F340981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 228 | 138 | 228 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10017336|Ga0157372_100173367 |
| Length | 305 |
| Sequence | MRGEGMGDAWFAFDASIIEGAARRRRTIMNDSTDITVPFAHAVIEAVRRVAADEIMPRYRSVVATRKDDGSLLTEADLASQRALVRALGAIEPVPVMGEEMAPEKQVRIFESAPRFWCVDPIDGTANFAAGIPYFAVSVALMENARPLFGTVYDPVADTAYYAVRGGGAWKDHRPLELAPEAPPLARAHAEVSLRRDTRALRGAIKNHRPYGKRRTSGSSTLSWCDLAQGRIDAMLHSGQKMWDYAAGSLILCEARGALCTIETDDFWSAPAWNRSVIAARSEKLLVEWRQWIRGHLASREPDSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 12 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 28 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 85 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 86 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 87 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 88 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 91 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 92 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 93 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 94 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 95 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 96 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 99 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 100 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 101 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 102 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 103 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 104 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 108 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.63 |
| Rhizosphere | 97.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10080869 | 3300005327 | Bacteria | 2669 |
| 2 | Ga0070683_100280088 | 3300005329 | Bacteria | 1586 |
| 3 | Ga0070680_100567345 | 3300005336 | Bacteria | 973 |
| 4 | Ga0068868_100276415 | 3300005338 | Bacteria | 1420 |
| 5 | Ga0068868_100364783 | 3300005338 | Bacteria | 1240 |
| 6 | Ga0070689_100193426 | 3300005340 | Bacteria | 1657 |
| 7 | Ga0070689_100362975 | 3300005340 | Bacteria | 1217 |
| 8 | Ga0070661_100059313 | 3300005344 | Bacteria | 2806 |
| 9 | Ga0070692_10018051 | 3300005345 | Bacteria | 3385 |
| 10 | Ga0070674_100040402 | 3300005356 | Bacteria | 3156 |
| 11 | Ga0070674_100178265 | 3300005356 | Bacteria | 1625 |
| 12 | Ga0070659_100010620 | 3300005366 | Bacteria | 6781 |
| 13 | Ga0070659_100130125 | 3300005366 | Bacteria | 2043 |
| 14 | Ga0070659_100501311 | 3300005366 | Bacteria | 1035 |
| 15 | Ga0070700_100000310 | 3300005441 | Bacteria | 25261 |
| 16 | Ga0068867_100131559 | 3300005459 | Bacteria | 1945 |
| 17 | Ga0068867_100175390 | 3300005459 | Bacteria | 1701 |
