F340069

General Info

Members Datasets Scaffolds Average Seq Length
227 124 227 181

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10020913|Ga0265338_100209132
Length 214
Sequence VHRGCFELGQLALRHRPVLVFLNGADARPLLQIIKFVAKNIVYFDLETQKSADEVGGWNHIAKMGMSLGVTFSTARGDYTVYGEKQVNDLITDLQRADLVVGFNVLRFDYEVLHGYTAYDLRQLPTLDMMVELQNTLQHRLSLDSIATATFGVEKTAEGLQAIRWFKDGKLAEIAEYCCYDVKLTKLVHEYGQRHRQLHYQNRFGKKMTVPVSW

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
73 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
77 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016329 3300003320 Bacteria 7528
2 Ga0065707_10440607 3300005295 Unclassified 810
3 Ga0070690_100217784 3300005330 Unclassified 1336
4 Ga0068868_100096426 3300005338 Unclassified 2389
5 Ga0070691_10032422 3300005341 Bacteria 2455
6 Ga0070692_10627264 3300005345 Bacteria 715
7 Ga0070688_100016494 3300005365 Bacteria 4224
8 Ga0070701_10015156 3300005438 Unclassified 3552
9 Ga0070711_100001668 3300005439 Bacteria 12290
10 Ga0070694_100005133 3300005444 Bacteria 7894
11 Ga0070694_100663421 3300005444 Bacteria 845
12 Ga0070685_10088102 3300005466 Bacteria 1874
13 Ga0070685_10112303 3300005466 Unclassified 1681
14 Ga0070707_100374613 3300005468 Unclassified 1383
15 Ga0070684_101139250 3300005535 Bacteria 733
16 Ga0070686_100079532 3300005544 Unclassified 2167
17 Ga0070686_100811962 3300005544 Unclassified 755
18 Ga0070704_100040457 3300005549 Unclassified 3209
19 Ga0068855_100079934 3300005563 Bacteria 3791
20 Ga0068855_100260967 3300005563 Bacteria 1930
21 Ga0068857_100135014 3300005577 Unclassified 2227
22 Ga0068856_100000172 3300005614 Bacteria 67506
23 Ga0068856_100154416 3300005614 Bacteria 2305
24 Ga0070702_100069356 3300005615 Unclassified 2077
25 Ga0070702_100403861 3300005615 Unclassified 978
26 Ga0068859_100012090 3300005617 Bacteria 8675
27 Ga0068859_100239969 3300005617 Bacteria 1901
28 Ga0068859_100295484 3300005617 Unclassified 1713
29 Ga0068859_100388027 3300005617 Unclassified 1492
30 Ga0068864_100417828 3300005618 Unclassified 1277
31 Ga0068864_100537288 3300005618 Bacteria 1129
32 Ga0068863_100188429 3300005841 Bacteria 1982
33 Ga0068863_100342133 3300005841 Bacteria 1455
34 Ga0068858_100175821 3300005842 Bacteria 2020
35 Ga0097621_100139447 3300006237 Unclassified 2071
36 Ga0068871_100014149 3300006358 Bacteria 5937
37 Ga0075434_100216958 3300006871 Bacteria 1933
38 Ga0097620_100012090 3300006931 Bacteria 8675
39 Ga0097620_100239983 3300006931 Bacteria 1901
40 Ga0097620_100295492 3300006931 Unclassified 1713
41 Ga0097620_100388041 3300006931 Unclassified 1492
42 Ga0099794_10235075 3300007265 Unclassified 943
43 Ga0105240_10331994 3300009093 Bacteria 1730
44 Ga0105240_10901816 3300009093 Bacteria 951
45 Ga0111539_10063474 3300009094 Bacteria 4371
46 Ga0111539_10079744 3300009094 Bacteria 3851
47 Ga0111539_10100167 3300009094 Bacteria 3402
48 Ga0111539_10126833 3300009094 Bacteria 2989
49 Ga0111539_11021787 3300009094 Bacteria 961
50 Ga0105245_10206054 3300009098 Unclassified 1891
51 Ga0105248_10511910 3300009177 Bacteria 1353
52 Ga0105238_10001833 3300009551 Bacteria 21297
53 Ga0105249_10212758 3300009553 Bacteria 1898
54 Ga0157375_10231555 3300013308 Bacteria 2007
55 Ga0157375_11511688 3300013308 Bacteria 793
56 Ga0163163_10212306 3300014325 Bacteria 1985
57 Ga0157377_10081975 3300014745 Bacteria 1888
58 Ga0207695_10011036 3300025913 Bacteria 10977
