F339588

General Info

Members Datasets Scaffolds Average Seq Length
227 169 454 141

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100146193|Ga0068868_1001461933
Length 149
Sequence LNLEPRTLTINEIQDELIEEFSLFGDWMEKYENIIQMGKELPLIEEQYKKEENLIKGCQAKVWLHADFKNGKILFSADSDAIITKGLVSMVVRVLTNHTPEEIVHADLYFVDKIGLKEHLSLTRSNGLLSMIKQMKMYALALQSRVNVN

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
94 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
118 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
134 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
135 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
136 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
139 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
140 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
156 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
157 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
158 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
159 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
160 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
161 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
162 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
163 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
164 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
165 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
166 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
167 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
168 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
169 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 0.44
Isolates 6.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 0
Rhizoplane 0.44
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 12.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100146193 3300005338 Bacteria 1944
2 SwRhRL2b_contig_926693 2162886007 Bacteria 919
3 JGI24740J21852_10014395 3300001979 Bacteria 2919
4 JGI24739J22299_10024895 3300001989 Bacteria 2108
5 JGI25154J39366_1000028 3300002738 Bacteria 195818
6 JGI25406J46586_10025379 3300003203 Bacteria 2302
7 JGI25153J46596_10014697 3300003215 Bacteria 3238
8 rootH1_10124579 3300003316 Bacteria 1220
9 rootH2_10007492 3300003320 Bacteria 31313
10 rootH2_10022397 3300003320 Bacteria 2853
11 rootH2_10073496 3300003320 Bacteria 4789
12 rootH2_10142132 3300003320 Unclassified 1056
13 rootH2_10157649 3300003320 Bacteria 1161
14 rootH2_10217478 3300003320 Bacteria 1576
15 rootL2_10005737 3300003322 Bacteria 6065
16 rootL2_10117241 3300003322 Unclassified 1109
17 rootL2_10187408 3300003322 Bacteria 1066
18 rootH1_10113762 3300003323 Bacteria 6974
19 JGI25160J50197_1005183 3300003354 Bacteria 5467
20 Ga0055526_1020629 3300003771 Bacteria 2332
21 Ga0055528_1000029 3300003790 Bacteria 122126
22 Ga0055530_10000263 3300003791 Bacteria 47460
23 Ga0055531_10030702 3300003794 Bacteria 1796
24 Ga0065165_1000052 3300005262 Bacteria 192010
25 Ga0065165_1085186 3300005262 Bacteria 814
26 Ga0065714_10081370 3300005288 Bacteria 2380
27 Ga0065714_10285312 3300005288 Bacteria 716
28 Ga0065704_10091552 3300005289 Bacteria 2710
