F340216

General Info

Members Datasets Scaffolds Average Seq Length
227 104 222 137

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0245793|Ga0451577_0245793_972_1409
Length 145
Sequence MGITMTMTVHVDVVSAEEQIFSGLAEVVVVPGEMGELGIYPRHTALMTRIKPGAVRIKSPDQEEEVLIYVSGGMLEVQPNVVTVLADTAIRGHDLDEARALEAKQAAEEALKNRTADLDLAQAXXXXAEAIAQLRAIQQLRKTTH

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
12 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
20 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
29 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
32 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
33 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
45 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
46 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
51 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
52 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
60 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
61 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
62 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
63 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
74 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
75 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
76 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.07
Metatranscriptomes 7.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 4.41
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100669944 3300005337 Bacteria 828
2 Ga0070689_101020448 3300005340 Bacteria 737
3 Ga0070671_100397905 3300005355 Bacteria 1178
4 Ga0070659_100096833 3300005366 Bacteria 2371
5 Ga0070663_100173261 3300005455 Bacteria 1669
6 Ga0070662_100100210 3300005457 Bacteria 2191
7 Ga0070662_101308133 3300005457 Bacteria 624
8 Ga0070679_101821242 3300005530 Unclassified 557
9 Ga0068853_100255892 3300005539 Bacteria 1608
10 Ga0068853_101060176 3300005539 Bacteria 781
11 Ga0068854_101682117 3300005578 Bacteria 580
12 Ga0068856_100202063 3300005614 Bacteria 2002
13 Ga0075366_10000391 3300006195 Bacteria 20363
14 Ga0075366_10140105 3300006195 Bacteria 1462
15 Ga0111539_10079682 3300009094 Bacteria 3853
16 Ga0111539_10881478 3300009094 Bacteria 1041
17 Ga0105242_10042536 3300009176 Bacteria 3669
18 Ga0105237_11349829 3300009545 Bacteria 719
19 Ga0105239_10343109 3300010375 Bacteria 1686
20 Ga0157373_10675082 3300013100 Unclassified 756
21 Ga0157374_10009986 3300013296 Bacteria 8151
22 Ga0157375_10107011 3300013308 Bacteria 2889
23 Ga0157377_10591102 3300014745 Bacteria 790
24 Ga0207707_11531454 3300025912 Bacteria 527
25 Ga0207662_10018444 3300025918 Bacteria 3960
26 Ga0207646_10727893 3300025922 Bacteria 886
27 Ga0207690_10476170 3300025932 Bacteria 1007
28 Ga0207706_10085395 3300025933 Bacteria 2775
29 Ga0207706_10406524 3300025933 Bacteria 1180
30 Ga0207706_10664370 3300025933 Bacteria 892
31 Ga0207702_10956233 3300026078 Bacteria 849
32 Ga0207683_10322838 3300026121 Bacteria 1414
33 Ga0209974_10228908 3300027876 Bacteria 694
34 Ga0207428_10059073 3300027907 Bacteria 3041
35 Ga0265336_10000584 3300028666 Bacteria 20549
36 Ga0265338_10454640 3300028800 Bacteria 906
37 Ga0265324_10000018 3300029957 Bacteria 184238
38 Ga0265324_10001353 3300029957 Bacteria 14301
39 Ga0265324_10039556 3300029957 Bacteria 1635
40 Ga0265324_10048081 3300029957 Bacteria 1467
41 Ga0265332_10049861 3300031238 Bacteria 1799
42 Ga0265328_10036706 3300031239 Bacteria 1811
