F340758

General Info

Members Datasets Scaffolds Average Seq Length
228 184 456 173

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100012906|Ga0070697_1000129062
Length 203
Sequence VPGYPRSVISPGCPHRRSTGFAVTSEESMVKITALVAAGLIVGLLVYAGTKPDAFSVQRSMDIKAPSEKIFTLIDDLQNWAAWSPWEKMDPIMKRTYSGAARGKGAVYEWEGNRDVGKGRMEITDTSSPSKVVIKLDFITPFEAHNTAEFTLGPAGDFTNVTWAMYGPNPYMSKVMTVFFDMDSMIGKQFETGLANLKAIAEN

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
182 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.04
Nodule 0
Rhizoplane 4.82
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100012906 3300005536 Bacteria 6546
2 SwRhRL2b_contig_1033581 2162886007 Bacteria 1939
3 MBSR1b_contig_11036974 2162886012 Bacteria 829
4 JGI25156J39149_1005888 3300002705 Bacteria 3450
5 JGI25154J39366_1000117 3300002738 Bacteria 65094
6 Ga0055526_1000086 3300003771 Bacteria 86198
7 Ga0055537_1000012 3300003773 Bacteria 133761
8 Ga0055524_1002521 3300003775 Bacteria 9389
9 Ga0055534_1000436 3300003784 Bacteria 24676
10 Ga0055528_1000134 3300003790 Bacteria 60071
11 Ga0065704_10104974 3300005289 Bacteria 2124
12 Ga0065704_10370839 3300005289 Bacteria 721
13 Ga0065715_10002055 3300005293 Bacteria 5461
14 Ga0065707_10207597 3300005295 Bacteria 1281
15 Ga0070690_100722316 3300005330 Bacteria 767
16 Ga0070670_100122143 3300005331 Bacteria 2246
17 Ga0068869_100726025 3300005334 Bacteria 849
18 Ga0070666_10177269 3300005335 Unclassified 1494
19 Ga0070666_10246563 3300005335 Bacteria 1264
20 Ga0070666_10512334 3300005335 Bacteria 870
21 Ga0068868_100045608 3300005338 Bacteria 3430
22 Ga0070689_100049661 3300005340 Bacteria 3240
23 Ga0070661_100035428 3300005344 Bacteria 3624
24 Ga0070669_100224917 3300005353 Bacteria 1485
25 Ga0070671_100017377 3300005355 Bacteria 5826
26 Ga0070674_100291834 3300005356 Unclassified 1297
27 Ga0070673_100069776 3300005364 Bacteria 2818
28 Ga0070659_101166452 3300005366 Unclassified 680
29 Ga0070709_10218795 3300005434 Bacteria 1357
30 Ga0070709_10640417 3300005434 Bacteria 822
31 Ga0070714_100265809 3300005435 Unclassified 1589
32 Ga0070713_100016796 3300005436 Bacteria 5512
33 Ga0070710_10177902 3300005437 Bacteria 1330
34 Ga0070701_10444404 3300005438 Bacteria 831
35 Ga0070701_10907088 3300005438 Bacteria 609
36 Ga0070705_100321640 3300005440 Bacteria 1117
37 Ga0070705_100375853 3300005440 Bacteria 1044
38 Ga0070705_100377651 3300005440 Bacteria 1042
39 Ga0070694_100558999 3300005444 Bacteria 917
40 Ga0070708_100260813 3300005445 Bacteria 1629
41 Ga0070681_10168287 3300005458 Bacteria 2114
42 Ga0068867_100268630 3300005459 Bacteria 1393
43 Ga0070685_10316750 3300005466 Bacteria 1056
44 Ga0070706_100115804 3300005467 Bacteria 2496
45 Ga0070706_100184117 3300005467 Bacteria 1951
46 Ga0070707_100000981 3300005468 Bacteria 28230
47 Ga0070707_100536523 3300005468 Bacteria 1132
48 Ga0070698_100165435 3300005471 Bacteria 2155
49 Ga0070698_100248997 3300005471 Bacteria 1710
50 Ga0070699_100010847 3300005518 Bacteria 7884