| 18 | Ga0070685_10094055 | 3300005466 | Bacteria | 1819 |
| 19 | Ga0070679_100063220 | 3300005530 | Bacteria | 3690 |
| 20 | Ga0070684_100060929 | 3300005535 | Bacteria | 3302 |
| 21 | Ga0070684_100354251 | 3300005535 | Bacteria | 1350 |
| 22 | Ga0068853_100025574 | 3300005539 | Bacteria | 4955 |
| 23 | Ga0070672_100194687 | 3300005543 | Bacteria | 1694 |
| 24 | Ga0068855_100050611 | 3300005563 | Bacteria | 4895 |
| 25 | Ga0068855_100062235 | 3300005563 | Bacteria | 4357 |
| 26 | Ga0068857_100002306 | 3300005577 | Bacteria | 15509 |
| 27 | Ga0068857_100017243 | 3300005577 | Bacteria | 6327 |
| 28 | Ga0068857_100033859 | 3300005577 | Bacteria | 4519 |
| 29 | Ga0068852_100001951 | 3300005616 | Bacteria | 14045 |
| 30 | Ga0068852_100022464 | 3300005616 | Bacteria | 5059 |
| 31 | Ga0068852_100024635 | 3300005616 | Bacteria | 4867 |
| 32 | Ga0068859_100011952 | 3300005617 | Bacteria | 8720 |
| 33 | Ga0068859_100130947 | 3300005617 | Bacteria | 2580 |
| 34 | Ga0068851_10007314 | 3300005834 | Bacteria | 5064 |
| 35 | Ga0068870_10132769 | 3300005840 | Bacteria | 1448 |
| 36 | Ga0068863_100119815 | 3300005841 | Bacteria | 2508 |
| 37 | Ga0068858_100002547 | 3300005842 | Bacteria | 18383 |
| 38 | Ga0068860_100324772 | 3300005843 | Bacteria | 1511 |
| 39 | Ga0097621_100027251 | 3300006237 | Bacteria | 4491 |
| 40 | Ga0068871_100231483 | 3300006358 | Bacteria | 1604 |
| 41 | Ga0075431_100075096 | 3300006847 | Bacteria | 3488 |
| 42 | Ga0097620_100011952 | 3300006931 | Bacteria | 8720 |
| 43 | Ga0097620_100130940 | 3300006931 | Bacteria | 2580 |
| 44 | Ga0105240_10077880 | 3300009093 | Bacteria | 4084 |
| 45 | Ga0105245_10063751 | 3300009098 | Bacteria | 3329 |
| 46 | Ga0105245_10190388 | 3300009098 | Bacteria | 1965 |
| 47 | Ga0105243_10514794 | 3300009148 | Bacteria | 1137 |
| 48 | Ga0105241_10003882 | 3300009174 | Bacteria | 11084 |
| 49 | Ga0105241_10392937 | 3300009174 | Bacteria | 1215 |
| 50 | Ga0105242_10205521 | 3300009176 | Bacteria | 1751 |
| 51 | Ga0105248_10043033 | 3300009177 | Bacteria | 5064 |
| 52 | Ga0105237_10040502 | 3300009545 | Bacteria | 4698 |
| 53 | Ga0105238_10039082 | 3300009551 | Bacteria | 4814 |
| 54 | Ga0105238_10058234 | 3300009551 | Bacteria | 3873 |
| 55 | Ga0105239_10137593 | 3300010375 | Bacteria | 2719 |
| 56 | Ga0105239_10162825 | 3300010375 | Bacteria | 2493 |
| 57 | Ga0105246_10031264 | 3300011119 | Bacteria | 3522 |
| 58 | Ga0157373_10059555 | 3300013100 | Bacteria | 2706 |
| 59 | Ga0157371_10112437 | 3300013102 | Bacteria | 1933 |
| 60 | Ga0157370_10037008 | 3300013104 | Bacteria | 4734 |
| 61 | Ga0157370_10176890 | 3300013104 | Bacteria | 1983 |
| 62 | Ga0157370_10216180 | 3300013104 | Bacteria | 1776 |