43 Ga0265328_10076476 3300031239 Bacteria 1232
44 Ga0265325_10000035 3300031241 Bacteria 99051
45 Ga0265325_10041218 3300031241 Bacteria 2420
46 Ga0265331_10000259 3300031250 Bacteria 60879
47 Ga0265331_10001923 3300031250 Bacteria 14557
48 Ga0265331_10003137 3300031250 Bacteria 10796
49 Ga0265331_10013855 3300031250 Bacteria 4316
50 Ga0265331_10022556 3300031250 Bacteria 3211
51 Ga0265331_10042424 3300031250 Bacteria 2206
52 Ga0265331_10260600 3300031250 Bacteria 777
53 Ga0265327_10000250 3300031251 Bacteria 107090
54 Ga0265327_10000502 3300031251 Bacteria 67878
55 Ga0265327_10000595 3300031251 Bacteria 60289
56 Ga0265327_10003486 3300031251 Bacteria 14963
57 Ga0265327_10006387 3300031251 Bacteria 9441
58 Ga0265327_10011810 3300031251 Bacteria 5969
59 Ga0265327_10149414 3300031251 Bacteria 1086
60 Ga0265316_10149799 3300031344 Bacteria 1748
61 Ga0265316_10821113 3300031344 Bacteria 651
62 Ga0316575_10000484 3300031665 Bacteria 11516
63 Ga0316575_10171292 3300031665 Bacteria 900
64 Ga0316579_10052653 3300031691 Bacteria 1906
65 Ga0316579_10070293 3300031691 Bacteria 1658
66 Ga0265314_10005275 3300031711 Bacteria 11697
67 Ga0265314_10042586 3300031711 Bacteria 3237
68 Ga0316576_10005316 3300031727 Bacteria 7847
69 Ga0316576_10005400 3300031727 Bacteria 7804
70 Ga0316576_10026802 3300031727 Bacteria 4048
71 Ga0316576_10065614 3300031727 Bacteria 2668
72 Ga0316576_10118542 3300031727 Bacteria 1987
73 Ga0316578_10025148 3300031728 Bacteria 3345
74 Ga0316578_10030334 3300031728 Bacteria 3073
75 Ga0316578_10359780 3300031728 Bacteria 866
76 Ga0316578_10835581 3300031728 Bacteria 533
77 Ga0316577_10006165 3300031733 Bacteria 6323
78 Ga0316577_10626684 3300031733 Unclassified 612
79 Ga0316585_10007973 3300032137 Bacteria 3063
80 Ga0316580_10197213 3300032139 Bacteria 620
81 Ga0316580_10280145 3300032139 Bacteria 517
82 Ga0316593_10015316 3300032168 Bacteria 2304
83 Ga0316593_10026342 3300032168 Bacteria 1858
84 Ga0316593_10034181 3300032168 Bacteria 1667
85 Ga0316593_10061875 3300032168 Bacteria 1281
86 Ga0316593_10166290 3300032168 Bacteria 807
87 Ga0316593_10244064 3300032168 Bacteria 671
88 Ga0316593_10257346 3300032168 Bacteria 654
89 Ga0316593_10377805 3300032168 Bacteria 545
90 Ga0316592_1003822 3300033524 Bacteria 2759
91 Ga0316592_1042819 3300033524 Bacteria 1004
92 Ga0316592_1082723 3300033524 Bacteria 731
93 Ga0316587_1052193 3300033529 Bacteria 750
94 Ga0316596_1000409 3300033541 Bacteria 7143
95 Ga0316596_1022701 3300033541 Bacteria 1605
96 Ga0316596_1028263 3300033541 Bacteria 1449
97 Ga0373952_0000274 3300035092 Bacteria 8479
98 Ga0373960_0227251 3300035121 Bacteria 670
99 Ga0373942_0261603 3300035207 Bacteria 591
100 Ga0316574_0072412 3300035398 Unclassified 2178
101 Ga0316574_0109189 3300035398 Bacteria 1773
102 Ga0316574_0711454 3300035398 Bacteria 615
103 Ga0373927_0112682 3300035695 Bacteria 1773
104 Ga0373927_0207260 3300035695 Bacteria 1288
105 Ga0373927_0444510 3300035695 Bacteria 856
106 Ga0316582_0003219 3300036647 Bacteria 7943
107 Ga0316582_0117910 3300036647 Bacteria 1774
108 Ga0316582_0152065 3300036647 Bacteria 1565
109 Ga0316582_0276386 3300036647 Bacteria 1152
110 Ga0316582_0626150 3300036647 Bacteria 740
111 Ga0316584_0064058 3300036712 Bacteria 2752
112 Ga0316584_0209627 3300036712 Bacteria 1435
113 Ga0373925_1615264 3300037068 Bacteria 530
114 Ga0395901_0757076 3300038443 Bacteria 964
115 Ga0395901_0951425 3300038443 Bacteria 838