51 Ga0070699_101283778 3300005518 Viruses 671
52 Ga0070697_100320861 3300005536 Bacteria 1334
53 Ga0070672_100019058 3300005543 Bacteria 4972
54 Ga0070695_100045491 3300005545 Bacteria 2798
55 Ga0070696_100232010 3300005546 Bacteria 1389
56 Ga0070696_100342227 3300005546 Bacteria 1156
57 Ga0070696_100426604 3300005546 Bacteria 1042
58 Ga0070664_100079513 3300005564 Bacteria 2823
59 Ga0068857_100282229 3300005577 Bacteria 1528
60 Ga0068854_100008160 3300005578 Bacteria 6716
61 Ga0068854_100110019 3300005578 Bacteria 2077
62 Ga0068852_100010080 3300005616 Bacteria 7033
63 Ga0068859_100345885 3300005617 Bacteria 1581
64 Ga0068864_100831832 3300005618 Bacteria 909
65 Ga0068864_101020894 3300005618 Bacteria 821
66 Ga0068861_100813692 3300005719 Unclassified 878
67 Ga0068858_101138415 3300005842 Bacteria 766
68 Ga0070717_10768879 3300006028 Bacteria 876
69 Ga0075365_10044139 3300006038 Bacteria 2920
70 Ga0070716_100592103 3300006173 Unclassified 833
71 Ga0075362_10000952 3300006177 Bacteria 8838
72 Ga0075362_10139074 3300006177 Bacteria 1159
73 Ga0075362_10244965 3300006177 Bacteria 881
74 Ga0075369_10088355 3300006186 Bacteria 1381
75 Ga0075366_10167418 3300006195 Bacteria 1333
76 Ga0075366_10428875 3300006195 Bacteria 815
77 Ga0097621_100006785 3300006237 Bacteria 8136
78 Ga0097621_100149739 3300006237 Bacteria 2001
79 Ga0097621_101227472 3300006237 Bacteria 707
80 Ga0075370_10707042 3300006353 Bacteria 613
81 Ga0068871_100005203 3300006358 Bacteria 9095
82 Ga0075428_100157992 3300006844 Bacteria 2461
83 Ga0075428_100663613 3300006844 Bacteria 1112
84 Ga0075431_100421486 3300006847 Bacteria 1334
85 Ga0075433_10161393 3300006852 Bacteria 1995
86 Ga0075434_101051906 3300006871 Bacteria 828
87 Ga0068865_100498515 3300006881 Bacteria 1015
88 Ga0097620_100345881 3300006931 Bacteria 1581
89 Ga0099794_10067901 3300007265 Bacteria 1742
90 Ga0111539_10004381 3300009094 Bacteria 18469
91 Ga0105242_10410643 3300009176 Bacteria 1266
92 Ga0105248_10087205 3300009177 Bacteria 3512
93 Ga0105249_11130260 3300009553 Bacteria 854
94 Ga0099796_10309957 3300010159 Bacteria 671
95 Ga0157374_10014168 3300013296 Bacteria 6971
96 Ga0157378_10031378 3300013297 Bacteria 4695
97 Ga0163162_10032970 3300013306 Bacteria 5144
98 Ga0163162_11101845 3300013306 Bacteria 900
99 Ga0157380_10718729 3300014326 Bacteria 1006
100 Ga0157376_10139415 3300014969 Bacteria 2174
101 Ga0163161_10095881 3300017792 Bacteria 2201
102 Ga0213876_10001491 3300021384 Bacteria 14550
103 Ga0209435_100140 3300025206 Bacteria 24371
104 Ga0209646_1000020 3300025246 Bacteria 462204
105 Ga0209026_1002806 3300025250 Bacteria 6174
106 Ga0209759_1000073 3300025256 Bacteria 178048
107 Ga0209233_1003344 3300025261 Bacteria 5672
108 Ga0209565_1000057 3300025263 Bacteria 196908
109 Ga0209673_1000051 3300025273 Bacteria 282161
110 Ga0209675_1000027 3300025291 Bacteria 282175
111 Ga0209676_1016312 3300025292 Bacteria 2687
112 Ga0209564_1000009 3300025295 Bacteria 950196
113 Ga0209564_1000094 3300025295 Bacteria 243176
