153111 Caulobacter radicis 736 Isolate Unclassified
148 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
149 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 0
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.14
Nodule 0
Rhizoplane 0.44
Rhizosphere 68.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500562_000387 3300053108 Bacteria 10704
2 Ga0055536_1005096 3300003781 Bacteria 6515
3 Ga0055530_10000949 3300003791 Bacteria 23707
4 Ga0055530_10005025 3300003791 Bacteria 6515
5 Ga0055531_10010421 3300003794 Bacteria 4620
6 Ga0055531_10049792 3300003794 Bacteria 1116
7 Ga0065165_1001262 3300005262 Bacteria 28613
8 Ga0070670_100000007 3300005331 Bacteria 318672
9 Ga0070680_100040330 3300005336 Bacteria 3780
10 Ga0070668_100007764 3300005347 Bacteria 7966
11 Ga0070668_100008888 3300005347 Bacteria 7460
12 Ga0070668_100017845 3300005347 Bacteria 5323
13 Ga0070668_100040646 3300005347 Bacteria 3559
14 Ga0070669_100028900 3300005353 Bacteria 3994
15 Ga0070671_100002518 3300005355 Bacteria 14197
16 Ga0070667_100000155 3300005367 Bacteria 85527
17 Ga0070667_100021236 3300005367 Bacteria 5393
18 Ga0070663_100182510 3300005455 Bacteria 1629
19 Ga0070681_10019999 3300005458 Bacteria 6708
20 Ga0070665_100001961 3300005548 Bacteria 23155
21 Ga0070665_100004749 3300005548 Bacteria 14144
22 Ga0070665_100036774 3300005548 Bacteria 4924
23 Ga0070665_100080804 3300005548 Bacteria 3256
24 Ga0068855_100069345 3300005563 Bacteria 4103
25 Ga0068855_100168574 3300005563 Bacteria 2480
26 Ga0068854_100153621 3300005578 Bacteria 1777
27 Ga0068856_100065818 3300005614 Bacteria 3581
28 Ga0068856_100136019 3300005614 Bacteria 2463
29 Ga0068852_100022836 3300005616 Bacteria 5024
30 Ga0068859_100000230 3300005617 Bacteria 55064
31 Ga0068859_100014488 3300005617 Bacteria 7916
32 Ga0068859_100300635 3300005617 Bacteria 1698
33 Ga0068864_100000067 3300005618 Bacteria 115834
34 Ga0068864_100000128 3300005618 Bacteria 73813
35 Ga0068864_100085404 3300005618 Bacteria 2775
36 Ga0068861_100082218 3300005719 Bacteria 2523
37 Ga0068863_100000237 3300005841 Bacteria 58657
38 Ga0068863_100000360 3300005841 Bacteria 46300
39 Ga0068863_100004709 3300005841 Bacteria 13447
40 Ga0068858_100000020 3300005842 Bacteria 175896
41 Ga0068858_100003515 3300005842 Bacteria 15534
42 Ga0068860_100000047 3300005843 Bacteria 213287
43 Ga0068862_100001031 3300005844 Bacteria 26791
44 Ga0068862_100010926 3300005844 Bacteria 7497
45 Ga0068862_100122701 3300005844 Bacteria 2292
46 Ga0075368_10015801 3300006042 Bacteria 2805
47 Ga0075364_10007381 3300006051 Bacteria 6525
48 Ga0075367_10028159 3300006178 Bacteria 3203
49 Ga0075369_10009336 3300006186 Bacteria 3808
50 Ga0075369_10029537 3300006186 Bacteria 2303
51 Ga0075366_10055750 3300006195 Bacteria 2347
52 Ga0075370_10131856 3300006353 Bacteria 1458
53 Ga0097620_100000230 3300006931 Bacteria 55064
54 Ga0097620_100014488 3300006931 Bacteria 7916