116 Ga0400484_02771 3300038725 Bacteria 1590
117 Ga0400490_10504 3300038726 Bacteria 6403
118 Ga0439453_0057894 3300041408 Bacteria 797
119 Ga0439465_0182925 3300041413 Bacteria 759
120 Ga0451804_1039336 3300041463 Bacteria 583
121 Ga0451577_0000002 3300042876 Bacteria 1731375
122 Ga0451577_0000375 3300042876 Bacteria 83271
123 Ga0451577_0002837 3300042876 Bacteria 19935
124 Ga0451577_0025893 3300042876 Bacteria 5318
125 Ga0451577_0030220 3300042876 Bacteria 4895
126 Ga0451577_0245793 3300042876 Bacteria 1619
127 Ga0451577_0278410 3300042876 Bacteria 1515
128 Ga0451577_0324443 3300042876 Bacteria 1396
129 Ga0451577_0499630 3300042876 Bacteria 1104
130 Ga0451577_1367477 3300042876 Bacteria 628
131 Ga0453683_0000013 3300044673 Bacteria 371932
132 Ga0453683_0011398 3300044673 Bacteria 5856
133 Ga0453683_0023718 3300044673 Bacteria 3909
134 Ga0453683_0222939 3300044673 Bacteria 1199
135 Ga0453683_0785643 3300044673 Bacteria 626
136 Ga0453684_0000002 3300044712 Bacteria 1731375
137 Ga0453684_0000040 3300044712 Bacteria 690210
138 Ga0453684_0000158 3300044712 Bacteria 302033
139 Ga0453684_0007687 3300044712 Bacteria 19716
140 Ga0453684_0009190 3300044712 Bacteria 17372
141 Ga0453684_0036321 3300044712 Bacteria 6792
142 Ga0453684_0184280 3300044712 Bacteria 2448
143 Ga0453684_0518330 3300044712 Bacteria 1317
144 Ga0453684_0718248 3300044712 Bacteria 1084
145 Ga0453684_1011737 3300044712 Bacteria 883
146 Ga0451576_0000006 3300045051 Bacteria 949698
147 Ga0451576_0000037 3300045051 Bacteria 372173
148 Ga0451576_0002657 3300045051 Bacteria 26048
149 Ga0451576_0006384 3300045051 Bacteria 14478
150 Ga0451576_0007349 3300045051 Bacteria 13205
151 Ga0451576_0037531 3300045051 Bacteria 5131
152 Ga0451576_0052478 3300045051 Bacteria 4272
153 Ga0451576_0124797 3300045051 Bacteria 2682
154 Ga0451576_0141239 3300045051 Bacteria 2511
155 Ga0451576_0161014 3300045051 Bacteria 2342
156 Ga0451576_0214779 3300045051 Bacteria 2009
157 Ga0451576_0303491 3300045051 Bacteria 1670
158 Ga0451576_0413350 3300045051 Bacteria 1415
159 Ga0451576_0484333 3300045051 Bacteria 1299
160 Ga0451576_0736488 3300045051 Bacteria 1035
161 Ga0451576_1034290 3300045051 Bacteria 860
162 Ga0451576_1829258 3300045051 Bacteria 627
163 Ga0496100_1146533 3300048903 Bacteria 613
164 Ga0496106_0650988 3300048909 Bacteria 842
165 Ga0496108_0193269 3300048911 Bacteria 1764
166 Ga0496108_0324257 3300048911 Bacteria 1343
167 Ga0496109_0029545 3300048912 Bacteria 4910
168 Ga0496109_0496972 3300048912 Bacteria 1151
169 Ga0496111_0818105 3300048914 Bacteria 674
170 Ga0496113_0215359 3300048916 Bacteria 1530
171 Ga0496114_0010376 3300048917 Bacteria 7411
172 Ga0501290_102084 3300049513 Bacteria 511
173 Ga0501322_017092 3300049538 Bacteria 612
174 Ga0501031_0003706 3300049568 Bacteria 9829
175 Ga0501031_0015187 3300049568 Bacteria 4999
176 Ga0501032_0001904 3300049569 Bacteria 16472
177 Ga0501032_0008410 3300049569 Bacteria 7526
178 Ga0501032_0363768 3300049569 Bacteria 931
179 Ga0501033_0001759 3300049570 Bacteria 18939
180 Ga0501033_0009375 3300049570 Bacteria 7535
181 Ga0501033_0011812 3300049570 Bacteria 6675
182 Ga0501034_0058586 3300049571 Bacteria 3870
183 Ga0501034_0478164 3300049571 Bacteria 1161
184 Ga0501036_0000762 3300049572 Bacteria 23865
185 Ga0501036_0005160 3300049572 Bacteria 10559
186 Ga0501036_0228138 3300049572 Bacteria 1563
187 Ga0501037_0007273 3300049573 Bacteria 8091
188 Ga0501037_0109507 3300049573 Bacteria 1990