| 63 | Ga0157369_10002101 | 3300013105 | Bacteria | 24017 |
| 64 | Ga0157374_10157682 | 3300013296 | Bacteria | 2210 |
| 65 | Ga0157378_10073586 | 3300013297 | Bacteria | 3072 |
| 66 | Ga0157378_10328019 | 3300013297 | Bacteria | 1489 |
| 67 | Ga0163162_10108589 | 3300013306 | Bacteria | 2871 |
| 68 | Ga0163162_10132530 | 3300013306 | Bacteria | 2601 |
| 69 | Ga0157372_10017336 | 3300013307 | Bacteria | 7731 |
| 70 | Ga0157375_10072176 | 3300013308 | Bacteria | 3468 |
| 71 | Ga0157375_10394851 | 3300013308 | Bacteria | 1550 |
| 72 | Ga0163163_10249889 | 3300014325 | Bacteria | 1824 |
| 73 | Ga0157377_10020441 | 3300014745 | Bacteria | 3469 |
| 74 | Ga0157376_10081515 | 3300014969 | Bacteria | 2778 |
| 75 | Ga0207656_10000551 | 3300025321 | Bacteria | 12395 |
| 76 | Ga0207643_10187695 | 3300025908 | Bacteria | 1254 |
| 77 | Ga0207705_10063791 | 3300025909 | Bacteria | 2662 |
| 78 | Ga0207654_10008080 | 3300025911 | Bacteria | 5304 |
| 79 | Ga0207707_10191179 | 3300025912 | Bacteria | 1786 |
| 80 | Ga0207671_10043913 | 3300025914 | Bacteria | 3304 |
| 81 | Ga0207660_10185247 | 3300025917 | Bacteria | 1619 |
| 82 | Ga0207652_10025485 | 3300025921 | Bacteria | 4918 |
| 83 | Ga0207652_10417711 | 3300025921 | Bacteria | 1210 |
| 84 | Ga0207659_10083711 | 3300025926 | Bacteria | 2365 |
| 85 | Ga0207687_10103649 | 3300025927 | Bacteria | 2098 |
| 86 | Ga0207664_10011625 | 3300025929 | Bacteria | 6269 |
| 87 | Ga0207690_10050044 | 3300025932 | Bacteria | 2788 |
| 88 | Ga0207686_10001736 | 3300025934 | Bacteria | 12122 |
| 89 | Ga0207670_10176400 | 3300025936 | Bacteria | 1606 |
| 90 | Ga0207704_10039758 | 3300025938 | Bacteria | 2743 |
| 91 | Ga0207689_10178949 | 3300025942 | Bacteria | 1749 |
| 92 | Ga0207661_10222641 | 3300025944 | Bacteria | 1668 |
| 93 | Ga0207667_10046123 | 3300025949 | Bacteria | 4615 |
| 94 | Ga0207667_10047012 | 3300025949 | Bacteria | 4569 |
| 95 | Ga0207667_10093484 | 3300025949 | Bacteria | 3105 |
| 96 | Ga0207667_10870090 | 3300025949 | Bacteria | 894 |
| 97 | Ga0207658_10340818 | 3300025986 | Unclassified | 1303 |
| 98 | Ga0207677_10019685 | 3300026023 | Bacteria | 4082 |
| 99 | Ga0207677_10157095 | 3300026023 | Bacteria | 1762 |
| 100 | Ga0207703_10026726 | 3300026035 | Bacteria | 4545 |
| 101 | Ga0207703_10037967 | 3300026035 | Bacteria | 3840 |
| 102 | Ga0207703_10080687 | 3300026035 | Bacteria | 2710 |
| 103 | Ga0207639_10002742 | 3300026041 | Bacteria | 11819 |
| 104 | Ga0207639_10237204 | 3300026041 | Bacteria | 1584 |
| 105 | Ga0207708_10015366 | 3300026075 | Bacteria | 5742 |
| 106 | Ga0207648_10178437 | 3300026089 | Bacteria | 1879 |
| 107 | Ga0207674_10012942 | 3300026116 | Bacteria | 9304 |
| 108 | Ga0207675_100221582 | 3300026118 | Bacteria | 1823 |