59 Ga0207695_10273406 3300025913 Bacteria 1585
60 Ga0207695_10672233 3300025913 Bacteria 916
61 Ga0207663_10002293 3300025916 Bacteria 9163
62 Ga0207646_10387852 3300025922 Unclassified 1262
63 Ga0207646_10557731 3300025922 Bacteria 1030
64 Ga0207694_10004426 3300025924 Bacteria 10983
65 Ga0207686_10379792 3300025934 Unclassified 1071
66 Ga0207670_11018569 3300025936 Unclassified 697
67 Ga0207667_10027261 3300025949 Bacteria 6223
68 Ga0207667_10452124 3300025949 Bacteria 1305
69 Ga0207712_10771114 3300025961 Bacteria 844
70 Ga0207703_10126308 3300026035 Bacteria 2203
71 Ga0207702_10000407 3300026078 Bacteria 49121
72 Ga0207702_10067839 3300026078 Bacteria 3062
73 Ga0207702_10071799 3300026078 Bacteria 2982
74 Ga0207641_10163523 3300026088 Bacteria 2025
75 Ga0207641_10772367 3300026088 Bacteria 949
76 Ga0207676_10082078 3300026095 Bacteria 2621
77 Ga0207674_10058126 3300026116 Bacteria 3919
78 Ga0207674_10143156 3300026116 Unclassified 2350
79 Ga0207683_10290061 3300026121 Bacteria 1496
80 Ga0207428_10280285 3300027907 Bacteria 1237
81 Ga0268265_10503927 3300028380 Bacteria 1141
82 Ga0265337_1002204 3300028556 Bacteria 9070
83 Ga0265337_1002985 3300028556 Bacteria 7504
84 Ga0265337_1003245 3300028556 Bacteria 7109
85 Ga0265337_1004707 3300028556 Bacteria 5607
86 Ga0265337_1008456 3300028556 Unclassified 3742
87 Ga0265337_1024296 3300028556 Unclassified 1855
88 Ga0265337_1036647 3300028556 Bacteria 1430
89 Ga0265326_10039021 3300028558 Bacteria 1349
90 Ga0265319_1000004 3300028563 Bacteria 305085
91 Ga0265334_10018511 3300028573 Bacteria 2871
92 Ga0265318_10026566 3300028577 Bacteria 2279
93 Ga0265318_10166148 3300028577 Unclassified 809
94 Ga0265323_10000301 3300028653 Bacteria 28570
95 Ga0265323_10004562 3300028653 Bacteria 5964
96 Ga0265323_10021961 3300028653 Bacteria 2442
97 Ga0265323_10037703 3300028653 Bacteria 1770
98 Ga0265322_10006312 3300028654 Bacteria 3487
99 Ga0265336_10000653 3300028666 Bacteria 18863
100 Ga0265336_10011492 3300028666 Bacteria 3006
101 Ga0265336_10011970 3300028666 Bacteria 2933
102 Ga0265336_10048104 3300028666 Bacteria 1293
103 Ga0265338_10000197 3300028800 Bacteria 113587
104 Ga0265338_10001091 3300028800 Bacteria 45113
105 Ga0265338_10001253 3300028800 Bacteria 41843
106 Ga0265338_10003009 3300028800 Bacteria 24342
107 Ga0265338_10003617 3300028800 Bacteria 21551
108 Ga0265338_10009171 3300028800 Bacteria 11867
109 Ga0265338_10013272 3300028800 Bacteria 9317
110 Ga0265338_10020913 3300028800 Bacteria 6850
111 Ga0265338_10021607 3300028800 Bacteria 6704
112 Ga0265338_10026052 3300028800 Bacteria 5912
113 Ga0265338_10033180 3300028800 Bacteria 5016
114 Ga0265338_10048422 3300028800 Bacteria 3866
115 Ga0265338_10054098 3300028800 Bacteria 3583
116 Ga0265338_10210165 3300028800 Bacteria 1461
117 Ga0265338_10217014 3300028800 Bacteria 1431
118 Ga0265338_10255794 3300028800 Bacteria 1290
119 Ga0265338_10288313 3300028800 Unclassified 1197
120 Ga0265338_10477557 3300028800 Unclassified 880
121 Ga0265338_10534490 3300028800 Bacteria 822
122 Ga0265324_10000637 3300029957 Bacteria 23808
123 Ga0265324_10002564 3300029957 Bacteria 9174
124 Ga0265324_10011492 3300029957 Bacteria 3371
125 Ga0265324_10011964 3300029957 Unclassified 3290
126 Ga0265324_10019740 3300029957 Bacteria 2426
127 Ga0265324_10039648 3300029957 Bacteria 1633
128 Ga0265324_10068356 3300029957 Unclassified 1211