29 Ga0065704_10116858 3300005289 Bacteria 1821
30 Ga0065715_10674515 3300005293 Bacteria 666
31 Ga0070658_10491938 3300005327 Bacteria 1059
32 Ga0070670_100346855 3300005331 Bacteria 1304
33 Ga0070669_100840422 3300005353 Bacteria 782
34 Ga0070667_101658795 3300005367 Unclassified 601
35 Ga0068867_100898109 3300005459 Bacteria 797
36 Ga0068867_101256511 3300005459 Unclassified 682
37 Ga0070672_100113845 3300005543 Bacteria 2208
38 Ga0070693_100024496 3300005547 Bacteria 3237
39 Ga0070693_101416342 3300005547 Bacteria 541
40 Ga0070664_101579463 3300005564 Bacteria 621
41 Ga0068857_100732738 3300005577 Unclassified 941
42 Ga0068857_101347225 3300005577 Unclassified 693
43 Ga0068856_100162199 3300005614 Bacteria 2246
44 Ga0068859_100581535 3300005617 Bacteria 1213
45 Ga0068859_101388149 3300005617 Unclassified 775
46 Ga0068864_100318304 3300005618 Bacteria 1461
47 Ga0068861_100641200 3300005719 Bacteria 980
48 Ga0068851_10214075 3300005834 Unclassified 1080
49 Ga0068863_101941422 3300005841 Bacteria 599
50 Ga0068860_100020477 3300005843 Bacteria 6406
51 Ga0068860_100052540 3300005843 Bacteria 3876
52 Ga0068860_100639071 3300005843 Bacteria 1072
53 Ga0081455_10184066 3300005937 Bacteria 1579
54 Ga0081539_10000603 3300005985 Bacteria 73114
55 Ga0075366_10066876 3300006195 Bacteria 2138
56 Ga0097621_101412984 3300006237 Bacteria 659
57 Ga0075434_101516366 3300006871 Unclassified 679
58 Ga0068865_100381155 3300006881 Bacteria 1150
59 Ga0097620_100581520 3300006931 Bacteria 1213
60 Ga0097620_101388322 3300006931 Unclassified 775
61 Ga0105240_10012951 3300009093 Bacteria 11487
62 Ga0105240_11387036 3300009093 Bacteria 739
63 Ga0105243_10000109 3300009148 Bacteria 94597
64 Ga0105238_10576315 3300009551 Bacteria 1131
65 Ga0105249_10968298 3300009553 Bacteria 919
66 Ga0105239_11069197 3300010375 Unclassified 929
67 Ga0105239_11661957 3300010375 Bacteria 739
68 Ga0105246_10436877 3300011119 Bacteria 1096
69 Ga0105246_10980509 3300011119 Bacteria 764
70 Ga0157371_10059689 3300013102 Bacteria 2704
71 Ga0157371_10132637 3300013102 Bacteria 1773
72 Ga0157371_10596976 3300013102 Unclassified 821
73 Ga0157370_10000732 3300013104 Bacteria 41177
74 Ga0157370_10160213 3300013104 Bacteria 2094
75 Ga0157370_10238895 3300013104 Unclassified 1681
76 Ga0163162_10016980 3300013306 Bacteria 7121
77 Ga0163162_10424190 3300013306 Bacteria 1462
78 Ga0157372_10002580 3300013307 Bacteria 19628
79 Ga0157372_10764007 3300013307 Bacteria 1124
80 Ga0157372_11618697 3300013307 Bacteria 745
81 Ga0157375_11864237 3300013308 Bacteria 713
82 Ga0209646_1000006 3300025246 Bacteria 694084
83 Ga0209026_1000185 3300025250 Bacteria 91252
84 Ga0209673_1000187 3300025273 Bacteria 124227
85 Ga0209675_1045099 3300025291 Bacteria 939
86 Ga0209564_1001813 3300025295 Bacteria 19674
87 Ga0209564_1005716 3300025295 Bacteria 6966
88 Ga0209564_1007107 3300025295 Bacteria 5848
89 Ga0209758_1009754 3300025297 Bacteria 5893
90 Ga0209050_1000259 3300025298 Bacteria 113475
91 Ga0207426_1000209 3300025302 Bacteria 139524
92 Ga0207426_1001796 3300025302 Bacteria 16020
93 Ga0209051_1088540 3300025303 Bacteria 868
94 Ga0209257_1013061 3300025304 Bacteria 3744
