F340436

General Info

Members Datasets Scaffolds Average Seq Length
227 144 455 325

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0037376|Ga0500636_0037376_341_1333
Length 322
Sequence MIIRIFIPMETYDILIIGAGPIGLACGLAAKKAGLNYLIIEKGCLTNSLYNYPLYMTFFSTSEKLEIGGVPFVSISAKPIRPEALEYYRRVAVSNHLNTHLFEAVETVKQTNGSYTVTKHVIIATGFYDIPNMLNIPGEHLPKVNHYYKDPHFYAMQKVLVIGANNSSVDAALETYRKGADVTMVIREEGIGRRVKYWVKPDIENRISEGSIKAYTHSTVQSIREREVDILTPDGIVTLQNDFVLALTGYQPNFSFLEKAGIQLSEDEKKLPTYNPETMETNMSGIYLAGVVCGGMNTHVWFIENSRDHADKIIAHIKTTRY

Samples

Sample ID Description Type Environment
1 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
114 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
115 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2738541278 Niastella sp. CF465 Isolate Unclassified
133 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
134 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
135 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
136 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
137 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
138 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
139 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
140 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
141 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
142 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
143 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0
Isolates 5.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.54
Nodule 0
Rhizoplane 0.88
Rhizosphere 73.13
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500636_0037376 3300053177 Bacteria 2873
2 JGI24740J21852_10002427 3300001979 Bacteria 8462
3 JGI24739J22299_10008482 3300001989 Bacteria 3837
4 JGI25154J39366_1000047 3300002738 Bacteria 126449
5 JGI25153J46596_10005740 3300003215 Bacteria 6468
6 JGI25153J46596_10016030 3300003215 Bacteria 3023
7 rootH1_10006091 3300003316 Bacteria 3120
8 rootH1_10006091 3300003323 Bacteria 8013
9 rootH1_10058804 3300003316 Bacteria 3335
10 rootH2_10001558 3300003320 Bacteria 9795
11 rootH2_10015349 3300003320 Bacteria 24566
12 rootH2_10271063 3300003320 Bacteria 2400
13 rootL2_10066935 3300003322 Unclassified 2030
14 rootL2_10083224 3300003322 Bacteria 2640
15 rootL2_10328342 3300003322 Unclassified 1783
16 Ga0055528_1000882 3300003790 Bacteria 20299
17 Ga0055543_1016856 3300004625 Bacteria 1383
18 Ga0065165_1000190 3300005262 Bacteria 107377
19 Ga0065165_1030807 3300005262 Bacteria 1703
20 Ga0065704_10079143 3300005289 Bacteria 4247
21 Ga0070680_100000066 3300005336 Bacteria 55257
22 Ga0070682_100000455 3300005337 Bacteria 25816
23 Ga0068868_100174626 3300005338 Bacteria 1780
24 Ga0070660_100047744 3300005339 Bacteria 3286
25 Ga0070668_100041438 3300005347 Bacteria 3527
26 Ga0070667_100168712 3300005367 Bacteria 1931
27 Ga0070662_100271960 3300005457 Bacteria 1368
28 Ga0070681_10204649 3300005458 Bacteria 1891
29 Ga0070681_10324345 3300005458 Bacteria 1449
30 Ga0070679_100000973 3300005530 Bacteria 24934
31 Ga0068855_100004440 3300005563 Bacteria 17135
32 Ga0068855_100005197 3300005563 Bacteria 15879
33 Ga0068857_100001435 3300005577 Bacteria 18887