129 Ga0265320_10000082 3300031240 Bacteria 81536
130 Ga0265320_10000329 3300031240 Bacteria 38767
131 Ga0265320_10013570 3300031240 Bacteria 4680
132 Ga0265340_10015340 3300031247 Unclassified 3981
133 Ga0265340_10018215 3300031247 Bacteria 3624
134 Ga0265339_10035585 3300031249 Unclassified 2792
135 Ga0265339_10107711 3300031249 Bacteria 1445
136 Ga0265327_10000767 3300031251 Bacteria 49654
137 Ga0265327_10029234 3300031251 Bacteria 3138
138 Ga0265327_10030032 3300031251 Bacteria 3081
139 Ga0265327_10085167 3300031251 Bacteria 1552
140 Ga0265316_10001202 3300031344 Bacteria 28008
141 Ga0265316_10004708 3300031344 Bacteria 13516
142 Ga0265316_10060547 3300031344 Bacteria 2942
143 Ga0265316_10082646 3300031344 Bacteria 2461
144 Ga0265316_10155164 3300031344 Unclassified 1713
145 Ga0265316_10157107 3300031344 Bacteria 1701
146 Ga0265313_10024829 3300031595 Bacteria 3190
147 Ga0265313_10106517 3300031595 Bacteria 1237
148 Ga0265314_10299026 3300031711 Bacteria 904
149 Ga0265342_10133918 3300031712 Bacteria 1387
150 Ga0265342_10242637 3300031712 Bacteria 964
151 Ga0373928_0000600 3300035084 Bacteria 7085
152 Ga0373929_0000194 3300035085 Bacteria 10890
153 Ga0373940_0162169 3300035088 Bacteria 718
154 Ga0373944_0002247 3300035089 Bacteria 4912
155 Ga0373949_0003644 3300035090 Bacteria 3617
156 Ga0373951_0001481 3300035091 Bacteria 6126
157 Ga0373932_0000004 3300035112 Bacteria 412176
158 Ga0373954_0004753 3300035118 Bacteria 5854
159 Ga0373956_0000803 3300035119 Bacteria 13060
160 Ga0373955_0088333 3300035172 Bacteria 1763
161 Ga0373962_0000711 3300035242 Bacteria 7534
162 Ga0373931_0000036 3300035691 Bacteria 79351
163 Ga0373935_0029326 3300035692 Bacteria 3405
164 Ga0373927_0007088 3300035695 Bacteria 7603
165 Ga0373927_0033773 3300035695 Bacteria 3329
166 Ga0373933_0103221 3300035724 Bacteria 1771
167 Ga0373947_0040920 3300035725 Bacteria 2762
168 Ga0373937_0005334 3300036401 Bacteria 10991
169 Ga0373937_0179136 3300036401 Bacteria 1990
170 Ga0373925_0000171 3300037068 Bacteria 70398
171 Ga0373925_0008554 3300037068 Bacteria 7458
172 Ga0451577_0058024 3300042876 Bacteria 3450
173 Ga0451577_0192759 3300042876 Bacteria 1839
174 Ga0451576_1516165 3300045051 Unclassified 696
175 Ga0495592_0000652 3300046454 Bacteria 24071
176 Ga0495592_0283110 3300046454 Unclassified 1084
177 Ga0495592_0485732 3300046454 Unclassified 769
178 Ga0495629_0098445 3300046459 Bacteria 2040
179 Ga0495651_0254079 3300046462 Bacteria 1199
180 Ga0495580_0432894 3300046472 Unclassified 884
181 Ga0495662_0006017 3300046476 Bacteria 6063
182 Ga0495608_0269376 3300046511 Unclassified 1059
183 Ga0495618_0006304 3300046514 Bacteria 7201
184 Ga0495618_0013412 3300046514 Bacteria 4986
185 Ga0495628_0000531 3300046516 Bacteria 34883
186 Ga0495628_0131248 3300046516 Bacteria 1916
187 Ga0495630_0029357 3300046517 Bacteria 4089
188 Ga0495630_0049675 3300046517 Unclassified 3139
189 Ga0495630_0092237 3300046517 Bacteria 2289
190 Ga0495630_0357472 3300046517 Bacteria 1118
191 Ga0495652_0400203 3300046529 Bacteria 972
192 Ga0495652_0455946 3300046529 Unclassified 894
193 Ga0495652_0474068 3300046529 Bacteria 872
194 Ga0495640_0191625 3300046533 Unclassified 1299
195 Ga0495586_0000466 3300046535 Bacteria 24211
196 Ga0495586_0008507 3300046535 Bacteria 5460
197 Ga0495645_0062439 3300046543 Bacteria 2698
198 Ga0495645_0502668 3300046543 Unclassified 757