| 109 | Ga0207683_10114988 | 3300026121 | Bacteria | 2412 |
| 110 | Ga0207698_10001345 | 3300026142 | Bacteria | 14324 |
| 111 | Ga0207698_10031596 | 3300026142 | Bacteria | 3824 |
| 112 | Ga0207698_10037180 | 3300026142 | Bacteria | 3583 |
| 113 | Ga0268266_10259621 | 3300028379 | Bacteria | 1610 |
| 114 | Ga0265331_10001994 | 3300031250 | Bacteria | 14251 |
| 115 | Ga0265331_10003198 | 3300031250 | Bacteria | 10693 |
| 116 | Ga0265331_10004021 | 3300031250 | Bacteria | 9279 |
| 117 | Ga0265331_10028752 | 3300031250 | Bacteria | 2778 |
| 118 | Ga0265327_10000923 | 3300031251 | Bacteria | 43037 |
| 119 | Ga0265327_10009990 | 3300031251 | Bacteria | 6754 |
| 120 | Ga0307408_100054851 | 3300031548 | Bacteria | 2883 |
| 121 | Ga0307408_100104334 | 3300031548 | Bacteria | 2166 |
| 122 | Ga0316575_10003815 | 3300031665 | Bacteria | 5251 |
| 123 | Ga0316575_10016344 | 3300031665 | Bacteria | 2807 |
| 124 | Ga0316579_10005342 | 3300031691 | Bacteria | 5176 |
| 125 | Ga0316579_10016561 | 3300031691 | Bacteria | 3222 |
| 126 | Ga0316578_10095292 | 3300031728 | Bacteria | 1781 |
| 127 | Ga0316578_10127089 | 3300031728 | Bacteria | 1533 |
| 128 | Ga0316577_10029024 | 3300031733 | Bacteria | 3088 |
| 129 | Ga0316577_10031123 | 3300031733 | Bacteria | 2981 |
| 130 | Ga0316577_10046411 | 3300031733 | Bacteria | 2426 |
| 131 | Ga0316577_10158270 | 3300031733 | Bacteria | 1277 |
| 132 | Ga0307413_10346860 | 3300031824 | Bacteria | 1144 |
| 133 | Ga0307416_100069030 | 3300032002 | Bacteria | 2923 |
| 134 | Ga0307416_100076065 | 3300032002 | Bacteria | 2812 |
| 135 | Ga0307416_100214442 | 3300032002 | Bacteria | 1840 |
| 136 | Ga0307416_100483386 | 3300032002 | Bacteria | 1299 |
| 137 | Ga0316585_10007298 | 3300032137 | Bacteria | 3183 |
| 138 | Ga0316585_10091353 | 3300032137 | Unclassified | 995 |
| 139 | Ga0316582_0008765 | 3300036647 | Bacteria | 5451 |
| 140 | Ga0316582_0012213 | 3300036647 | Bacteria | 4783 |
| 141 | Ga0316582_0036165 | 3300036647 | Bacteria | 3054 |
| 142 | Ga0316582_0131686 | 3300036647 | Bacteria | 1680 |
| 143 | Ga0316584_0045081 | 3300036712 | Bacteria | 3290 |
| 144 | Ga0316584_0061109 | 3300036712 | Bacteria | 2822 |
| 145 | Ga0316584_0096882 | 3300036712 | Bacteria | 2208 |
| 146 | Ga0316584_0104601 | 3300036712 | Bacteria | 2119 |
| 147 | Ga0316584_0359677 | 3300036712 | Bacteria | 1044 |
| 148 | Ga0316581_0009538 | 3300037588 | Bacteria | 2671 |
| 149 | Ga0316581_0061899 | 3300037588 | Bacteria | 1148 |
| 150 | Ga0395901_0425982 | 3300038443 | Bacteria | 1360 |
| 151 | Ga0451577_0000501 | 3300042876 | Bacteria | 65919 |
| 152 | Ga0451577_0003671 | 3300042876 | Bacteria | 16814 |
| 153 | Ga0451577_0320839 | 3300042876 | Bacteria | 1405 |