55 Ga0097620_100300622 3300006931 Bacteria 1698
56 Ga0105240_10062702 3300009093 Bacteria 4627
57 Ga0105240_10219343 3300009093 Bacteria 2217
58 Ga0105242_10437768 3300009176 Bacteria 1229
59 Ga0105248_10004051 3300009177 Bacteria 16197
60 Ga0105248_10104834 3300009177 Bacteria 3188
61 Ga0105238_10224737 3300009551 Bacteria 1854
62 Ga0105249_10001758 3300009553 Bacteria 18894
63 Ga0163162_10075545 3300013306 Bacteria 3430
64 Ga0163162_10280332 3300013306 Bacteria 1799
65 Ga0163163_10010857 3300014325 Bacteria 8225
66 Ga0163163_10021531 3300014325 Bacteria 6086
67 Ga0157379_10010392 3300014968 Bacteria 8109
68 Ga0213874_10029191 3300021377 Bacteria 1581
69 Ga0213876_10000081 3300021384 Bacteria 108997
70 Ga0213876_10162915 3300021384 Bacteria 1186
71 Ga0209026_1004839 3300025250 Bacteria 3830
72 Ga0209148_1012004 3300025254 Bacteria 1595
73 Ga0209676_1000253 3300025292 Bacteria 113412
74 Ga0209758_1000894 3300025297 Bacteria 40579
75 Ga0209050_1000173 3300025298 Bacteria 149800
76 Ga0209050_1000649 3300025298 Bacteria 53856
77 Ga0209051_1005367 3300025303 Bacteria 7521
78 Ga0209257_1000196 3300025304 Bacteria 149656
79 Ga0209257_1014332 3300025304 Bacteria 3412
80 Ga0207695_10007614 3300025913 Bacteria 13721
81 Ga0207695_10033508 3300025913 Bacteria 5600
82 Ga0207695_10073887 3300025913 Bacteria 3472
83 Ga0207681_10024548 3300025923 Bacteria 3870
84 Ga0207694_10142515 3300025924 Bacteria 1928
85 Ga0207650_10000030 3300025925 Bacteria 235824
86 Ga0207644_10001249 3300025931 Bacteria 16358
87 Ga0207711_10000669 3300025941 Bacteria 34078
88 Ga0207711_10002365 3300025941 Bacteria 16890
89 Ga0207711_10005325 3300025941 Bacteria 10911
90 Ga0207711_10111079 3300025941 Bacteria 2438
91 Ga0207667_10053212 3300025949 Bacteria 4260
92 Ga0207712_10000758 3300025961 Bacteria 24361
93 Ga0207712_10260873 3300025961 Bacteria 1405
94 Ga0207668_10000010 3300025972 Bacteria 185249
95 Ga0207668_10000108 3300025972 Bacteria 59119
96 Ga0207668_10004753 3300025972 Bacteria 7993
97 Ga0207668_10010421 3300025972 Bacteria 5614
98 Ga0207668_10012514 3300025972 Bacteria 5196
99 Ga0207668_10048054 3300025972 Bacteria 2926
100 Ga0207640_10105978 3300025981 Bacteria 1982
101 Ga0207658_10000265 3300025986 Bacteria 55108
102 Ga0207658_10014054 3300025986 Bacteria 5480
103 Ga0207658_10076554 3300025986 Bacteria 2549
104 Ga0207658_10181588 3300025986 Bacteria 1742
105 Ga0207703_10000082 3300026035 Bacteria 110579
106 Ga0207641_10000007 3300026088 Bacteria 441443
107 Ga0207641_10001651 3300026088 Bacteria 21777
108 Ga0207641_10009307 3300026088 Bacteria 8103
109 Ga0207676_10000183 3300026095 Bacteria 55220
110 Ga0207676_10000241 3300026095 Bacteria 47707
111 Ga0207676_10093870 3300026095 Bacteria 2471
112 Ga0207676_10219587 3300026095 Bacteria 1692
113 Ga0207675_100096375 3300026118 Bacteria 2785
114 Ga0268266_10001015 3300028379 Bacteria 35377
115 Ga0268266_10005366 3300028379 Bacteria 11979