199 Ga0495622_0156042 3300046557 Bacteria 1031
200 Ga0495667_0042812 3300046559 Bacteria 3002
201 Ga0495667_0051406 3300046559 Bacteria 2719
202 Ga0495667_0125643 3300046559 Bacteria 1655
203 Ga0495634_0000368 3300046642 Bacteria 43985
204 Ga0495613_0001517 3300046689 Bacteria 17654
205 Ga0495604_0188954 3300047317 Bacteria 1437
206 Ga0495674_0062688 3300047319 Bacteria 3236
207 Ga0495674_0201874 3300047319 Bacteria 1649
208 Ga0495680_0001444 3300047322 Bacteria 25623
209 Ga0495675_0574665 3300047444 Unclassified 641
210 Ga0496125_0000017 3300048928 Bacteria 508217
211 Ga0501031_0000093 3300049568 Bacteria 47816
212 Ga0501031_0165588 3300049568 Bacteria 1445
213 Ga0501032_0136448 3300049569 Bacteria 1617
214 Ga0501033_0001521 3300049570 Bacteria 20493
215 Ga0501036_0368357 3300049572 Bacteria 1199
216 Ga0501037_0062354 3300049573 Unclassified 2718
217 Ga0501043_0119681 3300049579 Bacteria 2065
218 Ga0501043_0135258 3300049579 Bacteria 1931
219 Ga0501043_0242647 3300049579 Bacteria 1389
220 Ga0501035_0006916 3300049822 Bacteria 10594
221 Ga0501035_0057422 3300049822 Unclassified 3470
222 Ga0501044_0000089 3300049823 Bacteria 112278
223 nmdc:mga08y16_26813_c1 3300050511 Bacteria 6072
224 nmdc:mga08y16_500242_c1 3300050511 Bacteria 1235
225 nmdc:mga08y16_63348_c1 3300050511 Bacteria 3861
226 Ga0495601_0640243 3300053077 Unclassified 680
227 Ga0500556_0008817 3300053104 Bacteria 2916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0000017 Ga0496125_0000017_356468_357010 176
2 3300053104 Ga0500556_0008817 Ga0500556_0008817_1886_2422 176
3 3300005330 Ga0070690_100217784 Ga0070690_1002177843 177
4 3300005338 Ga0068868_100096426 Ga0068868_1000964263 177
5 3300005365 Ga0070688_100016494 Ga0070688_1000164942 177
6 3300005438 Ga0070701_10015156 Ga0070701_100151563 177
7 3300005439 Ga0070711_100001668 Ga0070711_10000166817 177
8 3300005444 Ga0070694_100005133 Ga0070694_1000051336 177
9 3300005444 Ga0070694_100663421 Ga0070694_1006634212 177
10 3300005466 Ga0070685_10088102 Ga0070685_100881022 177
11 3300005466 Ga0070685_10112303 Ga0070685_101123032 177
12 3300005468 Ga0070707_100374613 Ga0070707_1003746132 177
13 3300005544 Ga0070686_100079532 Ga0070686_1000795322 177
14 3300005544 Ga0070686_100811962 Ga0070686_1008119621 177
15 3300005549 Ga0070704_100040457 Ga0070704_1000404572 177
16 3300005563 Ga0068855_100079934 Ga0068855_1000799342 177
17 3300005577 Ga0068857_100135014 Ga0068857_1001350142 177
18 3300005614 Ga0068856_100000172 Ga0068856_10000017214 177
19 3300005615 Ga0070702_100069356 Ga0070702_1000693562 177
20 3300005615 Ga0070702_100403861 Ga0070702_1004038612 177
21 3300005617 Ga0068859_100295484 Ga0068859_1002954842 177
22 3300005617 Ga0068859_100388027 Ga0068859_1003880273 177
23 3300005841 Ga0068863_100342133 Ga0068863_1003421332 177
24 3300006237 Ga0097621_100139447 Ga0097621_1001394472 177
25 3300006358 Ga0068871_100014149 Ga0068871_1000141494 177
26 3300006931 Ga0097620_100295492 Ga0097620_1002954922 177
27 3300006931 Ga0097620_100388041 Ga0097620_1003880413 177
28 3300009093 Ga0105240_10901816 Ga0105240_109018162 177
29 3300009094 Ga0111539_10063474 Ga0111539_100634742 177
30 3300009094 Ga0111539_10100167 Ga0111539_101001672 177
31 3300009094 Ga0111539_11021787 Ga0111539_110217871 177
32 3300009098 Ga0105245_10206054 Ga0105245_102060542 177
33 3300009177 Ga0105248_10511910 Ga0105248_105119102 177