189 Ga0501038_0003826 3300049574 Bacteria 13996
190 Ga0501038_0032977 3300049574 Bacteria 4562
191 Ga0501038_0045424 3300049574 Bacteria 3813
192 Ga0501038_0079558 3300049574 Bacteria 2763
193 Ga0501039_0213970 3300049575 Bacteria 1515
194 Ga0501040_0006337 3300049576 Bacteria 7684
195 Ga0501042_0027433 3300049578 Bacteria 4004
196 Ga0501043_0009404 3300049579 Bacteria 7672
197 Ga0501043_0041136 3300049579 Bacteria 3631
198 Ga0501043_0221775 3300049579 Bacteria 1462
199 Ga0501043_0825057 3300049579 Bacteria 669
200 Ga0501046_0005770 3300049580 Bacteria 11050
201 Ga0501046_0024626 3300049580 Bacteria 4935
202 Ga0501047_0069125 3300049581 Bacteria 3401
203 Ga0501048_0015971 3300049582 Bacteria 5538
204 Ga0501068_0003033 3300049584 Bacteria 8965
205 Ga0501070_0223726 3300049586 Bacteria 1543
206 Ga0501072_0204410 3300049588 Bacteria 1575
207 Ga0501080_1547126 3300049742 Bacteria 563
208 Ga0501280_007302 3300049776 Bacteria 1547
209 Ga0501035_0000444 3300049822 Bacteria 46207
210 Ga0501035_0013784 3300049822 Bacteria 7461
211 Ga0501035_0100765 3300049822 Bacteria 2535
212 Ga0501035_0112149 3300049822 Bacteria 2389
213 Ga0501044_0002682 3300049823 Bacteria 20239
214 Ga0501044_0004474 3300049823 Bacteria 15629
215 Ga0501044_0044560 3300049823 Bacteria 4603
216 Ga0501045_0017199 3300049824 Bacteria 5133
217 nmdc:mga0k408_5496_c1 3300050493 Bacteria 6747
218 nmdc:mga0qj67_292372_c1 3300050509 Bacteria 1320
219 nmdc:mga08y16_282868_c1 3300050511 Bacteria 1711
220 nmdc:mga0n895_338810_c1 3300050512 Bacteria 1523
221 Ga0500622_0000019 3300053156 Bacteria 275028
222 Ga0501082_0393169 3300060353 Bacteria 1210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032168 Ga0316593_10061875 Ga0316593_100618751 109
2 3300036647 Ga0316582_0276386 Ga0316582_0276386_89_505 110
3 3300031691 Ga0316579_10070293 Ga0316579_100702932 112
4 3300032168 Ga0316593_10244064 Ga0316593_102440642 112
5 3300033524 Ga0316592_1082723 Ga0316592_10827232 112
6 3300033541 Ga0316596_1028263 Ga0316596_10282632 112
7 3300036712 Ga0316584_0209627 Ga0316584_0209627_304_720 112
8 3300050512 nmdc:mga0n895_338810_c1 nmdc:mga0n895_338810_c1_585_1010 113
9 3300041413 Ga0439465_0182925 Ga0439465_0182925_88_510 114
10 3300049513 Ga0501290_102084 Ga0501290_102084_39_461 114
11 3300026121 Ga0207683_10322838 Ga0207683_103228381 115
12 3300005355 Ga0070671_100397905 Ga0070671_1003979052 116
13 3300009094 Ga0111539_10881478 Ga0111539_108814782 116
14 3300041463 Ga0451804_1039336 Ga0451804_1039336_157_513 116
15 3300027907 Ga0207428_10059073 Ga0207428_100590732 118
16 3300031727 Ga0316576_10026802 Ga0316576_100268021 118
17 3300031728 Ga0316578_10025148 Ga0316578_100251482 118
18 3300032139 Ga0316580_10197213 Ga0316580_101972131 118
19 3300035398 Ga0316574_0109189 Ga0316574_0109189_1184_1606 118
20 3300036647 Ga0316582_0626150 Ga0316582_0626150_84_506 118
21 3300045051 Ga0451576_0052478 Ga0451576_0052478_3439_3858 118
22 3300049742 Ga0501080_1547126 Ga0501080_1547126_50_472 118
23 3300050511 nmdc:mga08y16_282868_c1 nmdc:mga08y16_282868_c1_903_1325 118
24 3300060353 Ga0501082_0393169 Ga0501082_0393169_313_735 118
25 3300049538 Ga0501322_017092 Ga0501322_017092_33_395 119
26 3300025933 Ga0207706_10664370 Ga0207706_106643701 120
27 3300038725 Ga0400484_02771 Ga0400484_02771_416_844 120
28 3300038726 Ga0400490_10504 Ga0400490_10504_3208_3636 120
29 3300041408 Ga0439453_0057894 Ga0439453_0057894_197_616 120