116 Ga0268266_10014766 3300028379 Bacteria 6709
117 Ga0268265_10006429 3300028380 Bacteria 7965
118 Ga0268265_10023439 3300028380 Bacteria 4351
119 Ga0268265_10040484 3300028380 Bacteria 3442
120 Ga0268265_10043415 3300028380 Bacteria 3342
121 Ga0268264_10000110 3300028381 Bacteria 206663
122 Ga0268264_10000125 3300028381 Bacteria 186416
123 Ga0265334_10044802 3300028573 Bacteria 1716
124 Ga0307517_10001402 3300028786 Bacteria 40531
125 Ga0307517_10029106 3300028786 Bacteria 6543
126 Ga0307517_10126564 3300028786 Bacteria 1861
127 Ga0265327_10002651 3300031251 Bacteria 18419
128 Ga0265327_10038029 3300031251 Bacteria 2629
129 Ga0307513_10003700 3300031456 Bacteria 20671
130 Ga0307513_10010991 3300031456 Bacteria 11295
131 Ga0307513_10013112 3300031456 Bacteria 10189
132 Ga0307516_10000001 3300031730 Bacteria 510338
133 Ga0373945_0115472 3300035116 Bacteria 1063
134 Ga0373943_0098197 3300035170 Bacteria 1527
135 Ga0373946_0015968 3300035171 Bacteria 2855
136 Ga0373927_0000472 3300035695 Bacteria 30834
137 Ga0373925_0000003 3300037068 Bacteria 362401
138 Ga0373925_0140744 3300037068 Bacteria 1888
139 Ga0395899_0076675 3300037312 Bacteria 2440
140 Ga0395900_0022855 3300037418 Bacteria 6398
141 Ga0395900_0269710 3300037418 Bacteria 1697
142 Ga0395898_0124062 3300037466 Bacteria 2474
143 Ga0395905_0009683 3300037471 Bacteria 9406
144 Ga0395905_0053948 3300037471 Bacteria 3762
145 Ga0395905_0062286 3300037471 Bacteria 3489
146 Ga0436364_0882847 3300037853 Bacteria 3537
147 Ga0395901_0137277 3300038443 Bacteria 2570
148 Ga0436365_0187494 3300039437 Bacteria 67801
149 Ga0436365_0195056 3300039437 Bacteria 3279
150 Ga0436363_0886336 3300039450 Bacteria 2087
151 Ga0439459_0015715 3300042438 Bacteria 1390
152 Ga0466969_0038947 3300044656 Bacteria 2390
153 Ga0466968_0043668 3300044735 Bacteria 1899
154 Ga0466959_0016077 3300045049 Bacteria 5463
155 Ga0495650_0066665 3300046471 Bacteria 1424
156 Ga0495643_0006929 3300046522 Bacteria 7373
157 Ga0495597_0020236 3300046542 Bacteria 3101
158 Ga0495668_0000291 3300046616 Bacteria 68802
159 Ga0495668_0017233 3300046616 Bacteria 4193
160 Ga0495668_0025207 3300046616 Bacteria 3381
161 Ga0495668_0054031 3300046616 Bacteria 2220
162 Ga0495669_0000044 3300046684 Bacteria 85633
163 Ga0495669_0079732 3300046684 Bacteria 1501
164 Ga0495677_0017589 3300047445 Bacteria 2591
165 Ga0495685_057766 3300047447 Bacteria 1310
166 Ga0495686_0010570 3300047472 Bacteria 6558
167 Ga0495602_0170140 3300048088 Bacteria 1692
168 Ga0496115_0141134 3300048918 Bacteria 1988
169 Ga0496117_0059406 3300048920 Bacteria 2641
170 Ga0496118_0072565 3300048921 Bacteria 2471
171 Ga0496119_0055328 3300048922 Bacteria 2410
172 Ga0496121_0000035 3300048924 Bacteria 374316
173 Ga0496124_0113683 3300048927 Bacteria 2175
174 Ga0496125_0028483 3300048928 Bacteria 5044
175 Ga0501036_0106083 3300049572 Bacteria 2376
176 Ga0501038_0039953 3300049574 Bacteria 4101