34 3300025913 Ga0207695_10672233 Ga0207695_106722332 177
35 3300025916 Ga0207663_10002293 Ga0207663_100022939 177
36 3300025922 Ga0207646_10387852 Ga0207646_103878522 177
37 3300025949 Ga0207667_10027261 Ga0207667_100272614 177
38 3300026078 Ga0207702_10000407 Ga0207702_1000040725 177
39 3300026088 Ga0207641_10772367 Ga0207641_107723671 177
40 3300026116 Ga0207674_10143156 Ga0207674_101431562 177
41 3300028556 Ga0265337_1003245 Ga0265337_100324510 177
42 3300028556 Ga0265337_1004707 Ga0265337_10047072 177
43 3300028556 Ga0265337_1024296 Ga0265337_10242963 177
44 3300028666 Ga0265336_10011492 Ga0265336_100114924 177
45 3300028666 Ga0265336_10048104 Ga0265336_100481042 177
46 3300028800 Ga0265338_10000197 Ga0265338_1000019714 177
47 3300028800 Ga0265338_10013272 Ga0265338_100132722 177
48 3300028800 Ga0265338_10021607 Ga0265338_100216078 177
49 3300028800 Ga0265338_10288313 Ga0265338_102883131 177
50 3300028800 Ga0265338_10477557 Ga0265338_104775572 177
51 3300028800 Ga0265338_10534490 Ga0265338_105344901 177
52 3300029957 Ga0265324_10002564 Ga0265324_100025642 177
53 3300029957 Ga0265324_10011492 Ga0265324_100114922 177
54 3300031247 Ga0265340_10015340 Ga0265340_100153402 177
55 3300031247 Ga0265340_10018215 Ga0265340_100182154 177
56 3300031249 Ga0265339_10107711 Ga0265339_101077112 177
57 3300031251 Ga0265327_10085167 Ga0265327_100851672 177
58 3300031344 Ga0265316_10004708 Ga0265316_100047088 177
59 3300031711 Ga0265314_10299026 Ga0265314_102990262 177
60 3300035172 Ga0373955_0088333 Ga0373955_0088333_511_1050 177
61 3300035695 Ga0373927_0007088 Ga0373927_0007088_7058_7591 177
62 3300037068 Ga0373925_0008554 Ga0373925_0008554_4619_5152 177
63 3300042876 Ga0451577_0058024 Ga0451577_0058024_1870_2409 177
64 3300042876 Ga0451577_0192759 Ga0451577_0192759_128_667 177
65 3300045051 Ga0451576_1516165 Ga0451576_1516165_104_643 177
66 3300046454 Ga0495592_0000652 Ga0495592_0000652_1763_2296 177
67 3300046454 Ga0495592_0485732 Ga0495592_0485732_132_671 177
68 3300046472 Ga0495580_0432894 Ga0495580_0432894_117_656 177
69 3300046476 Ga0495662_0006017 Ga0495662_0006017_2377_2910 177
70 3300046511 Ga0495608_0269376 Ga0495608_0269376_50_583 177
71 3300046514 Ga0495618_0006304 Ga0495618_0006304_165_698 177
72 3300046516 Ga0495628_0000531 Ga0495628_0000531_18302_18835 177
73 3300046517 Ga0495630_0029357 Ga0495630_0029357_2854_3393 177
74 3300046517 Ga0495630_0049675 Ga0495630_0049675_777_1310 177
75 3300046529 Ga0495652_0400203 Ga0495652_0400203_134_667 177
76 3300046533 Ga0495640_0191625 Ga0495640_0191625_741_1274 177
77 3300046535 Ga0495586_0008507 Ga0495586_0008507_1849_2382 177
78 3300046543 Ga0495645_0062439 Ga0495645_0062439_307_840 177
79 3300047319 Ga0495674_0062688 Ga0495674_0062688_2436_2969 177
80 3300047319 Ga0495674_0201874 Ga0495674_0201874_720_1259 177
81 3300049568 Ga0501031_0165588 Ga0501031_0165588_827_1360 177
82 3300049569 Ga0501032_0136448 Ga0501032_0136448_853_1386 177
83 3300049572 Ga0501036_0368357 Ga0501036_0368357_235_768 177
84 3300049573 Ga0501037_0062354 Ga0501037_0062354_206_739 177
85 3300049579 Ga0501043_0135258 Ga0501043_0135258_1277_1810 177
86 3300049579 Ga0501043_0242647 Ga0501043_0242647_218_751 177
87 3300049822 Ga0501035_0006916 Ga0501035_0006916_2333_2866 177
88 3300050511 nmdc:mga08y16_63348_c1 nmdc:mga08y16_63348_c1_2331_2876 177
89 3300003320 rootH2_10016329 rootH2_100163298 178
90 3300005295 Ga0065707_10440607 Ga0065707_104406072 178