30 3300035398 Ga0316574_0711454 Ga0316574_0711454_167_595 123
31 3300036647 Ga0316582_0152065 Ga0316582_0152065_163_591 123
32 3300032168 Ga0316593_10166290 Ga0316593_101662902 124
33 3300031727 Ga0316576_10065614 Ga0316576_100656142 125
34 3300031728 Ga0316578_10359780 Ga0316578_103597801 125
35 3300032168 Ga0316593_10026342 Ga0316593_100263421 125
36 3300035092 Ga0373952_0000274 Ga0373952_0000274_3282_3704 125
37 3300035121 Ga0373960_0227251 Ga0373960_0227251_201_623 125
38 3300035207 Ga0373942_0261603 Ga0373942_0261603_104_526 125
39 3300035695 Ga0373927_0112682 Ga0373927_0112682_952_1374 125
40 3300037068 Ga0373925_1615264 Ga0373925_1615264_32_454 125
41 3300044712 Ga0453684_0718248 Ga0453684_0718248_333_758 125
42 3300005340 Ga0070689_101020448 Ga0070689_1010204481 127
43 3300005455 Ga0070663_100173261 Ga0070663_1001732612 127
44 3300005457 Ga0070662_100100210 Ga0070662_1001002102 127
45 3300009094 Ga0111539_10079682 Ga0111539_100796821 127
46 3300010375 Ga0105239_10343109 Ga0105239_103431092 127
47 3300013308 Ga0157375_10107011 Ga0157375_101070113 127
48 3300014745 Ga0157377_10591102 Ga0157377_105911021 127
49 3300025918 Ga0207662_10018444 Ga0207662_100184442 127
50 3300025933 Ga0207706_10085395 Ga0207706_100853952 127
51 3300044712 Ga0453684_0009190 Ga0453684_0009190_14670_15101 127
52 3300048909 Ga0496106_0650988 Ga0496106_0650988_315_734 127
53 3300048911 Ga0496108_0193269 Ga0496108_0193269_1260_1691 127
54 3300048911 Ga0496108_0324257 Ga0496108_0324257_638_1057 127
55 3300048912 Ga0496109_0029545 Ga0496109_0029545_2087_2518 127
56 3300048916 Ga0496113_0215359 Ga0496113_0215359_94_525 127
57 3300048917 Ga0496114_0010376 Ga0496114_0010376_4389_4820 127
58 3300042876 Ga0451577_0025893 Ga0451577_0025893_4205_4630 132
59 3300042876 Ga0451577_0278410 Ga0451577_0278410_177_602 132
60 3300044712 Ga0453684_0000158 Ga0453684_0000158_263417_263842 132
61 3300044712 Ga0453684_0518330 Ga0453684_0518330_400_825 132
62 3300045051 Ga0451576_0006384 Ga0451576_0006384_459_884 132
63 3300045051 Ga0451576_0736488 Ga0451576_0736488_397_822 132
64 3300045051 Ga0451576_1034290 Ga0451576_1034290_66_491 132
65 3300044673 Ga0453683_0785643 Ga0453683_0785643_12_422 134
66 3300031250 Ga0265331_10260600 Ga0265331_102606001 135
67 3300031251 Ga0265327_10006387 Ga0265327_100063877 135
68 3300031239 Ga0265328_10076476 Ga0265328_100764761 136
69 3300031250 Ga0265331_10001923 Ga0265331_1000192314 136
70 3300031251 Ga0265327_10000250 Ga0265327_1000025035 136
71 3300049776 Ga0501280_007302 Ga0501280_007302_400_816 136
72 3300005530 Ga0070679_101821242 Ga0070679_1018212421 137
73 3300005539 Ga0068853_100255892 Ga0068853_1002558921 137
74 3300009176 Ga0105242_10042536 Ga0105242_100425361 137
75 3300013296 Ga0157374_10009986 Ga0157374_100099863 137
76 3300027876 Ga0209974_10228908 Ga0209974_102289081 137
77 3300031251 Ga0265327_10003486 Ga0265327_1000348613 137
78 3300031665 Ga0316575_10171292 Ga0316575_101712922 137
79 3300031691 Ga0316579_10052653 Ga0316579_100526532 137
80 3300031691 Ga0316579_10052653 Ga0316579_100526533 137
81 3300031728 Ga0316578_10030334 Ga0316578_100303342 137
82 3300031728 Ga0316578_10030334 Ga0316578_100303343 137
83 3300031733 Ga0316577_10006165 Ga0316577_100061653 137
84 3300031733 Ga0316577_10626684 Ga0316577_106266841 137
85 3300032137 Ga0316585_10007973 Ga0316585_100079733 137
86 3300032139 Ga0316580_10280145 Ga0316580_102801451 137
87 3300032168 Ga0316593_10034181 Ga0316593_100341812 137