| 154 | Ga0466966_0121661 | 3300044684 | Bacteria | 1603 |
| 155 | Ga0453684_0004098 | 3300044712 | Bacteria | 31613 |
| 156 | Ga0453684_0134829 | 3300044712 | Bacteria | 2958 |
| 157 | Ga0466957_0011844 | 3300044842 | Bacteria | 5041 |
| 158 | Ga0466959_0029429 | 3300045049 | Bacteria | 4069 |
| 159 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 160 | Ga0451576_0000801 | 3300045051 | Bacteria | 61543 |
| 161 | Ga0451576_0001865 | 3300045051 | Bacteria | 34037 |
| 162 | Ga0451576_0002074 | 3300045051 | Bacteria | 31365 |
| 163 | Ga0451576_0113295 | 3300045051 | Bacteria | 2823 |
| 164 | Ga0451576_0783369 | 3300045051 | Bacteria | 1001 |
| 165 | Ga0466958_0085119 | 3300045836 | Bacteria | 1950 |
| 166 | Ga0496104_0167203 | 3300048907 | Bacteria | 2109 |
| 167 | Ga0496105_0455405 | 3300048908 | Unclassified | 1009 |
| 168 | Ga0496108_0075229 | 3300048911 | Bacteria | 2853 |
| 169 | Ga0496109_0724430 | 3300048912 | Bacteria | 932 |
| 170 | Ga0496110_0070669 | 3300048913 | Bacteria | 3094 |
| 171 | Ga0496114_0001419 | 3300048917 | Bacteria | 18174 |
| 172 | Ga0501031_0043406 | 3300049568 | Bacteria | 2934 |
| 173 | Ga0501032_0004647 | 3300049569 | Bacteria | 10317 |
| 174 | Ga0501032_0071485 | 3300049569 | Bacteria | 2312 |
| 175 | Ga0501032_0179704 | 3300049569 | Bacteria | 1385 |
| 176 | Ga0501033_0003230 | 3300049570 | Bacteria | 13484 |
| 177 | Ga0501033_0013653 | 3300049570 | Bacteria | 6182 |
| 178 | Ga0501033_0021956 | 3300049570 | Bacteria | 4814 |
| 179 | Ga0501034_0001644 | 3300049571 | Bacteria | 28871 |
| 180 | Ga0501034_0093195 | 3300049571 | Bacteria | 3008 |
| 181 | Ga0501036_0120922 | 3300049572 | Unclassified | 2211 |
| 182 | Ga0501036_0135648 | 3300049572 | Bacteria | 2077 |
| 183 | Ga0501037_0113152 | 3300049573 | Bacteria | 1954 |
| 184 | Ga0501038_0013089 | 3300049574 | Bacteria | 7568 |
| 185 | Ga0501038_0035607 | 3300049574 | Bacteria | 4369 |
| 186 | Ga0501038_0047008 | 3300049574 | Bacteria | 3740 |
| 187 | Ga0501038_0073444 | 3300049574 | Bacteria | 2896 |
| 188 | Ga0501038_0270595 | 3300049574 | Bacteria | 1340 |
| 189 | Ga0501039_0007336 | 3300049575 | Bacteria | 8401 |
| 190 | Ga0501040_0003670 | 3300049576 | Bacteria | 9940 |
| 191 | Ga0501042_0002512 | 3300049578 | Bacteria | 11297 |
| 192 | Ga0501043_0018143 | 3300049579 | Bacteria | 5516 |
| 193 | Ga0501043_0018397 | 3300049579 | Bacteria | 5479 |
| 194 | Ga0501043_0030751 | 3300049579 | Bacteria | 4222 |
| 195 | Ga0501043_0192792 | 3300049579 | Unclassified | 1584 |
| 196 | Ga0501046_0005898 | 3300049580 | Bacteria | 10921 |
| 197 | Ga0501046_0010092 | 3300049580 | Bacteria | 8128 |
| 198 | Ga0501046_0342188 | 3300049580 | Unclassified | 1087 |
| 199 | Ga0501047_0003233 | 3300049581 | Bacteria | 15446 |