177 Ga0501038_0042929 3300049574 Bacteria 3936
178 Ga0501040_0238633 3300049576 Bacteria 1295
179 Ga0501046_0017408 3300049580 Bacteria 5998
180 Ga0501047_0005131 3300049581 Bacteria 12290
181 Ga0501047_0220490 3300049581 Bacteria 1753
182 Ga0501047_0265557 3300049581 Bacteria 1563
183 Ga0501071_0140148 3300049587 Bacteria 1800
184 Ga0501072_0101152 3300049588 Bacteria 2291
185 Ga0501075_0100097 3300049591 Bacteria 2201
186 Ga0501076_0047740 3300049592 Bacteria 3385
187 Ga0501076_0280156 3300049592 Bacteria 1366
188 Ga0501077_0045269 3300049593 Bacteria 2795
189 Ga0501079_0010693 3300049741 Bacteria 6988
190 Ga0501081_0142461 3300049743 Bacteria 1718
191 nmdc:mga00v17_254_c1 3300050491 Bacteria 31422
192 nmdc:mga06z11_175849_c1 3300050494 Bacteria 1232
193 nmdc:mga04h51_18617_c1 3300050495 Bacteria 2047
194 nmdc:mga07m45_106128_c1 3300050496 Bacteria 1616
195 Ga0500635_0000133 3300053080 Bacteria 42884
196 Ga0495655_0045818 3300053083 Bacteria 1137
197 Ga0500643_016835 3300053087 Bacteria 2465
198 Ga0500583_0075225 3300053092 Bacteria 1622
199 Ga0500651_0012784 3300053093 Bacteria 5095
200 Ga0500641_0011239 3300053096 Bacteria 3248
201 Ga0500569_037574 3300053109 Bacteria 1400
202 Ga0500595_009594 3300053119 Bacteria 3899
203 Ga0500595_015399 3300053119 Bacteria 2871
204 Ga0500608_002907 3300053122 Bacteria 6332
205 Ga0500559_0000048 3300053136 Bacteria 93755
206 Ga0500559_0002446 3300053136 Bacteria 9612
207 Ga0500559_0023470 3300053136 Bacteria 2618
208 Ga0500590_030642 3300053148 Bacteria 2790
209 Ga0500636_0003639 3300053177 Bacteria 8694
210 Ga0500637_0019160 3300053178 Bacteria 3686
211 Ga0501084_0021975 3300054114 Bacteria 5322
212 Ga0501084_0045308 3300054114 Bacteria 3683
213 Ga0501082_0054963 3300060353 Bacteria 3431
214 Ga0530510_0027025 3300061734 Bacteria 4111
215 2587917059 2585428106 Bacteria 5179711
216 2644087092 2643221614 Bacteria 4260023
217 2644342046 2643221661 Bacteria 4267604
218 2644368333 2643221666 Bacteria 4265935
219 2792461849 2791355048 Bacteria 5832535
220 2842697295 2842694124 Bacteria 4063419
221 2843745212 2843744320 Bacteria 5659202
222 2849563995 2849560528 Bacteria 5393480
223 2849577627 2849573788 Bacteria 5421256
224 2851157541 2851153111 Bacteria 5542585
225 2857506131 2857504554 Bacteria 5369913
226 2889310723 2889306138 Bacteria 6358934
227 Ga0500562_000387
228 Ga0055536_1005096
229 Ga0055530_10000949
230 Ga0055530_10005025
231 Ga0055531_10010421
232 Ga0055531_10049792
233 Ga0065165_1001262
234 Ga0070670_100000007
235 Ga0070680_100040330
236 Ga0070668_100007764
237 Ga0070668_100008888
238 Ga0070668_100017845
239 Ga0070668_100040646
240 Ga0070669_100028900
241 Ga0070671_100002518
242 Ga0070667_100000155
243 Ga0070667_100021236
244 Ga0070663_100182510
245 Ga0070681_10019999
246 Ga0070665_100001961
247 Ga0070665_100004749
248 Ga0070665_100036774
249 Ga0070665_100080804
250 Ga0068855_100069345