91 3300005341 Ga0070691_10032422 Ga0070691_100324223 178
92 3300005345 Ga0070692_10627264 Ga0070692_106272641 178
93 3300005535 Ga0070684_101139250 Ga0070684_1011392502 178
94 3300005563 Ga0068855_100260967 Ga0068855_1002609672 178
95 3300005614 Ga0068856_100154416 Ga0068856_1001544162 178
96 3300005617 Ga0068859_100012090 Ga0068859_10001209010 178
97 3300005617 Ga0068859_100239969 Ga0068859_1002399692 178
98 3300005618 Ga0068864_100417828 Ga0068864_1004178282 178
99 3300005618 Ga0068864_100537288 Ga0068864_1005372882 178
100 3300005841 Ga0068863_100188429 Ga0068863_1001884291 178
101 3300005842 Ga0068858_100175821 Ga0068858_1001758211 178
102 3300006871 Ga0075434_100216958 Ga0075434_1002169582 178
103 3300006931 Ga0097620_100012090 Ga0097620_1000120902 178
104 3300006931 Ga0097620_100239983 Ga0097620_1002399832 178
105 3300007265 Ga0099794_10235075 Ga0099794_102350752 178
106 3300009093 Ga0105240_10331994 Ga0105240_103319943 178
107 3300009094 Ga0111539_10079744 Ga0111539_100797442 178
108 3300009094 Ga0111539_10126833 Ga0111539_101268332 178
109 3300009551 Ga0105238_10001833 Ga0105238_1000183314 178
110 3300009553 Ga0105249_10212758 Ga0105249_102127582 178
111 3300013308 Ga0157375_10231555 Ga0157375_102315551 178
112 3300013308 Ga0157375_11511688 Ga0157375_115116881 178
113 3300014325 Ga0163163_10212306 Ga0163163_102123062 178
114 3300014745 Ga0157377_10081975 Ga0157377_100819752 178
115 3300025913 Ga0207695_10011036 Ga0207695_100110366 178
116 3300025913 Ga0207695_10273406 Ga0207695_102734062 178
117 3300025922 Ga0207646_10557731 Ga0207646_105577312 178
118 3300025924 Ga0207694_10004426 Ga0207694_100044262 178
119 3300025934 Ga0207686_10379792 Ga0207686_103797921 178
120 3300025936 Ga0207670_11018569 Ga0207670_110185691 178
121 3300025949 Ga0207667_10452124 Ga0207667_104521242 178
122 3300025961 Ga0207712_10771114 Ga0207712_107711141 178
123 3300026035 Ga0207703_10126308 Ga0207703_101263083 178
124 3300026078 Ga0207702_10067839 Ga0207702_100678392 178
125 3300026078 Ga0207702_10071799 Ga0207702_100717991 178
126 3300026088 Ga0207641_10163523 Ga0207641_101635231 178
127 3300026095 Ga0207676_10082078 Ga0207676_100820781 178
128 3300026116 Ga0207674_10058126 Ga0207674_100581262 178
129 3300026121 Ga0207683_10290061 Ga0207683_102900612 178
130 3300027907 Ga0207428_10280285 Ga0207428_102802852 178
131 3300028380 Ga0268265_10503927 Ga0268265_105039272 178
132 3300028556 Ga0265337_1002204 Ga0265337_10022044 178
133 3300028556 Ga0265337_1002985 Ga0265337_10029852 178
134 3300028556 Ga0265337_1008456 Ga0265337_10084562 178
135 3300028556 Ga0265337_1036647 Ga0265337_10366472 178
136 3300028558 Ga0265326_10039021 Ga0265326_100390212 178
137 3300028563 Ga0265319_1000004 Ga0265319_1000004243 178
138 3300028573 Ga0265334_10018511 Ga0265334_100185111 178
139 3300028577 Ga0265318_10026566 Ga0265318_100265662 178
140 3300028577 Ga0265318_10166148 Ga0265318_101661481 178
141 3300028653 Ga0265323_10000301 Ga0265323_1000030121 178
142 3300028653 Ga0265323_10004562 Ga0265323_100045623 178
143 3300028653 Ga0265323_10021961 Ga0265323_100219612 178
144 3300028653 Ga0265323_10037703 Ga0265323_100377031 178
145 3300028654 Ga0265322_10006312 Ga0265322_100063122 178
146 3300028666 Ga0265336_10000653 Ga0265336_1000065312 178
147 3300028666 Ga0265336_10011970 Ga0265336_100119703 178
148 3300028800 Ga0265338_10001091 Ga0265338_100010915 178