95 Ga0207647_10657525 3300025904 Bacteria 574
96 Ga0207654_10518873 3300025911 Bacteria 843
97 Ga0207695_10062807 3300025913 Bacteria 3832
98 Ga0207657_10011243 3300025919 Bacteria 8893
99 Ga0207681_10275426 3300025923 Bacteria 1323
100 Ga0207681_10717552 3300025923 Bacteria 832
101 Ga0207694_10529878 3300025924 Bacteria 988
102 Ga0207659_10076459 3300025926 Bacteria 2461
103 Ga0207709_10000072 3300025935 Bacteria 178084
104 Ga0207691_11023012 3300025940 Bacteria 689
105 Ga0207640_10136490 3300025981 Unclassified 1782
106 Ga0207678_10781807 3300026067 Unclassified 842
107 Ga0207702_10020152 3300026078 Bacteria 5524
108 Ga0207641_10817126 3300026088 Bacteria 923
109 Ga0207641_11612676 3300026088 Bacteria 651
110 Ga0207648_10315464 3300026089 Bacteria 1404
111 Ga0207648_10382098 3300026089 Unclassified 1273
112 Ga0207648_10487605 3300026089 Bacteria 1126
113 Ga0207648_11394277 3300026089 Bacteria 659
114 Ga0207674_11237486 3300026116 Unclassified 716
115 Ga0207698_10118530 3300026142 Bacteria 2235
116 Ga0268265_10125085 3300028380 Bacteria 2126
117 Ga0268264_10003170 3300028381 Bacteria 14246
118 Ga0268264_10220823 3300028381 Bacteria 1744
119 Ga0265336_10019541 3300028666 Bacteria 2185
120 Ga0265338_10299751 3300028800 Bacteria 1169
121 Ga0265327_10000055 3300031251 Bacteria 247188
122 Ga0265327_10300394 3300031251 Unclassified 707
123 Ga0265313_10067584 3300031595 Bacteria 1653
124 Ga0307508_10035059 3300031616 Bacteria 4523
125 Ga0307508_10637715 3300031616 Bacteria 670
126 Ga0316576_10617203 3300031727 Bacteria 791
127 Ga0307516_10001627 3300031730 Bacteria 30950
128 Ga0307407_11158435 3300031903 Bacteria 603
129 Ga0307510_10058747 3300033180 Bacteria 3978
130 Ga0395905_0000001 3300037471 Bacteria 2037079
131 Ga0395905_0001075 3300037471 Bacteria 34404
132 Ga0395905_0706390 3300037471 Unclassified 911
133 Ga0451804_0885850 3300041463 Bacteria 768
134 Ga0451849_0535928 3300041505 Bacteria 1161
135 Ga0451843_0659567 3300041509 Bacteria 790
136 Ga0439431_0098487 3300041997 Bacteria 802
137 Ga0451577_0001069 3300042876 Bacteria 39336
138 Ga0451577_0008198 3300042876 Bacteria 10186
139 Ga0453683_0041896 3300044673 Bacteria 2875
140 Ga0466966_0189092 3300044684 Bacteria 1248
141 Ga0466961_0063102 3300044693 Bacteria 2354
142 Ga0453684_0000143 3300044712 Bacteria 315998
143 Ga0453684_0007774 3300044712 Bacteria 19563
144 Ga0453684_0031155 3300044712 Bacteria 7505
145 Ga0453684_1495307 3300044712 Bacteria 697
146 Ga0466971_0099787 3300044719 Bacteria 1333
147 Ga0466959_0006566 3300045049 Bacteria 8073
148 Ga0466959_0533618 3300045049 Bacteria 792
149 Ga0451576_0000002 3300045051 Bacteria 1670975
150 Ga0451576_0029769 3300045051 Bacteria 5841
151 Ga0451576_0164892 3300045051 Bacteria 2312
152 Ga0451576_2428817 3300045051 Bacteria 536
153 Ga0466958_0100296 3300045836 Bacteria 1800
154 Ga0466967_0051499 3300045976 Bacteria 3609
155 Ga0495607_0007871 3300046501 Bacteria 7333
156 Ga0495616_0002865 3300046513 Bacteria 11255
157 Ga0495643_0001089 3300046522 Bacteria 27032
158 Ga0495668_0000453 3300046616 Bacteria 52477
159 Ga0495668_0001556 3300046616 Bacteria 21755
160 Ga0496116_0001232 3300048919 Bacteria 29803