114 Ga0209256_1000139 3300025299 Bacteria 155515
115 Ga0207426_1005838 3300025302 Bacteria 5500
116 Ga0207680_10022388 3300025903 Bacteria 3436
117 Ga0207680_10875065 3300025903 Bacteria 644
118 Ga0207699_10020124 3300025906 Bacteria 3571
119 Ga0207699_10179176 3300025906 Bacteria 1423
120 Ga0207705_10030293 3300025909 Bacteria 3861
121 Ga0207684_10074327 3300025910 Bacteria 2888
122 Ga0207684_10193358 3300025910 Bacteria 1755
123 Ga0207646_10000125 3300025922 Bacteria 103911
124 Ga0207650_10009822 3300025925 Bacteria 6545
125 Ga0207659_10081934 3300025926 Bacteria 2387
126 Ga0207659_10172372 3300025926 Bacteria 1708
127 Ga0207700_10036339 3300025928 Bacteria 3556
128 Ga0207644_10014001 3300025931 Bacteria 5362
129 Ga0207670_10208010 3300025936 Bacteria 1490
130 Ga0207665_10870229 3300025939 Unclassified 714
131 Ga0207691_10025338 3300025940 Bacteria 5571
132 Ga0207711_10666533 3300025941 Bacteria 970
133 Ga0207651_10360968 3300025960 Bacteria 1226
134 Ga0207677_10005665 3300026023 Bacteria 6794
135 Ga0207648_10056026 3300026089 Bacteria 3441
136 Ga0207676_10717348 3300026095 Bacteria 970
137 Ga0207674_10079318 3300026116 Bacteria 3287
138 Ga0207675_100092861 3300026118 Unclassified 2838
139 Ga0207675_100145603 3300026118 Bacteria 2252
140 Ga0207683_10004513 3300026121 Bacteria 12013
141 Ga0207428_10015704 3300027907 Bacteria 6541
142 Ga0265327_10001967 3300031251 Bacteria 23494
143 Ga0307408_100033235 3300031548 Bacteria 3602
144 Ga0307405_10025221 3300031731 Bacteria 3409
145 Ga0307413_10078921 3300031824 Bacteria 2102
146 Ga0307410_10010843 3300031852 Bacteria 5186
147 Ga0307407_10008304 3300031903 Bacteria 4759
148 Ga0307412_10022906 3300031911 Bacteria 3836
149 Ga0307409_100004179 3300031995 Bacteria 8044
150 Ga0307416_100004578 3300032002 Bacteria 8357
151 Ga0307411_10120743 3300032005 Bacteria 1895
152 Ga0307415_100055006 3300032126 Bacteria 2720
153 Ga0373934_0149252 3300035086 Bacteria 957
154 Ga0373933_0086899 3300035724 Bacteria 1925
155 Ga0373933_0339093 3300035724 Bacteria 976
156 Ga0373937_0084695 3300036401 Bacteria 2933
157 Ga0395898_1280741 3300037466 Bacteria 663
158 Ga0436365_0921625 3300039437 Bacteria 24575
159 Ga0436362_0741099 3300039453 Bacteria 4353
160 Ga0451804_1159627 3300041463 Bacteria 866
161 Ga0451807_2722753 3300041486 Bacteria 725
162 Ga0495629_0013187 3300046459 Bacteria 5967
163 Ga0495662_0284244 3300046476 Bacteria 814
164 Ga0495584_0001834 3300046491 Bacteria 12339
165 Ga0495585_0000184 3300046492 Bacteria 66520
166 Ga0495585_0080102 3300046492 Bacteria 1770
167 Ga0495596_0001167 3300046500 Bacteria 15399
168 Ga0495583_0000903 3300046506 Bacteria 35338
169 Ga0495663_0019041 3300046525 Bacteria 1960
170 Ga0495642_0014970 3300046528 Bacteria 3010
171 Ga0495633_0001584 3300046558 Bacteria 17352
172 Ga0495668_0001881 3300046616 Bacteria 18807
173 Ga0495668_0231813 3300046616 Bacteria 1011
174 Ga0495661_0275494 3300046665 Bacteria 850
175 Ga0495599_0155747 3300046678 Bacteria 1414
176 Ga0495624_0813917 3300046690 Bacteria 552