88 3300033524 Ga0316592_1003822 Ga0316592_10038221 137
89 3300033524 Ga0316592_1003822 Ga0316592_10038222 137
90 3300033541 Ga0316596_1000409 Ga0316596_10004092 137
91 3300033541 Ga0316596_1022701 Ga0316596_10227012 137
92 3300033541 Ga0316596_1022701 Ga0316596_10227013 137
93 3300035398 Ga0316574_0072412 Ga0316574_0072412_1004_1426 137
94 3300035398 Ga0316574_0072412 Ga0316574_0072412_1550_1972 137
95 3300036647 Ga0316582_0003219 Ga0316582_0003219_4930_5352 137
96 3300036647 Ga0316582_0117910 Ga0316582_0117910_362_784 137
97 3300036712 Ga0316584_0064058 Ga0316584_0064058_1797_2219 137
98 3300044712 Ga0453684_0000040 Ga0453684_0000040_636154_636573 137
99 3300050509 nmdc:mga0qj67_292372_c1 nmdc:mga0qj67_292372_c1_299_718 137
100 3300031727 Ga0316576_10005316 Ga0316576_100053162 138
101 3300031727 Ga0316576_10005400 Ga0316576_100054006 138
102 3300031727 Ga0316576_10118542 Ga0316576_101185422 138
103 3300031728 Ga0316578_10835581 Ga0316578_108355811 138
104 3300032168 Ga0316593_10015316 Ga0316593_100153162 138
105 3300032168 Ga0316593_10257346 Ga0316593_102573462 138
106 3300033524 Ga0316592_1042819 Ga0316592_10428191 138
107 3300033529 Ga0316587_1052193 Ga0316587_10521932 138
108 3300005337 Ga0070682_100669944 Ga0070682_1006699442 139
109 3300005366 Ga0070659_100096833 Ga0070659_1000968331 139
110 3300005457 Ga0070662_101308133 Ga0070662_1013081331 139
111 3300005539 Ga0068853_101060176 Ga0068853_1010601761 139
112 3300005578 Ga0068854_101682117 Ga0068854_1016821171 139
113 3300005614 Ga0068856_100202063 Ga0068856_1002020631 139
114 3300006195 Ga0075366_10000391 Ga0075366_100003913 139
115 3300006195 Ga0075366_10140105 Ga0075366_101401052 139
116 3300009545 Ga0105237_11349829 Ga0105237_113498291 139
117 3300013100 Ga0157373_10675082 Ga0157373_106750822 139
118 3300025912 Ga0207707_11531454 Ga0207707_115314541 139
119 3300025922 Ga0207646_10727893 Ga0207646_107278932 139
120 3300025932 Ga0207690_10476170 Ga0207690_104761701 139
121 3300025933 Ga0207706_10406524 Ga0207706_104065241 139
122 3300026078 Ga0207702_10956233 Ga0207702_109562332 139
123 3300028666 Ga0265336_10000584 Ga0265336_1000058419 139
124 3300028800 Ga0265338_10454640 Ga0265338_104546402 139
125 3300029957 Ga0265324_10000018 Ga0265324_1000001882 139
126 3300029957 Ga0265324_10001353 Ga0265324_100013536 139
127 3300029957 Ga0265324_10039556 Ga0265324_100395562 139
128 3300029957 Ga0265324_10048081 Ga0265324_100480812 139
129 3300031238 Ga0265332_10049861 Ga0265332_100498612 139
130 3300031239 Ga0265328_10036706 Ga0265328_100367062 139
131 3300031241 Ga0265325_10000035 Ga0265325_1000003577 139
132 3300031241 Ga0265325_10041218 Ga0265325_100412183 139
133 3300031250 Ga0265331_10000259 Ga0265331_100002596 139
134 3300031250 Ga0265331_10003137 Ga0265331_100031374 139
135 3300031250 Ga0265331_10013855 Ga0265331_100138552 139
136 3300031250 Ga0265331_10022556 Ga0265331_100225561 139
137 3300031250 Ga0265331_10042424 Ga0265331_100424242 139
138 3300031251 Ga0265327_10000502 Ga0265327_1000050268 139
139 3300031251 Ga0265327_10000595 Ga0265327_1000059563 139
140 3300031251 Ga0265327_10011810 Ga0265327_100118101 139
141 3300031251 Ga0265327_10149414 Ga0265327_101494142 139
142 3300031344 Ga0265316_10149799 Ga0265316_101497992 139
143 3300031344 Ga0265316_10821113 Ga0265316_108211131 139
144 3300031665 Ga0316575_10000484 Ga0316575_100004842 139
145 3300031711 Ga0265314_10005275 Ga0265314_100052753 139