161 Ga0496117_0100984 3300048920 Bacteria 1826
162 Ga0496122_0004988 3300048925 Bacteria 16061
163 Ga0496122_0208720 3300048925 Bacteria 1134
164 Ga0496123_0004042 3300048926 Bacteria 15814
165 Ga0496124_0253987 3300048927 Bacteria 1298
166 Ga0496126_0253155 3300048929 Bacteria 1467
167 Ga0501298_047906 3300049521 Unclassified 880
168 Ga0501319_018015 3300049535 Bacteria 616
169 Ga0501031_0003536 3300049568 Bacteria 10030
170 Ga0501032_0001517 3300049569 Bacteria 18541
171 Ga0501032_0007698 3300049569 Bacteria 7853
172 Ga0501032_0092026 3300049569 Bacteria 2012
173 Ga0501033_0000199 3300049570 Bacteria 57341
174 Ga0501034_0000506 3300049571 Bacteria 62858
175 Ga0501034_0038565 3300049571 Bacteria 4837
176 Ga0501036_0634147 3300049572 Bacteria 885
177 Ga0501037_0001000 3300049573 Bacteria 20955
178 Ga0501038_0007066 3300049574 Bacteria 10367
179 Ga0501039_0002895 3300049575 Bacteria 12839
180 Ga0501043_0011713 3300049579 Bacteria 6866
181 Ga0501047_0017624 3300049581 Bacteria 6844
182 Ga0501047_0120394 3300049581 Bacteria 2507
183 Ga0501047_0657993 3300049581 Bacteria 867
184 Ga0501048_0316831 3300049582 Bacteria 1111
185 Ga0501070_0263881 3300049586 Bacteria 1407
186 Ga0501208_018137 3300049655 Unclassified 1118
187 Ga0501217_127614 3300049661 Unclassified 743
188 Ga0501233_060959 3300049668 Unclassified 936
189 Ga0501242_017749 3300049674 Unclassified 900
190 Ga0501252_063029 3300049682 Bacteria 583
191 Ga0501219_000190 3300049703 Bacteria 11301
192 Ga0501225_0016301 3300049705 Bacteria 2066
193 Ga0501241_013613 3300049758 Bacteria 1478
194 Ga0501269_004089 3300049766 Bacteria 1754
195 Ga0501279_065108 3300049775 Unclassified 604
196 Ga0501035_0001435 3300049822 Bacteria 24437
197 Ga0501044_0005001 3300049823 Bacteria 14799
198 Ga0501044_0113619 3300049823 Bacteria 2715
199 Ga0501045_0000745 3300049824 Bacteria 20812
200 Ga0501284_00001 3300050005 Bacteria 261916
201 nmdc:mga0k408_265391_c1 3300050493 Bacteria 1025
202 Ga0500646_0041009 3300053090 Bacteria 1303
203 Ga0500583_0439482 3300053092 Unclassified 621
204 Ga0500641_0354932 3300053096 Unclassified 588
205 Ga0500642_0006953 3300053130 Bacteria 3770
206 Ga0500568_0052903 3300053139 Bacteria 1593
207 Ga0500568_0137726 3300053139 Unclassified 905
208 Ga0500588_0072264 3300053146 Bacteria 1134
209 Ga0500604_0039184 3300053151 Bacteria 1424
210 Ga0500616_0000698 3300053153 Bacteria 39124
211 Ga0500616_0013026 3300053153 Bacteria 4844
212 Ga0500645_044919 3300053730 Bacteria 1299
213 2722730275 2721755487 Bacteria 6357185
214 2842904020 2842903701 Bacteria 6986368
215 2881958477 2881955468 Bacteria 3545609
216 2884792412 2884791551 Bacteria 8511252
217 2890737913 2890737413 Bacteria 4269751
218 2896089422 2896085136 Bacteria 6129793
219 2898715813 2898713307 Bacteria 4110805
220 2904783909 2904780799 Bacteria 5840761
221 2919181847 2919177583 Bacteria 5641607
222 2919513067 2919509842 Bacteria 4104664
223 2929924801 2929921140 Bacteria 8649150
224 2958514308 2958512119 Bacteria 4528530
225 3003237356 3003233435 Bacteria 4458031
226 8003156288 8003151029 Bacteria 8187759
227 8055590789 8055588893 Bacteria 3619545