251 Ga0068855_100168574
252 Ga0068854_100153621
253 Ga0068856_100065818
254 Ga0068856_100136019
255 Ga0068852_100022836
256 Ga0068859_100000230
257 Ga0068859_100014488
258 Ga0068859_100300635
259 Ga0068864_100000067
260 Ga0068864_100000128
261 Ga0068864_100085404
262 Ga0068861_100082218
263 Ga0068863_100000237
264 Ga0068863_100000360
265 Ga0068863_100004709
266 Ga0068858_100000020
267 Ga0068858_100003515
268 Ga0068860_100000047
269 Ga0068862_100001031
270 Ga0068862_100010926
271 Ga0068862_100122701
272 Ga0075368_10015801
273 Ga0075364_10007381
274 Ga0075367_10028159
275 Ga0075369_10009336
276 Ga0075369_10029537
277 Ga0075366_10055750
278 Ga0075370_10131856
279 Ga0097620_100000230
280 Ga0097620_100014488
281 Ga0097620_100300622
282 Ga0105240_10062702
283 Ga0105240_10219343
284 Ga0105242_10437768
285 Ga0105248_10004051
286 Ga0105248_10104834
287 Ga0105238_10224737
288 Ga0105249_10001758
289 Ga0163162_10075545
290 Ga0163162_10280332
291 Ga0163163_10010857
292 Ga0163163_10021531
293 Ga0157379_10010392
294 Ga0213874_10029191
295 Ga0213876_10000081
296 Ga0213876_10162915
297 Ga0209026_1004839
298 Ga0209148_1012004
299 Ga0209676_1000253
300 Ga0209758_1000894
301 Ga0209050_1000173
302 Ga0209050_1000649
303 Ga0209051_1005367
304 Ga0209257_1000196
305 Ga0209257_1014332
306 Ga0207695_10007614
307 Ga0207695_10033508
308 Ga0207695_10073887
309 Ga0207681_10024548
310 Ga0207694_10142515
311 Ga0207650_10000030
312 Ga0207644_10001249
313 Ga0207711_10000669
314 Ga0207711_10002365
315 Ga0207711_10005325
316 Ga0207711_10111079
317 Ga0207667_10053212
318 Ga0207712_10000758
319 Ga0207712_10260873
320 Ga0207668_10000010
321 Ga0207668_10000108
322 Ga0207668_10004753
323 Ga0207668_10010421
324 Ga0207668_10012514
325 Ga0207668_10048054
326 Ga0207640_10105978
327 Ga0207658_10000265
328 Ga0207658_10014054
329 Ga0207658_10076554
330 Ga0207658_10181588
331 Ga0207703_10000082
332 Ga0207641_10000007
333 Ga0207641_10001651
334 Ga0207641_10009307
335 Ga0207676_10000183
336 Ga0207676_10000241
337 Ga0207676_10093870
338 Ga0207676_10219587
339 Ga0207675_100096375
340 Ga0268266_10001015
341 Ga0268266_10005366
342 Ga0268266_10014766
343 Ga0268265_10006429
344 Ga0268265_10023439
345 Ga0268265_10040484
346 Ga0268265_10043415
347 Ga0268264_10000110
348 Ga0268264_10000125
349 Ga0265334_10044802
350 Ga0307517_10001402
351 Ga0307517_10029106
352 Ga0307517_10126564
353 Ga0265327_10002651
354 Ga0265327_10038029
355 Ga0307513_10003700
356 Ga0307513_10010991
357 Ga0307513_10013112
358 Ga0307516_10000001
359 Ga0373945_0115472
360 Ga0373943_0098197
361 Ga0373946_0015968
362 Ga0373927_0000472
363 Ga0373925_0000003
364 Ga0373925_0140744
365 Ga0395899_0076675
366 Ga0395900_0022855
367 Ga0395900_0269710
368 Ga0395898_0124062
369 Ga0395905_0009683
370 Ga0395905_0053948
371 Ga0395905_0062286
372 Ga0436364_0882847
373 Ga0395901_0137277
374 Ga0436365_0187494
375 Ga0436365_0195056
376 Ga0436363_0886336