146 3300031711 Ga0265314_10042586 Ga0265314_100425862 139
147 3300032168 Ga0316593_10377805 Ga0316593_103778051 139
148 3300035695 Ga0373927_0207260 Ga0373927_0207260_528_953 139
149 3300035695 Ga0373927_0444510 Ga0373927_0444510_331_756 139
150 3300038443 Ga0395901_0757076 Ga0395901_0757076_285_716 139
151 3300038443 Ga0395901_0951425 Ga0395901_0951425_238_669 139
152 3300042876 Ga0451577_0000002 Ga0451577_0000002_1671340_1671765 139
153 3300042876 Ga0451577_0000375 Ga0451577_0000375_837_1265 139
154 3300042876 Ga0451577_0002837 Ga0451577_0002837_3945_4373 139
155 3300042876 Ga0451577_0030220 Ga0451577_0030220_363_785 139
156 3300042876 Ga0451577_0245793 Ga0451577_0245793_972_1409 139
157 3300042876 Ga0451577_0324443 Ga0451577_0324443_98_523 139
158 3300042876 Ga0451577_0499630 Ga0451577_0499630_639_1067 139
159 3300042876 Ga0451577_1367477 Ga0451577_1367477_133_555 139
160 3300044673 Ga0453683_0000013 Ga0453683_0000013_311897_312322 139
161 3300044673 Ga0453683_0011398 Ga0453683_0011398_4695_5123 139
162 3300044673 Ga0453683_0023718 Ga0453683_0023718_3206_3628 139
163 3300044673 Ga0453683_0222939 Ga0453683_0222939_148_573 139
164 3300044712 Ga0453684_0000002 Ga0453684_0000002_59611_60036 139
165 3300044712 Ga0453684_0007687 Ga0453684_0007687_16366_16794 139
166 3300044712 Ga0453684_0036321 Ga0453684_0036321_5689_6117 139
167 3300044712 Ga0453684_0184280 Ga0453684_0184280_1587_2012 139
168 3300044712 Ga0453684_1011737 Ga0453684_1011737_186_608 139
169 3300045051 Ga0451576_0000006 Ga0451576_0000006_605274_605702 139
170 3300045051 Ga0451576_0000037 Ga0451576_0000037_312138_312563 139
171 3300045051 Ga0451576_0002657 Ga0451576_0002657_24119_24547 139
172 3300045051 Ga0451576_0007349 Ga0451576_0007349_7886_8308 139
173 3300045051 Ga0451576_0037531 Ga0451576_0037531_3265_3693 139
174 3300045051 Ga0451576_0124797 Ga0451576_0124797_89_514 139
175 3300045051 Ga0451576_0141239 Ga0451576_0141239_2056_2481 139
176 3300045051 Ga0451576_0161014 Ga0451576_0161014_277_702 139
177 3300045051 Ga0451576_0214779 Ga0451576_0214779_542_967 139
178 3300045051 Ga0451576_0303491 Ga0451576_0303491_956_1378 139
179 3300045051 Ga0451576_0413350 Ga0451576_0413350_256_684 139
180 3300045051 Ga0451576_0484333 Ga0451576_0484333_175_603 139
181 3300045051 Ga0451576_1829258 Ga0451576_1829258_45_470 139
182 3300048903 Ga0496100_1146533 Ga0496100_1146533_144_563 139
183 3300048912 Ga0496109_0496972 Ga0496109_0496972_509_940 139
184 3300048914 Ga0496111_0818105 Ga0496111_0818105_46_477 139
185 3300049568 Ga0501031_0003706 Ga0501031_0003706_7654_8085 139
186 3300049568 Ga0501031_0015187 Ga0501031_0015187_4342_4773 139
187 3300049569 Ga0501032_0001904 Ga0501032_0001904_9746_10177 139
188 3300049569 Ga0501032_0008410 Ga0501032_0008410_5653_6084 139
189 3300049569 Ga0501032_0363768 Ga0501032_0363768_326_757 139
190 3300049570 Ga0501033_0001759 Ga0501033_0001759_4126_4557 139
191 3300049570 Ga0501033_0009375 Ga0501033_0009375_3721_4152 139
192 3300049570 Ga0501033_0011812 Ga0501033_0011812_5883_6314 139
193 3300049571 Ga0501034_0058586 Ga0501034_0058586_2416_2847 139
194 3300049571 Ga0501034_0478164 Ga0501034_0478164_25_444 139
195 3300049572 Ga0501036_0000762 Ga0501036_0000762_16468_16899 139
196 3300049572 Ga0501036_0005160 Ga0501036_0005160_6159_6590 139
197 3300049572 Ga0501036_0228138 Ga0501036_0228138_717_1148 139
198 3300049573 Ga0501037_0007273 Ga0501037_0007273_7562_7993 139