34 Ga0068857_100036700 3300005577 Bacteria 4343
35 Ga0068854_100078309 3300005578 Bacteria 2435
36 Ga0068856_100114111 3300005614 Bacteria 2701
37 Ga0068852_100000342 3300005616 Bacteria 31480
38 Ga0068852_100321383 3300005616 Bacteria 1503
39 Ga0068859_100470036 3300005617 Bacteria 1353
40 Ga0068861_100143961 3300005719 Bacteria 1949
41 Ga0068858_100298205 3300005842 Bacteria 1537
42 Ga0068860_100000060 3300005843 Bacteria 195631
43 Ga0068860_100068671 3300005843 Bacteria 3367
44 Ga0081540_1011975 3300005983 Bacteria 5750
45 Ga0075366_10093064 3300006195 Unclassified 1806
46 Ga0075366_10163847 3300006195 Bacteria 1348
47 Ga0075431_100011377 3300006847 Bacteria 8964
48 Ga0075429_100013085 3300006880 Bacteria 7197
49 Ga0097620_100470030 3300006931 Bacteria 1353
50 Ga0105240_10001336 3300009093 Bacteria 42397
51 Ga0105240_10002890 3300009093 Bacteria 27120
52 Ga0105240_10004786 3300009093 Bacteria 20421
53 Ga0105240_10004977 3300009093 Bacteria 19960
54 Ga0105240_10016576 3300009093 Bacteria 9969
55 Ga0105240_10173970 3300009093 Bacteria 2547
56 Ga0105240_10230661 3300009093 Bacteria 2152
57 Ga0111539_10086512 3300009094 Bacteria 3683
58 Ga0114129_10025061 3300009147 Bacteria 8453
59 Ga0105241_10000144 3300009174 Bacteria 50819
60 Ga0105241_10396320 3300009174 Bacteria 1210
61 Ga0105237_10000651 3300009545 Bacteria 48483
62 Ga0105237_10006210 3300009545 Bacteria 13323
63 Ga0105237_10038709 3300009545 Bacteria 4815
64 Ga0105238_10002965 3300009551 Bacteria 16945
65 Ga0105238_10008866 3300009551 Bacteria 10064
66 Ga0105238_10066986 3300009551 Bacteria 3592
67 Ga0105238_10095320 3300009551 Unclassified 2963
68 Ga0105239_10004216 3300010375 Bacteria 17268
69 Ga0105239_10004649 3300010375 Bacteria 16319
70 Ga0105239_10039968 3300010375 Bacteria 5138
71 Ga0157370_10006627 3300013104 Bacteria 12725
72 Ga0157370_10008346 3300013104 Bacteria 11172
73 Ga0157369_10011152 3300013105 Bacteria 10217
74 Ga0157374_10000007 3300013296 Bacteria 595643
75 Ga0157374_10151684 3300013296 Bacteria 2253
76 Ga0163162_10000213 3300013306 Bacteria 53744
77 Ga0163162_10000386 3300013306 Bacteria 40256
78 Ga0163162_10180628 3300013306 Bacteria 2236
79 Ga0157372_10000954 3300013307 Bacteria 31547
80 Ga0157372_10014521 3300013307 Bacteria 8429
81 Ga0157372_10055824 3300013307 Bacteria 4412
82 Ga0157372_10307877 3300013307 Bacteria 1844
83 Ga0157376_10002013 3300014969 Bacteria 13618
84 Ga0163161_10291061 3300017792 Bacteria 1284
85 Ga0209436_112575 3300025208 Bacteria 1431
86 Ga0209646_1000003 3300025246 Bacteria 1160860
87 Ga0209026_1000303 3300025250 Bacteria 53764
88 Ga0209564_1023791 3300025295 Bacteria 2114
89 Ga0209758_1002589 3300025297 Bacteria 18144
90 Ga0209758_1007517 3300025297 Bacteria 7386
91 Ga0209758_1017983 3300025297 Bacteria 3489
92 Ga0209050_1000136 3300025298 Bacteria 179113
93 Ga0207426_1000341 3300025302 Bacteria 87735
94 Ga0207426_1000655 3300025302 Bacteria 42458
95 Ga0207426_1000738 3300025302 Bacteria 37211
96 Ga0209257_1002231 3300025304 Bacteria 19906
97 Ga0207647_10012072 3300025904 Bacteria 6029
98 Ga0207654_10002008 3300025911 Bacteria 10463
99 Ga0207654_10015994 3300025911 Bacteria 3901