| 200 | Ga0501047_0108479 | 3300049581 | Bacteria | 2658 |
| 201 | Ga0501048_0034431 | 3300049582 | Bacteria | 3653 |
| 202 | Ga0501067_0084518 | 3300049583 | Bacteria | 1760 |
| 203 | Ga0501068_0000509 | 3300049584 | Bacteria | 19755 |
| 204 | Ga0501068_0227513 | 3300049584 | Bacteria | 1186 |
| 205 | Ga0501069_0002634 | 3300049585 | Bacteria | 9157 |
| 206 | Ga0501070_0004327 | 3300049586 | Bacteria | 12206 |
| 207 | Ga0501072_0010884 | 3300049588 | Bacteria | 6938 |
| 208 | Ga0501072_0452751 | 3300049588 | Unclassified | 1016 |
| 209 | Ga0501073_0001888 | 3300049589 | Bacteria | 15612 |
| 210 | Ga0501073_0010377 | 3300049589 | Bacteria | 6831 |
| 211 | Ga0501074_0016578 | 3300049590 | Bacteria | 5348 |
| 212 | Ga0501074_0029097 | 3300049590 | Bacteria | 4002 |
| 213 | Ga0501077_0214979 | 3300049593 | Bacteria | 1222 |
| 214 | Ga0501079_0004017 | 3300049741 | Bacteria | 10885 |
| 215 | Ga0501080_0007029 | 3300049742 | Bacteria | 10162 |
| 216 | Ga0501083_0001055 | 3300049744 | Bacteria | 18371 |
| 217 | Ga0501035_0000258 | 3300049822 | Bacteria | 63033 |
| 218 | Ga0501035_0007708 | 3300049822 | Bacteria | 10054 |
| 219 | Ga0501035_0013795 | 3300049822 | Bacteria | 7459 |
| 220 | Ga0501044_0000186 | 3300049823 | Bacteria | 77642 |
| 221 | Ga0501044_0012433 | 3300049823 | Bacteria | 9217 |
| 222 | Ga0501044_0022421 | 3300049823 | Bacteria | 6729 |
| 223 | Ga0501044_0405614 | 3300049823 | Bacteria | 1275 |
| 224 | Ga0501045_0001846 | 3300049824 | Bacteria | 14316 |
| 225 | Ga0501045_0432075 | 3300049824 | Bacteria | 979 |
| 226 | nmdc:mga0n895_259242_c1 | 3300050512 | Bacteria | 1764 |
| 227 | nmdc:mga0a205_54011_c1 | 3300050515 | Bacteria | 3878 |
| 228 | Ga0501082_0109680 | 3300060353 | Bacteria | 2389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048911 | Ga0496108_0075229 | Ga0496108_0075229_754_1500 | 247 |
| 2 | 3300005336 | Ga0070680_100567345 | Ga0070680_1005673451 | 259 |
| 3 | 3300005340 | Ga0070689_100193426 | Ga0070689_1001934262 | 259 |
| 4 | 3300005356 | Ga0070674_100178265 | Ga0070674_1001782652 | 259 |
| 5 | 3300005366 | Ga0070659_100010620 | Ga0070659_1000106206 | 259 |
| 6 | 3300005459 | Ga0068867_100175390 | Ga0068867_1001753902 | 259 |
| 7 | 3300005617 | Ga0068859_100011952 | Ga0068859_1000119525 | 259 |
| 8 | 3300005841 | Ga0068863_100119815 | Ga0068863_1001198153 | 259 |
| 9 | 3300005843 | Ga0068860_100324772 | Ga0068860_1003247722 | 259 |
| 10 | 3300006358 | Ga0068871_100231483 | Ga0068871_1002314831 | 259 |
| 11 | 3300006931 | Ga0097620_100011952 | Ga0097620_1000119525 | 259 |
| 12 | 3300009177 | Ga0105248_10043033 | Ga0105248_100430332 | 259 |
| 13 | 3300010375 | Ga0105239_10162825 | Ga0105239_101628252 | 259 |