177 Ga0495636_0012418 3300047318 Bacteria 3373
178 Ga0495680_0494205 3300047322 Bacteria 831
179 Ga0495683_0000182 3300047323 Bacteria 61818
180 Ga0495685_036472 3300047447 Bacteria 1688
181 Ga0495626_0297641 3300048091 Bacteria 638
182 Ga0496102_0008653 3300048905 Bacteria 8736
183 Ga0496102_0024737 3300048905 Bacteria 5341
184 Ga0496102_0050972 3300048905 Bacteria 3770
185 Ga0496103_0025232 3300048906 Bacteria 3591
186 Ga0496107_0301278 3300048910 Bacteria 1193
187 Ga0496109_0011004 3300048912 Bacteria 7754
188 Ga0496110_0075121 3300048913 Bacteria 3003
189 Ga0496114_0021498 3300048917 Bacteria 5249
190 Ga0496114_0184526 3300048917 Bacteria 1823
191 Ga0496125_0002721 3300048928 Bacteria 22456
192 Ga0496125_0164873 3300048928 Bacteria 1499
193 Ga0496126_0080226 3300048929 Bacteria 2888
194 Ga0501034_0029409 3300049571 Bacteria 5583
195 Ga0501038_0256158 3300049574 Bacteria 1384
196 Ga0501046_0000010 3300049580 Bacteria 331082
197 Ga0501047_0268001 3300049581 Bacteria 1554
198 Ga0501071_0483271 3300049587 Bacteria 949
199 Ga0501072_0091615 3300049588 Bacteria 2413
200 Ga0501074_0895388 3300049590 Bacteria 625
201 Ga0501076_0119648 3300049592 Bacteria 2132
202 Ga0501076_0126124 3300049592 Bacteria 2074
203 Ga0501077_0129119 3300049593 Bacteria 1602
204 Ga0501079_0149424 3300049741 Bacteria 1821
205 Ga0501083_0008389 3300049744 Bacteria 7306
206 Ga0501045_0070232 3300049824 Bacteria 2576
207 Ga0501045_0545140 3300049824 Bacteria 860
208 nmdc:mga03683_169405_c1 3300050489 Bacteria 992
209 nmdc:mga03683_264579_c1 3300050489 Bacteria 801
210 nmdc:mga03683_31154_c1 3300050489 Bacteria 2138
211 nmdc:mga03683_6420_c1 3300050489 Bacteria 4024
212 nmdc:mga03683_91595_c1 3300050489 Bacteria 1326
213 nmdc:mga0yw44_12735_c1 3300050492 Bacteria 4396
214 nmdc:mga06z11_327152_c1 3300050494 Bacteria 915
215 nmdc:mga09592_22502_c1 3300050508 Bacteria 5202
216 nmdc:mga0qj67_23465_c1 3300050509 Bacteria 4747
217 nmdc:mga0qj67_74728_c1 3300050509 Bacteria 2708
218 nmdc:mga06r32_15002_c1 3300050510 Bacteria 7033
219 nmdc:mga06r32_425529_c1 3300050510 Bacteria 1309
220 nmdc:mga08y16_22236_c1 3300050511 Bacteria 6692
221 nmdc:mga0n895_348598_c1 3300050512 Bacteria 1499
222 nmdc:mga0sz30_65732_c1 3300050516 Bacteria 1555
223 Ga0495601_0041676 3300053077 Bacteria 2879
224 Ga0495619_0082087 3300053085 Bacteria 2172
225 Ga0500636_0037115 3300053177 Bacteria 2883
226 Ga0500552_017957 3300053733 Bacteria 975
227 Ga0501082_0326745 3300060353 Bacteria 1336
228 Ga0530510_0080995 3300061734 Bacteria 2363
229 Ga0070697_100012906
230 SwRhRL2b_contig_1033581
231 MBSR1b_contig_11036974
232 JGI25156J39149_1005888
233 JGI25154J39366_1000117
234 Ga0055526_1000086
235 Ga0055537_1000012
236 Ga0055524_1002521
237 Ga0055534_1000436
238 Ga0055528_1000134
239 Ga0065704_10104974
240 Ga0065704_10370839
241 Ga0065715_10002055
242 Ga0065707_10207597
243 Ga0070690_100722316
244 Ga0070670_100122143
245 Ga0068869_100726025
246 Ga0070666_10177269
247 Ga0070666_10246563