100 Ga0207654_10239285 3300025911 Bacteria 1212
101 Ga0207707_10000317 3300025912 Bacteria 50861
102 Ga0207695_10000170 3300025913 Bacteria 192469
103 Ga0207695_10001252 3300025913 Bacteria 43328
104 Ga0207695_10005660 3300025913 Bacteria 16495
105 Ga0207695_10010877 3300025913 Bacteria 11079
106 Ga0207695_10014637 3300025913 Bacteria 9277
107 Ga0207695_10039654 3300025913 Bacteria 5060
108 Ga0207695_10108716 3300025913 Bacteria 2756
109 Ga0207671_10007695 3300025914 Bacteria 9302
110 Ga0207671_10052047 3300025914 Bacteria 3034
111 Ga0207671_10076701 3300025914 Bacteria 2501
112 Ga0207671_10162202 3300025914 Unclassified 1732
113 Ga0207660_10001972 3300025917 Bacteria 13679
114 Ga0207652_10000456 3300025921 Bacteria 42137
115 Ga0207694_10010257 3300025924 Bacteria 7064
116 Ga0207694_10022798 3300025924 Bacteria 4749
117 Ga0207694_10071000 3300025924 Bacteria 2721
118 Ga0207694_10350556 3300025924 Bacteria 1222
119 Ga0207667_10005154 3300025949 Bacteria 15964
120 Ga0207667_10050854 3300025949 Bacteria 4371
121 Ga0207667_10061412 3300025949 Bacteria 3931
122 Ga0207640_10086756 3300025981 Bacteria 2156
123 Ga0207677_10118280 3300026023 Bacteria 1988
124 Ga0207639_10137234 3300026041 Bacteria 2033
125 Ga0207639_10158880 3300026041 Bacteria 1903
126 Ga0207702_10037601 3300026078 Bacteria 4052
127 Ga0207674_10002964 3300026116 Bacteria 21086
128 Ga0207674_10092816 3300026116 Bacteria 3008
129 Ga0207698_10058966 3300026142 Bacteria 2978
130 Ga0268264_10000109 3300028381 Bacteria 208477
131 Ga0268264_10014224 3300028381 Bacteria 6544
132 Ga0268264_10076245 3300028381 Bacteria 2852
133 Ga0307513_10058234 3300031456 Bacteria 4109
134 Ga0307509_10231311 3300031507 Bacteria 1651
135 Ga0307510_10087121 3300033180 Bacteria 2990
136 Ga0373925_0122373 3300037068 Bacteria 2021
137 Ga0451853_3961713 3300041512 Bacteria 3038
138 Ga0439449_0001224 3300042007 Bacteria 10075
139 Ga0439449_0042667 3300042007 Bacteria 1685
140 Ga0439457_010262 3300042014 Bacteria 2158
141 Ga0439462_0018707 3300042015 Bacteria 1800
142 Ga0439462_0043759 3300042015 Bacteria 1197
143 Ga0466972_0000013 3300044658 Bacteria 229345
144 Ga0466972_0001020 3300044658 Bacteria 13428
145 Ga0466972_0022726 3300044658 Bacteria 3121
146 Ga0466972_0031236 3300044658 Bacteria 2620
147 Ga0466961_0018040 3300044693 Bacteria 4538
148 Ga0453684_0092927 3300044712 Bacteria 3717
149 Ga0466968_0018657 3300044735 Bacteria 2784
150 Ga0466957_0001230 3300044842 Bacteria 13374
151 Ga0466959_0054639 3300045049 Bacteria 2917
152 Ga0495627_006134 3300046453 Bacteria 4741
153 Ga0495638_0156213 3300046460 Unclassified 1319
154 Ga0495648_0018142 3300046524 Bacteria 5000
155 Ga0495633_0000344 3300046558 Bacteria 51775
156 Ga0495625_0062667 3300046660 Bacteria 2628
157 Ga0495625_0144039 3300046660 Unclassified 1606
158 Ga0495649_0042877 3300046694 Bacteria 2471
159 Ga0495672_0015969 3300047320 Bacteria 5083
160 Ga0495672_0103775 3300047320 Unclassified 1537
161 Ga0495687_000014 3300047443 Bacteria 366896
162 Ga0495686_0000034 3300047472 Bacteria 325038
163 Ga0495686_0005149 3300047472 Bacteria 10420
164 Ga0495686_0024839 3300047472 Bacteria 3932
165 Ga0496101_0224308 3300048904 Bacteria 1459