| 14 | 3300011119 | Ga0105246_10031264 | Ga0105246_100312642 | 259 |
| 15 | 3300013100 | Ga0157373_10059555 | Ga0157373_100595554 | 259 |
| 16 | 3300013104 | Ga0157370_10037008 | Ga0157370_100370084 | 259 |
| 17 | 3300013296 | Ga0157374_10157682 | Ga0157374_101576823 | 259 |
| 18 | 3300013297 | Ga0157378_10328019 | Ga0157378_103280191 | 259 |
| 19 | 3300013306 | Ga0163162_10108589 | Ga0163162_101085893 | 259 |
| 20 | 3300014969 | Ga0157376_10081515 | Ga0157376_100815152 | 259 |
| 21 | 3300025929 | Ga0207664_10011625 | Ga0207664_100116256 | 259 |
| 22 | 3300025938 | Ga0207704_10039758 | Ga0207704_100397583 | 259 |
| 23 | 3300025986 | Ga0207658_10340818 | Ga0207658_103408182 | 259 |
| 24 | 3300026035 | Ga0207703_10026726 | Ga0207703_100267263 | 259 |
| 25 | 3300026118 | Ga0207675_100221582 | Ga0207675_1002215823 | 259 |
| 26 | 3300026121 | Ga0207683_10114988 | Ga0207683_101149882 | 259 |
| 27 | 3300042876 | Ga0451577_0320839 | Ga0451577_0320839_348_1130 | 259 |
| 28 | 3300044712 | Ga0453684_0134829 | Ga0453684_0134829_1754_2536 | 259 |
| 29 | 3300045051 | Ga0451576_0001865 | Ga0451576_0001865_10823_11605 | 259 |
| 30 | 3300048907 | Ga0496104_0167203 | Ga0496104_0167203_119_901 | 259 |
| 31 | 3300048917 | Ga0496114_0001419 | Ga0496114_0001419_11526_12308 | 259 |
| 32 | 3300049568 | Ga0501031_0043406 | Ga0501031_0043406_1007_1789 | 259 |
| 33 | 3300049569 | Ga0501032_0004647 | Ga0501032_0004647_8149_8931 | 259 |
| 34 | 3300049569 | Ga0501032_0071485 | Ga0501032_0071485_1192_1974 | 259 |
| 35 | 3300049569 | Ga0501032_0179704 | Ga0501032_0179704_433_1215 | 259 |
| 36 | 3300049570 | Ga0501033_0003230 | Ga0501033_0003230_3354_4136 | 259 |
| 37 | 3300049570 | Ga0501033_0013653 | Ga0501033_0013653_1194_1976 | 259 |
| 38 | 3300049570 | Ga0501033_0021956 | Ga0501033_0021956_1633_2415 | 259 |
| 39 | 3300049571 | Ga0501034_0001644 | Ga0501034_0001644_16100_16882 | 259 |
| 40 | 3300049572 | Ga0501036_0120922 | Ga0501036_0120922_1195_1977 | 259 |
| 41 | 3300049572 | Ga0501036_0135648 | Ga0501036_0135648_848_1630 | 259 |
| 42 | 3300049573 | Ga0501037_0113152 | Ga0501037_0113152_890_1672 | 259 |
| 43 | 3300049574 | Ga0501038_0013089 | Ga0501038_0013089_5102_5884 | 259 |
| 44 | 3300049574 | Ga0501038_0035607 | Ga0501038_0035607_2997_3779 | 259 |
| 45 | 3300049574 | Ga0501038_0047008 | Ga0501038_0047008_2921_3703 | 259 |
| 46 | 3300049574 | Ga0501038_0073444 | Ga0501038_0073444_93_875 | 259 |
| 47 | 3300049574 | Ga0501038_0270595 | Ga0501038_0270595_289_1071 | 259 |
| 48 | 3300049575 | Ga0501039_0007336 | Ga0501039_0007336_6239_7021 | 259 |
| 49 | 3300049576 | Ga0501040_0003670 | Ga0501040_0003670_6356_7138 | 259 |
| 50 | 3300049578 | Ga0501042_0002512 | Ga0501042_0002512_4098_4880 | 259 |