228 Ga0068868_100146193
229 SwRhRL2b_contig_926693
230 JGI24740J21852_10014395
231 JGI24739J22299_10024895
232 JGI25154J39366_1000028
233 JGI25406J46586_10025379
234 JGI25153J46596_10014697
235 rootH1_10124579
236 rootH2_10007492
237 rootH2_10022397
238 rootH2_10073496
239 rootH2_10142132
240 rootH2_10157649
241 rootH2_10217478
242 rootL2_10005737
243 rootL2_10117241
244 rootL2_10187408
245 rootH1_10113762
246 JGI25160J50197_1005183
247 Ga0055526_1020629
248 Ga0055528_1000029
249 Ga0055530_10000263
250 Ga0055531_10030702
251 Ga0065165_1000052
252 Ga0065165_1085186
253 Ga0065714_10081370
254 Ga0065714_10285312
255 Ga0065704_10091552
256 Ga0065704_10116858
257 Ga0065715_10674515
258 Ga0070658_10491938
259 Ga0070670_100346855
260 Ga0070669_100840422
261 Ga0070667_101658795
262 Ga0068867_100898109
263 Ga0068867_101256511
264 Ga0070672_100113845
265 Ga0070693_100024496
266 Ga0070693_101416342
267 Ga0070664_101579463
268 Ga0068857_100732738
269 Ga0068857_101347225
270 Ga0068856_100162199
271 Ga0068859_100581535
272 Ga0068859_101388149
273 Ga0068864_100318304
274 Ga0068861_100641200
275 Ga0068851_10214075
276 Ga0068863_101941422
277 Ga0068860_100020477
278 Ga0068860_100052540
279 Ga0068860_100639071
280 Ga0081455_10184066
281 Ga0081539_10000603
282 Ga0075366_10066876
283 Ga0097621_101412984
284 Ga0075434_101516366
285 Ga0068865_100381155
286 Ga0097620_100581520
287 Ga0097620_101388322
288 Ga0105240_10012951
289 Ga0105240_11387036
290 Ga0105243_10000109
291 Ga0105238_10576315
292 Ga0105249_10968298
293 Ga0105239_11069197
294 Ga0105239_11661957
295 Ga0105246_10436877
296 Ga0105246_10980509
297 Ga0157371_10059689
298 Ga0157371_10132637
299 Ga0157371_10596976
300 Ga0157370_10000732
301 Ga0157370_10160213
302 Ga0157370_10238895
303 Ga0163162_10016980
304 Ga0163162_10424190
305 Ga0157372_10002580
306 Ga0157372_10764007
307 Ga0157372_11618697
308 Ga0157375_11864237
309 Ga0209646_1000006
310 Ga0209026_1000185
311 Ga0209673_1000187
312 Ga0209675_1045099
313 Ga0209564_1001813
314 Ga0209564_1005716
315 Ga0209564_1007107
316 Ga0209758_1009754
317 Ga0209050_1000259
318 Ga0207426_1000209
319 Ga0207426_1001796
320 Ga0209051_1088540
321 Ga0209257_1013061
322 Ga0207647_10657525
323 Ga0207654_10518873
324 Ga0207695_10062807
325 Ga0207657_10011243
326 Ga0207681_10275426
327 Ga0207681_10717552
328 Ga0207694_10529878
329 Ga0207659_10076459
330 Ga0207709_10000072
331 Ga0207691_11023012
332 Ga0207640_10136490
333 Ga0207678_10781807
334 Ga0207702_10020152
335 Ga0207641_10817126
336 Ga0207641_11612676
337 Ga0207648_10315464
338 Ga0207648_10382098
339 Ga0207648_10487605
340 Ga0207648_11394277
341 Ga0207674_11237486
342 Ga0207698_10118530
343 Ga0268265_10125085
344 Ga0268264_10003170
345 Ga0268264_10220823
346 Ga0265336_10019541
347 Ga0265338_10299751
348 Ga0265327_10000055
349 Ga0265327_10300394
350 Ga0265313_10067584
351 Ga0307508_10035059
352 Ga0307508_10637715
353 Ga0316576_10617203
354 Ga0307516_10001627
355 Ga0307407_11158435
356 Ga0307510_10058747
357 Ga0395905_0000001
358 Ga0395905_0001075
359 Ga0395905_0706390
360 Ga0451804_0885850
361 Ga0451849_0535928
362 Ga0451843_0659567
363 Ga0439431_0098487