166 Ga0496104_0465217 3300048907 Bacteria 1176
167 Ga0496121_0000010 3300048924 Bacteria 793488
168 Ga0496126_0006356 3300048929 Bacteria 13173
169 Ga0501032_0019012 3300049569 Bacteria 4807
170 Ga0501033_0127370 3300049570 Bacteria 1846
171 Ga0501034_0031601 3300049571 Bacteria 5378
172 Ga0501034_0045956 3300049571 Bacteria 4411
173 Ga0501034_0074393 3300049571 Bacteria 3405
174 Ga0501034_0384402 3300049571 Bacteria 1328
175 Ga0501034_0567544 3300049571 Bacteria 1043
176 Ga0501036_0010312 3300049572 Bacteria 7710
177 Ga0501038_0042289 3300049574 Unclassified 3968
178 Ga0501039_0055891 3300049575 Bacteria 3058
179 Ga0501043_0021088 3300049579 Bacteria 5108
180 Ga0501043_0065763 3300049579 Bacteria 2847
181 Ga0501047_0045084 3300049581 Bacteria 4262
182 Ga0501047_0059413 3300049581 Unclassified 3691
183 Ga0501047_0189478 3300049581 Bacteria 1921
184 Ga0501048_0134836 3300049582 Bacteria 1745
185 Ga0501067_0020451 3300049583 Bacteria 3664
186 Ga0501070_0133781 3300049586 Bacteria 2047
187 Ga0501073_0030294 3300049589 Bacteria 3863
188 Ga0501238_009706 3300049671 Bacteria 1278
189 Ga0501219_000385 3300049703 Bacteria 7399
190 Ga0501225_0000104 3300049705 Bacteria 26591
191 Ga0501225_0045569 3300049705 Bacteria 1215
192 Ga0501044_0006034 3300049823 Bacteria 13376
193 Ga0501044_0008528 3300049823 Bacteria 11230
194 Ga0501044_0259064 3300049823 Bacteria 1678
195 Ga0501284_00041 3300050005 Bacteria 50589
196 nmdc:mga0k408_104863_c1 3300050493 Unclassified 1669
197 nmdc:mga0k408_111523_c1 3300050493 Bacteria 1617
198 nmdc:mga0k408_37998_c1 3300050493 Bacteria 2764
199 nmdc:mga05p37_19037_c1 3300050507 Bacteria 8304
200 nmdc:mga05p37_89995_c1 3300050507 Bacteria 3782
201 nmdc:mga06r32_26442_c1 3300050510 Bacteria 4310
202 Ga0500644_0105120 3300053088 Bacteria 1079
203 Ga0500583_0000043 3300053092 Bacteria 81313
204 Ga0500583_0000936 3300053092 Bacteria 8306
205 Ga0500652_008803 3300053131 Bacteria 3381
206 Ga0500559_0033350 3300053136 Bacteria 2216
207 Ga0500568_0027970 3300053139 Bacteria 2354
208 Ga0500616_0073345 3300053153 Unclassified 1738
209 Ga0500622_0000987 3300053156 Bacteria 24103
210 Ga0500622_0014767 3300053156 Bacteria 4188
211 Ga0500633_0008350 3300053160 Bacteria 2666
212 Ga0500636_0141692 3300053177 Bacteria 1330
213 Ga0501084_0000686 3300054114 Bacteria 25875
214 Ga0501082_0046764 3300060353 Bacteria 3729
215 Ga0466962_0019649 3300061719 Bacteria 3247
216 2738726294 2738541278 Bacteria 9755573
217 2819680556 2818991460 Bacteria 7595395
218 2840677683 2840677318 Bacteria 2664183
219 2883071158 2883068021 Bacteria 6192739
220 2884798019 2884791551 Bacteria 8511252
221 2896085501 2896085136 Bacteria 6129793
222 2896113708 2896109856 Bacteria 7140722
223 2929182850 2929177148 Bacteria 7883697
224 2929244984 2929239360 Bacteria 7745570
225 2929927244 2929921140 Bacteria 8649150
226 2945978805 2945977869 Bacteria 7777518
227 2946015329 2946013367 Bacteria 7766675
228 8003151138 8003151029 Bacteria 8187759
229 Ga0500636_0037376
230 JGI24740J21852_10002427
231 JGI24739J22299_10008482
232 JGI25154J39366_1000047
233 JGI25153J46596_10005740
234 JGI25153J46596_10016030
235 rootH1_10006091