377 Ga0439459_0015715
378 Ga0466969_0038947
379 Ga0466968_0043668
380 Ga0466959_0016077
381 Ga0495650_0066665
382 Ga0495643_0006929
383 Ga0495597_0020236
384 Ga0495668_0000291
385 Ga0495668_0017233
386 Ga0495668_0025207
387 Ga0495668_0054031
388 Ga0495669_0000044
389 Ga0495669_0079732
390 Ga0495677_0017589
391 Ga0495685_057766
392 Ga0495686_0010570
393 Ga0495602_0170140
394 Ga0496115_0141134
395 Ga0496117_0059406
396 Ga0496118_0072565
397 Ga0496119_0055328
398 Ga0496121_0000035
399 Ga0496124_0113683
400 Ga0496125_0028483
401 Ga0501036_0106083
402 Ga0501038_0039953
403 Ga0501038_0042929
404 Ga0501040_0238633
405 Ga0501046_0017408
406 Ga0501047_0005131
407 Ga0501047_0220490
408 Ga0501047_0265557
409 Ga0501071_0140148
410 Ga0501072_0101152
411 Ga0501075_0100097
412 Ga0501076_0047740
413 Ga0501076_0280156
414 Ga0501077_0045269
415 Ga0501079_0010693
416 Ga0501081_0142461
417 nmdc:mga00v17_254_c1
418 nmdc:mga06z11_175849_c1
419 nmdc:mga04h51_18617_c1
420 nmdc:mga07m45_106128_c1
421 Ga0500635_0000133
422 Ga0495655_0045818
423 Ga0500643_016835
424 Ga0500583_0075225
425 Ga0500651_0012784
426 Ga0500641_0011239
427 Ga0500569_037574
428 Ga0500595_009594
429 Ga0500595_015399
430 Ga0500608_002907
431 Ga0500559_0000048
432 Ga0500559_0002446
433 Ga0500559_0023470
434 Ga0500590_030642
435 Ga0500636_0003639
436 Ga0500637_0019160
437 Ga0501084_0021975
438 Ga0501084_0045308
439 Ga0501082_0054963
440 Ga0530510_0027025
441 2587917059
442 2644087092
443 2644342046
444 2644368333
445 2792461849
446 2842697295
447 2843745212
448 2849563995
449 2849577627
450 2851157541
451 2857506131
452 2889310723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

1

180

0.96

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

203

296

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9027 2 308
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.8984 2 308
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.8959 1 308
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.8914 2 308
3q0i-assembly1.cif.gz_A methionyl-trna formyltransferase from vibrio cholerae 0.8903 1 308
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9505 2 205 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9362 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.934 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9121 2 205 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9041 2 205 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3B9VCC8-F1-model_v4 Methionyl-tRNA formyltransferase 0.9687 1 96 GO:0004479
GO:0005829
AF-H8K8G4-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9647 6 97 GO:0004479
GO:0005829
AF-A0A838F4N2-F1-model_v4 Methionyl-tRNA formyltransferase 0.9626 1 77 GO:0004479
GO:0005829
AF-A0A661M0D9-F1-model_v4 Methionyl-tRNA formyltransferase 0.9619 2 100 GO:0004479
GO:0005829
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9602 1 124 GO:0004479
GO:0005829

Map