149 3300028800 Ga0265338_10001253 Ga0265338_1000125322 178
150 3300028800 Ga0265338_10003009 Ga0265338_100030096 178
151 3300028800 Ga0265338_10003617 Ga0265338_1000361714 178
152 3300028800 Ga0265338_10009171 Ga0265338_100091713 178
153 3300028800 Ga0265338_10020913 Ga0265338_100209132 178
154 3300028800 Ga0265338_10026052 Ga0265338_100260522 178
155 3300028800 Ga0265338_10033180 Ga0265338_100331804 178
156 3300028800 Ga0265338_10048422 Ga0265338_100484226 178
157 3300028800 Ga0265338_10054098 Ga0265338_100540983 178
158 3300028800 Ga0265338_10210165 Ga0265338_102101652 178
159 3300028800 Ga0265338_10217014 Ga0265338_102170141 178
160 3300028800 Ga0265338_10255794 Ga0265338_102557942 178
161 3300029957 Ga0265324_10000637 Ga0265324_1000063713 178
162 3300029957 Ga0265324_10011964 Ga0265324_100119642 178
163 3300029957 Ga0265324_10019740 Ga0265324_100197402 178
164 3300029957 Ga0265324_10039648 Ga0265324_100396482 178
165 3300029957 Ga0265324_10068356 Ga0265324_100683562 178
166 3300031240 Ga0265320_10000082 Ga0265320_1000008216 178
167 3300031240 Ga0265320_10000329 Ga0265320_1000032913 178
168 3300031240 Ga0265320_10013570 Ga0265320_100135704 178
169 3300031249 Ga0265339_10035585 Ga0265339_100355852 178
170 3300031251 Ga0265327_10000767 Ga0265327_1000076729 178
171 3300031251 Ga0265327_10029234 Ga0265327_100292345 178
172 3300031251 Ga0265327_10030032 Ga0265327_100300323 178
173 3300031344 Ga0265316_10001202 Ga0265316_100012022 178
174 3300031344 Ga0265316_10060547 Ga0265316_100605472 178
175 3300031344 Ga0265316_10082646 Ga0265316_100826463 178
176 3300031344 Ga0265316_10155164 Ga0265316_101551642 178
177 3300031344 Ga0265316_10157107 Ga0265316_101571071 178
178 3300031595 Ga0265313_10024829 Ga0265313_100248295 178
179 3300031595 Ga0265313_10106517 Ga0265313_101065172 178
180 3300031712 Ga0265342_10133918 Ga0265342_101339182 178
181 3300031712 Ga0265342_10242637 Ga0265342_102426371 178
182 3300035084 Ga0373928_0000600 Ga0373928_0000600_2629_3171 178
183 3300035085 Ga0373929_0000194 Ga0373929_0000194_119_661 178
184 3300035088 Ga0373940_0162169 Ga0373940_0162169_155_697 178
185 3300035089 Ga0373944_0002247 Ga0373944_0002247_921_1463 178
186 3300035090 Ga0373949_0003644 Ga0373949_0003644_1674_2216 178
187 3300035091 Ga0373951_0001481 Ga0373951_0001481_1757_2299 178
188 3300035112 Ga0373932_0000004 Ga0373932_0000004_227312_227854 178
189 3300035118 Ga0373954_0004753 Ga0373954_0004753_3862_4407 178
190 3300035119 Ga0373956_0000803 Ga0373956_0000803_2330_2875 178
191 3300035242 Ga0373962_0000711 Ga0373962_0000711_3073_3615 178
192 3300035691 Ga0373931_0000036 Ga0373931_0000036_37158_37700 178
193 3300035692 Ga0373935_0029326 Ga0373935_0029326_848_1390 178
194 3300035695 Ga0373927_0033773 Ga0373927_0033773_1840_2382 178
195 3300035724 Ga0373933_0103221 Ga0373933_0103221_518_1054 178
196 3300035725 Ga0373947_0040920 Ga0373947_0040920_1075_1617 178
197 3300036401 Ga0373937_0005334 Ga0373937_0005334_3670_4215 178
198 3300036401 Ga0373937_0179136 Ga0373937_0179136_821_1357 178
199 3300037068 Ga0373925_0000171 Ga0373925_0000171_7977_8519 178
200 3300046454 Ga0495592_0283110 Ga0495592_0283110_335_883 178
201 3300046459 Ga0495629_0098445 Ga0495629_0098445_1352_1897 178
202 3300046462 Ga0495651_0254079 Ga0495651_0254079_177_713 178
203 3300046514 Ga0495618_0013412 Ga0495618_0013412_1843_2388 178