364 Ga0451577_0001069
365 Ga0451577_0008198
366 Ga0453683_0041896
367 Ga0466966_0189092
368 Ga0466961_0063102
369 Ga0453684_0000143
370 Ga0453684_0007774
371 Ga0453684_0031155
372 Ga0453684_1495307
373 Ga0466971_0099787
374 Ga0466959_0006566
375 Ga0466959_0533618
376 Ga0451576_0000002
377 Ga0451576_0029769
378 Ga0451576_0164892
379 Ga0451576_2428817
380 Ga0466958_0100296
381 Ga0466967_0051499
382 Ga0495607_0007871
383 Ga0495616_0002865
384 Ga0495643_0001089
385 Ga0495668_0000453
386 Ga0495668_0001556
387 Ga0496116_0001232
388 Ga0496117_0100984
389 Ga0496122_0004988
390 Ga0496122_0208720
391 Ga0496123_0004042
392 Ga0496124_0253987
393 Ga0496126_0253155
394 Ga0501298_047906
395 Ga0501319_018015
396 Ga0501031_0003536
397 Ga0501032_0001517
398 Ga0501032_0007698
399 Ga0501032_0092026
400 Ga0501033_0000199
401 Ga0501034_0000506
402 Ga0501034_0038565
403 Ga0501036_0634147
404 Ga0501037_0001000
405 Ga0501038_0007066
406 Ga0501039_0002895
407 Ga0501043_0011713
408 Ga0501047_0017624
409 Ga0501047_0120394
410 Ga0501047_0657993
411 Ga0501048_0316831
412 Ga0501070_0263881
413 Ga0501208_018137
414 Ga0501217_127614
415 Ga0501233_060959
416 Ga0501242_017749
417 Ga0501252_063029
418 Ga0501219_000190
419 Ga0501225_0016301
420 Ga0501241_013613
421 Ga0501269_004089
422 Ga0501279_065108
423 Ga0501035_0001435
424 Ga0501044_0005001
425 Ga0501044_0113619
426 Ga0501045_0000745
427 Ga0501284_00001
428 nmdc:mga0k408_265391_c1
429 Ga0500646_0041009
430 Ga0500583_0439482
431 Ga0500641_0354932
432 Ga0500642_0006953
433 Ga0500568_0052903
434 Ga0500568_0137726
435 Ga0500588_0072264
436 Ga0500604_0039184
437 Ga0500616_0000698
438 Ga0500616_0013026
439 Ga0500645_044919
440 2722730275
441 2842904020
442 2881958477
443 2884792412
444 2890737913
445 2896089422
446 2898715813
447 2904783909
448 2919181847
449 2919513067
450 2929924801
451 2958514308
452 3003237356
453 8003156288
454 8055590789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

18

138

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.959 7 134
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.945 7 139
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.9049 7 134
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.8997 7 139
5nq6-assembly1.cif.gz_A crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution 0.8988 7 134
ID Description Score Start End Superfamily
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.959 7 134 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.944 17 138 3.90.1010.10
af_O96155_92_241_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9269 6 132 3.90.1010.10
af_Q10RM2_1_106_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9253 37 139 3.90.1010.10
af_Q6K258_62_207_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8972 2 133 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A0S7E6L7-F1-model_v4 Fe-S metabolism protein SufE 1.004 1 139
AF-A0A495MLM1-F1-model_v4 Cysteine desulfuration protein SufE 1.002 1 139
AF-A0A7K1GQV2-F1-model_v4 SufE family protein 1.002 1 139
AF-A0A385BMH8-F1-model_v4 Cysteine desulfuration protein SufE 1.002 2 138
AF-A0A7Y7NFQ1-F1-model_v4 SufE family protein 1.002 1 138

Map