236 rootH1_10058804
237 rootH2_10001558
238 rootH2_10015349
239 rootH2_10271063
240 rootL2_10066935
241 rootL2_10083224
242 rootL2_10328342
243 Ga0055528_1000882
244 Ga0055543_1016856
245 Ga0065165_1000190
246 Ga0065165_1030807
247 Ga0065704_10079143
248 Ga0070680_100000066
249 Ga0070682_100000455
250 Ga0068868_100174626
251 Ga0070660_100047744
252 Ga0070668_100041438
253 Ga0070667_100168712
254 Ga0070662_100271960
255 Ga0070681_10204649
256 Ga0070681_10324345
257 Ga0070679_100000973
258 Ga0068855_100004440
259 Ga0068855_100005197
260 Ga0068857_100001435
261 Ga0068857_100036700
262 Ga0068854_100078309
263 Ga0068856_100114111
264 Ga0068852_100000342
265 Ga0068852_100321383
266 Ga0068859_100470036
267 Ga0068861_100143961
268 Ga0068858_100298205
269 Ga0068860_100000060
270 Ga0068860_100068671
271 Ga0081540_1011975
272 Ga0075366_10093064
273 Ga0075366_10163847
274 Ga0075431_100011377
275 Ga0075429_100013085
276 Ga0097620_100470030
277 Ga0105240_10001336
278 Ga0105240_10002890
279 Ga0105240_10004786
280 Ga0105240_10004977
281 Ga0105240_10016576
282 Ga0105240_10173970
283 Ga0105240_10230661
284 Ga0111539_10086512
285 Ga0114129_10025061
286 Ga0105241_10000144
287 Ga0105241_10396320
288 Ga0105237_10000651
289 Ga0105237_10006210
290 Ga0105237_10038709
291 Ga0105238_10002965
292 Ga0105238_10008866
293 Ga0105238_10066986
294 Ga0105238_10095320
295 Ga0105239_10004216
296 Ga0105239_10004649
297 Ga0105239_10039968
298 Ga0157370_10006627
299 Ga0157370_10008346
300 Ga0157369_10011152
301 Ga0157374_10000007
302 Ga0157374_10151684
303 Ga0163162_10000213
304 Ga0163162_10000386
305 Ga0163162_10180628
306 Ga0157372_10000954
307 Ga0157372_10014521
308 Ga0157372_10055824
309 Ga0157372_10307877
310 Ga0157376_10002013
311 Ga0163161_10291061
312 Ga0209436_112575
313 Ga0209646_1000003
314 Ga0209026_1000303
315 Ga0209564_1023791
316 Ga0209758_1002589
317 Ga0209758_1007517
318 Ga0209758_1017983
319 Ga0209050_1000136
320 Ga0207426_1000341
321 Ga0207426_1000655
322 Ga0207426_1000738
323 Ga0209257_1002231
324 Ga0207647_10012072
325 Ga0207654_10002008
326 Ga0207654_10015994
327 Ga0207654_10239285
328 Ga0207707_10000317
329 Ga0207695_10000170
330 Ga0207695_10001252
331 Ga0207695_10005660
332 Ga0207695_10010877
333 Ga0207695_10014637
334 Ga0207695_10039654
335 Ga0207695_10108716
336 Ga0207671_10007695
337 Ga0207671_10052047
338 Ga0207671_10076701
339 Ga0207671_10162202
340 Ga0207660_10001972
341 Ga0207652_10000456
342 Ga0207694_10010257
343 Ga0207694_10022798
344 Ga0207694_10071000
345 Ga0207694_10350556
346 Ga0207667_10005154
347 Ga0207667_10050854
348 Ga0207667_10061412
349 Ga0207640_10086756
350 Ga0207677_10118280
351 Ga0207639_10137234
352 Ga0207639_10158880
353 Ga0207702_10037601
354 Ga0207674_10002964
355 Ga0207674_10092816
356 Ga0207698_10058966
357 Ga0268264_10000109
358 Ga0268264_10014224
359 Ga0268264_10076245
360 Ga0307513_10058234
361 Ga0307509_10231311
362 Ga0307510_10087121
363 Ga0373925_0122373
364 Ga0451853_3961713
365 Ga0439449_0001224
366 Ga0439449_0042667
367 Ga0439457_010262
368 Ga0439462_0018707
369 Ga0439462_0043759
370 Ga0466972_0000013
371 Ga0466972_0001020
372 Ga0466972_0022726
373 Ga0466972_0031236