204 3300046516 Ga0495628_0131248 Ga0495628_0131248_997_1545 178
205 3300046517 Ga0495630_0092237 Ga0495630_0092237_1490_2026 178
206 3300046517 Ga0495630_0357472 Ga0495630_0357472_385_930 178
207 3300046529 Ga0495652_0455946 Ga0495652_0455946_258_806 178
208 3300046529 Ga0495652_0474068 Ga0495652_0474068_76_621 178
209 3300046535 Ga0495586_0000466 Ga0495586_0000466_6359_6904 178
210 3300046543 Ga0495645_0502668 Ga0495645_0502668_140_688 178
211 3300046557 Ga0495622_0156042 Ga0495622_0156042_136_672 178
212 3300046559 Ga0495667_0042812 Ga0495667_0042812_657_1193 178
213 3300046559 Ga0495667_0051406 Ga0495667_0051406_927_1475 178
214 3300046559 Ga0495667_0125643 Ga0495667_0125643_976_1521 178
215 3300046642 Ga0495634_0000368 Ga0495634_0000368_29675_30220 178
216 3300046689 Ga0495613_0001517 Ga0495613_0001517_14947_15492 178
217 3300047317 Ga0495604_0188954 Ga0495604_0188954_626_1162 178
218 3300047322 Ga0495680_0001444 Ga0495680_0001444_7653_8198 178
219 3300047444 Ga0495675_0574665 Ga0495675_0574665_30_572 178
220 3300049568 Ga0501031_0000093 Ga0501031_0000093_34802_35338 178
221 3300049570 Ga0501033_0001521 Ga0501033_0001521_12259_12795 178
222 3300049579 Ga0501043_0119681 Ga0501043_0119681_1348_1884 178
223 3300049822 Ga0501035_0057422 Ga0501035_0057422_220_756 178
224 3300049823 Ga0501044_0000089 Ga0501044_0000089_102806_103342 178
225 3300050511 nmdc:mga08y16_26813_c1 nmdc:mga08y16_26813_c1_367_915 178
226 3300050511 nmdc:mga08y16_500242_c1 nmdc:mga08y16_500242_c1_211_750 178
227 3300053077 Ga0495601_0640243 Ga0495601_0640243_71_619 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13482

RNase_H_2

RNase_H superfamily

42

193

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hah-assembly1.cif.gz_A crystal structure of paf - p-sulfonatocalix[6]arene complex 0.7869 158 175
6i8a-assembly2.cif.gz_B the crystal structure of the pol2 catalytic domain of dna polymerase epsilon carrying a p301r substitution. 0.7657 5 160
4m8o-assembly1.cif.gz_A ternary complex of dna polymerase epsilon with an incoming datp 0.7589 4 159
4pty-assembly1.cif.gz_D crystal structure of the escherichia coli alkanesulfonate fmn reductase ssue in apo form 0.758 51 66
6h1v-assembly1.cif.gz_A the crystal structure of pol2core in complex with dna and an incoming nucleotide, carrying an fe-s cluster 0.7568 4 160
ID Description Score Start End Superfamily
af_B7Z0E2_437_533_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8821 161 176 2.40.50.140
af_I1JTQ5_134_346_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8408 32 47 2.120.10.80
6hahA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Antifungal protein domain 0.7856 158 175 2.40.50.60
af_G5EEZ1_22_315_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.7663 31 47 2.130.10.30
af_Q65WV4_67_380_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7615 30 47 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A3M2AYF3-F1-model_v4 Helicase 0.9946 4 178 GO:0003676
GO:0004386
AF-A0A1V5YJR6-F1-model_v4 Putative 3'-5' exonuclease related to the exonuclease domain of PolB 0.9911 4 178 GO:0003676
GO:0004527
AF-A0A661V7W8-F1-model_v4 Helicase 0.9901 4 178 GO:0003676
GO:0004386
AF-A0A7V6Z0Y9-F1-model_v4 Helicase 0.9899 3 178 GO:0003676
GO:0004386
AF-A0A7W1CUT6-F1-model_v4 Polyketide cyclase 0.9898 126 178

Feature Viewer

pLDDT pTM Quality
95.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map