248 Ga0070666_10512334
249 Ga0068868_100045608
250 Ga0070689_100049661
251 Ga0070661_100035428
252 Ga0070669_100224917
253 Ga0070671_100017377
254 Ga0070674_100291834
255 Ga0070673_100069776
256 Ga0070659_101166452
257 Ga0070709_10218795
258 Ga0070709_10640417
259 Ga0070714_100265809
260 Ga0070713_100016796
261 Ga0070710_10177902
262 Ga0070701_10444404
263 Ga0070701_10907088
264 Ga0070705_100321640
265 Ga0070705_100375853
266 Ga0070705_100377651
267 Ga0070694_100558999
268 Ga0070708_100260813
269 Ga0070681_10168287
270 Ga0068867_100268630
271 Ga0070685_10316750
272 Ga0070706_100115804
273 Ga0070706_100184117
274 Ga0070707_100000981
275 Ga0070707_100536523
276 Ga0070698_100165435
277 Ga0070698_100248997
278 Ga0070699_100010847
279 Ga0070699_101283778
280 Ga0070697_100320861
281 Ga0070672_100019058
282 Ga0070695_100045491
283 Ga0070696_100232010
284 Ga0070696_100342227
285 Ga0070696_100426604
286 Ga0070664_100079513
287 Ga0068857_100282229
288 Ga0068854_100008160
289 Ga0068854_100110019
290 Ga0068852_100010080
291 Ga0068859_100345885
292 Ga0068864_100831832
293 Ga0068864_101020894
294 Ga0068861_100813692
295 Ga0068858_101138415
296 Ga0070717_10768879
297 Ga0075365_10044139
298 Ga0070716_100592103
299 Ga0075362_10000952
300 Ga0075362_10139074
301 Ga0075362_10244965
302 Ga0075369_10088355
303 Ga0075366_10167418
304 Ga0075366_10428875
305 Ga0097621_100006785
306 Ga0097621_100149739
307 Ga0097621_101227472
308 Ga0075370_10707042
309 Ga0068871_100005203
310 Ga0075428_100157992
311 Ga0075428_100663613
312 Ga0075431_100421486
313 Ga0075433_10161393
314 Ga0075434_101051906
315 Ga0068865_100498515
316 Ga0097620_100345881
317 Ga0099794_10067901
318 Ga0111539_10004381
319 Ga0105242_10410643
320 Ga0105248_10087205
321 Ga0105249_11130260
322 Ga0099796_10309957
323 Ga0157374_10014168
324 Ga0157378_10031378
325 Ga0163162_10032970
326 Ga0163162_11101845
327 Ga0157380_10718729
328 Ga0157376_10139415
329 Ga0163161_10095881
330 Ga0213876_10001491
331 Ga0209435_100140
332 Ga0209646_1000020
333 Ga0209026_1002806
334 Ga0209759_1000073
335 Ga0209233_1003344
336 Ga0209565_1000057
337 Ga0209673_1000051
338 Ga0209675_1000027
339 Ga0209676_1016312
340 Ga0209564_1000009
341 Ga0209564_1000094
342 Ga0209256_1000139
343 Ga0207426_1005838
344 Ga0207680_10022388
345 Ga0207680_10875065
346 Ga0207699_10020124
347 Ga0207699_10179176
348 Ga0207705_10030293
349 Ga0207684_10074327
350 Ga0207684_10193358
351 Ga0207646_10000125
352 Ga0207650_10009822
353 Ga0207659_10081934
354 Ga0207659_10172372
355 Ga0207700_10036339
356 Ga0207644_10014001
357 Ga0207670_10208010
358 Ga0207665_10870229
359 Ga0207691_10025338
360 Ga0207711_10666533
361 Ga0207651_10360968
362 Ga0207677_10005665
363 Ga0207648_10056026
364 Ga0207676_10717348
365 Ga0207674_10079318
366 Ga0207675_100092861
367 Ga0207675_100145603
368 Ga0207683_10004513
369 Ga0207428_10015704
370 Ga0265327_10001967
371 Ga0307408_100033235
372 Ga0307405_10025221
373 Ga0307413_10078921
374 Ga0307410_10010843
375 Ga0307407_10008304
376 Ga0307412_10022906