374 Ga0466961_0018040
375 Ga0453684_0092927
376 Ga0466968_0018657
377 Ga0466957_0001230
378 Ga0466959_0054639
379 Ga0495627_006134
380 Ga0495638_0156213
381 Ga0495648_0018142
382 Ga0495633_0000344
383 Ga0495625_0062667
384 Ga0495625_0144039
385 Ga0495649_0042877
386 Ga0495672_0015969
387 Ga0495672_0103775
388 Ga0495687_000014
389 Ga0495686_0000034
390 Ga0495686_0005149
391 Ga0495686_0024839
392 Ga0496101_0224308
393 Ga0496104_0465217
394 Ga0496121_0000010
395 Ga0496126_0006356
396 Ga0501032_0019012
397 Ga0501033_0127370
398 Ga0501034_0031601
399 Ga0501034_0045956
400 Ga0501034_0074393
401 Ga0501034_0384402
402 Ga0501034_0567544
403 Ga0501036_0010312
404 Ga0501038_0042289
405 Ga0501039_0055891
406 Ga0501043_0021088
407 Ga0501043_0065763
408 Ga0501047_0045084
409 Ga0501047_0059413
410 Ga0501047_0189478
411 Ga0501048_0134836
412 Ga0501067_0020451
413 Ga0501070_0133781
414 Ga0501073_0030294
415 Ga0501238_009706
416 Ga0501219_000385
417 Ga0501225_0000104
418 Ga0501225_0045569
419 Ga0501044_0006034
420 Ga0501044_0008528
421 Ga0501044_0259064
422 Ga0501284_00041
423 nmdc:mga0k408_104863_c1
424 nmdc:mga0k408_111523_c1
425 nmdc:mga0k408_37998_c1
426 nmdc:mga05p37_19037_c1
427 nmdc:mga05p37_89995_c1
428 nmdc:mga06r32_26442_c1
429 Ga0500644_0105120
430 Ga0500583_0000043
431 Ga0500583_0000936
432 Ga0500652_008803
433 Ga0500559_0033350
434 Ga0500568_0027970
435 Ga0500616_0073345
436 Ga0500622_0000987
437 Ga0500622_0014767
438 Ga0500633_0008350
439 Ga0500636_0141692
440 Ga0501084_0000686
441 Ga0501082_0046764
442 Ga0466962_0019649
443 2738726294
444 2819680556
445 2840677683
446 2883071158
447 2884798019
448 2896085501
449 2896113708
450 2929182850
451 2929244984
452 2929927244
453 2945978805
454 2946015329
455 8003151138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

15

290

0.94

PF00890

FAD_binding_2

FAD binding domain

13

51

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

12

310

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9205 1 317
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9169 1 318
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9123 1 317
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9115 1 318
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.9085 1 36
ID Description Score Start End Superfamily
af_Q2FYF3_156_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9375 157 318 3.50.50.60
af_P9WP27_7_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9314 5 35 3.40.50.720
5nc8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9117 5 35 3.40.50.720
af_P45522_400_562_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9111 3 34 3.40.50.720
4rcnA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9086 5 33 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A658JIW6-F1-model_v4 deleted 0.971 138 318
AF-A0A3C0ZNU9-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9612 95 318 GO:0016491
AF-A0A519RS63-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9611 101 318 GO:0016491
AF-A0A7C5I8L1-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9605 110 319
AF-A0A7C5R3F2-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9597 95 318 GO:0016491

Map