199 3300049573 Ga0501037_0109507 Ga0501037_0109507_1293_1724 139
200 3300049574 Ga0501038_0003826 Ga0501038_0003826_4138_4569 139
201 3300049574 Ga0501038_0032977 Ga0501038_0032977_166_597 139
202 3300049574 Ga0501038_0045424 Ga0501038_0045424_2537_2968 139
203 3300049574 Ga0501038_0079558 Ga0501038_0079558_647_1078 139
204 3300049575 Ga0501039_0213970 Ga0501039_0213970_148_579 139
205 3300049576 Ga0501040_0006337 Ga0501040_0006337_3555_3986 139
206 3300049578 Ga0501042_0027433 Ga0501042_0027433_3554_3985 139
207 3300049579 Ga0501043_0009404 Ga0501043_0009404_5093_5524 139
208 3300049579 Ga0501043_0041136 Ga0501043_0041136_1111_1542 139
209 3300049579 Ga0501043_0221775 Ga0501043_0221775_821_1252 139
210 3300049579 Ga0501043_0825057 Ga0501043_0825057_71_502 139
211 3300049580 Ga0501046_0005770 Ga0501046_0005770_7809_8240 139
212 3300049580 Ga0501046_0024626 Ga0501046_0024626_2709_3140 139
213 3300049581 Ga0501047_0069125 Ga0501047_0069125_881_1312 139
214 3300049582 Ga0501048_0015971 Ga0501048_0015971_338_769 139
215 3300049584 Ga0501068_0003033 Ga0501068_0003033_7163_7594 139
216 3300049586 Ga0501070_0223726 Ga0501070_0223726_459_890 139
217 3300049588 Ga0501072_0204410 Ga0501072_0204410_255_686 139
218 3300049822 Ga0501035_0000444 Ga0501035_0000444_42087_42518 139
219 3300049822 Ga0501035_0013784 Ga0501035_0013784_2145_2576 139
220 3300049822 Ga0501035_0100765 Ga0501035_0100765_1522_1953 139
221 3300049822 Ga0501035_0112149 Ga0501035_0112149_1346_1777 139
222 3300049823 Ga0501044_0002682 Ga0501044_0002682_7234_7665 139
223 3300049823 Ga0501044_0004474 Ga0501044_0004474_4115_4546 139
224 3300049823 Ga0501044_0044560 Ga0501044_0044560_3509_3940 139
225 3300049824 Ga0501045_0017199 Ga0501045_0017199_1396_1827 139
226 3300050493 nmdc:mga0k408_5496_c1 nmdc:mga0k408_5496_c1_5714_6139 139
227 3300053156 Ga0500622_0000019 Ga0500622_0000019_79548_79976 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

93

138

0.96

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

9

89

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nl9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo state 3 0.9495 4 78
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9439 9 80
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9373 20 78
6ree-assembly1.cif.gz_R cryo-em structure of polytomella f-atp synthase, rotary substate 3b, composite map 0.9262 3 85
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9227 4 87
ID Description Score Start End Superfamily
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9763 2 87 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9707 2 88 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9678 25 87 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9656 1 88 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9544 1 87 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A2N3PL22-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9864 1 85 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-C5EXD6-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.986 1 85 GO:0005524
GO:0005886
GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A7Y6A622-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9847 2 87 GO:0005886
GO:0045261
GO:0046933
AF-A0A843Y9S7-F1-model_v4 deleted 0.9847 3 85
AF-A0A3C0LYM2-F1-model_v4 deleted 0.9846 3 88

Feature Viewer

pLDDT pTM Quality
80.96 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map