377 Ga0307409_100004179
378 Ga0307416_100004578
379 Ga0307411_10120743
380 Ga0307415_100055006
381 Ga0373934_0149252
382 Ga0373933_0086899
383 Ga0373933_0339093
384 Ga0373937_0084695
385 Ga0395898_1280741
386 Ga0436365_0921625
387 Ga0436362_0741099
388 Ga0451804_1159627
389 Ga0451807_2722753
390 Ga0495629_0013187
391 Ga0495662_0284244
392 Ga0495584_0001834
393 Ga0495585_0000184
394 Ga0495585_0080102
395 Ga0495596_0001167
396 Ga0495583_0000903
397 Ga0495663_0019041
398 Ga0495642_0014970
399 Ga0495633_0001584
400 Ga0495668_0001881
401 Ga0495668_0231813
402 Ga0495661_0275494
403 Ga0495599_0155747
404 Ga0495624_0813917
405 Ga0495636_0012418
406 Ga0495680_0494205
407 Ga0495683_0000182
408 Ga0495685_036472
409 Ga0495626_0297641
410 Ga0496102_0008653
411 Ga0496102_0024737
412 Ga0496102_0050972
413 Ga0496103_0025232
414 Ga0496107_0301278
415 Ga0496109_0011004
416 Ga0496110_0075121
417 Ga0496114_0021498
418 Ga0496114_0184526
419 Ga0496125_0002721
420 Ga0496125_0164873
421 Ga0496126_0080226
422 Ga0501034_0029409
423 Ga0501038_0256158
424 Ga0501046_0000010
425 Ga0501047_0268001
426 Ga0501071_0483271
427 Ga0501072_0091615
428 Ga0501074_0895388
429 Ga0501076_0119648
430 Ga0501076_0126124
431 Ga0501077_0129119
432 Ga0501079_0149424
433 Ga0501083_0008389
434 Ga0501045_0070232
435 Ga0501045_0545140
436 nmdc:mga03683_169405_c1
437 nmdc:mga03683_264579_c1
438 nmdc:mga03683_31154_c1
439 nmdc:mga03683_6420_c1
440 nmdc:mga03683_91595_c1
441 nmdc:mga0yw44_12735_c1
442 nmdc:mga06z11_327152_c1
443 nmdc:mga09592_22502_c1
444 nmdc:mga0qj67_23465_c1
445 nmdc:mga0qj67_74728_c1
446 nmdc:mga06r32_15002_c1
447 nmdc:mga06r32_425529_c1
448 nmdc:mga08y16_22236_c1
449 nmdc:mga0n895_348598_c1
450 nmdc:mga0sz30_65732_c1
451 Ga0495601_0041676
452 Ga0495619_0082087
453 Ga0500636_0037115
454 Ga0500552_017957
455 Ga0501082_0326745
456 Ga0530510_0080995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

54

202

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7966 21 168
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.7909 17 169
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.7857 17 169
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7824 18 169
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7775 18 169
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7966 21 168 3.30.530.20
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7926 25 169 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7905 18 167 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7887 23 169 3.30.530.20
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7823 25 169 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q4XAQ7-F1-model_v4 PhnB-like domain-containing protein 0.9872 2 169 GO:0016020
AF-A0A2W4T9M8-F1-model_v4 Polyketide cyclase 0.9852 2 169
AF-A0A7Y1US70-F1-model_v4 SRPBCC family protein 0.9849 23 115
AF-A0A1H2EWI8-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9838 5 169
AF-A0A7Y3B323-F1-model_v4 SRPBCC family protein 0.9816 23 129

Map