| 51 | 3300049579 | Ga0501043_0018143 | Ga0501043_0018143_3571_4353 | 259 |
| 52 | 3300049579 | Ga0501043_0018397 | Ga0501043_0018397_4380_5162 | 259 |
| 53 | 3300049579 | Ga0501043_0030751 | Ga0501043_0030751_2295_3077 | 259 |
| 54 | 3300049579 | Ga0501043_0192792 | Ga0501043_0192792_10_792 | 259 |
| 55 | 3300049580 | Ga0501046_0005898 | Ga0501046_0005898_9755_10537 | 259 |
| 56 | 3300049580 | Ga0501046_0010092 | Ga0501046_0010092_1309_2091 | 259 |
| 57 | 3300049580 | Ga0501046_0342188 | Ga0501046_0342188_245_1027 | 259 |
| 58 | 3300049581 | Ga0501047_0003233 | Ga0501047_0003233_9800_10582 | 259 |
| 59 | 3300049582 | Ga0501048_0034431 | Ga0501048_0034431_2132_2914 | 259 |
| 60 | 3300049584 | Ga0501068_0227513 | Ga0501068_0227513_201_983 | 259 |
| 61 | 3300049593 | Ga0501077_0214979 | Ga0501077_0214979_327_1109 | 259 |
| 62 | 3300049822 | Ga0501035_0000258 | Ga0501035_0000258_46063_46845 | 259 |
| 63 | 3300049822 | Ga0501035_0007708 | Ga0501035_0007708_3183_3965 | 259 |
| 64 | 3300049822 | Ga0501035_0013795 | Ga0501035_0013795_5664_6446 | 259 |
| 65 | 3300049823 | Ga0501044_0000186 | Ga0501044_0000186_10419_11201 | 259 |
| 66 | 3300049823 | Ga0501044_0012433 | Ga0501044_0012433_1192_1974 | 259 |
| 67 | 3300049823 | Ga0501044_0022421 | Ga0501044_0022421_5046_5828 | 259 |
| 68 | 3300049823 | Ga0501044_0405614 | Ga0501044_0405614_16_798 | 259 |
| 69 | 3300049824 | Ga0501045_0001846 | Ga0501045_0001846_5493_6275 | 259 |
| 70 | 3300049824 | Ga0501045_0432075 | Ga0501045_0432075_41_823 | 259 |
| 71 | 3300031665 | Ga0316575_10016344 | Ga0316575_100163442 | 261 |
| 72 | 3300031691 | Ga0316579_10005342 | Ga0316579_100053428 | 261 |
| 73 | 3300031733 | Ga0316577_10029024 | Ga0316577_100290244 | 261 |
| 74 | 3300036647 | Ga0316582_0008765 | Ga0316582_0008765_1542_2345 | 261 |
| 75 | 3300037588 | Ga0316581_0009538 | Ga0316581_0009538_1445_2248 | 261 |
| 76 | 3300031250 | Ga0265331_10003198 | Ga0265331_100031981 | 262 |
| 77 | 3300031250 | Ga0265331_10004021 | Ga0265331_100040212 | 262 |
| 78 | 3300031251 | Ga0265327_10000923 | Ga0265327_1000092318 | 262 |
| 79 | 3300032002 | Ga0307416_100483386 | Ga0307416_1004833862 | 262 |
| 80 | 3300005338 | Ga0068868_100276415 | Ga0068868_1002764151 | 263 |
| 81 | 3300005338 | Ga0068868_100364783 | Ga0068868_1003647831 | 263 |
| 82 | 3300005340 | Ga0070689_100362975 | Ga0070689_1003629752 | 263 |
| 83 | 3300005345 | Ga0070692_10018051 | Ga0070692_100180514 | 263 |
| 84 | 3300005441 | Ga0070700_100000310 | Ga0070700_1000003102 | 263 |
| 85 | 3300005459 | Ga0068867_100131559 | Ga0068867_1001315592 | 263 |
| 86 | 3300005535 | Ga0070684_100354251 | Ga0070684_1003542512 | 263 |
| 87 | 3300005563 | Ga0068855_100062235 | Ga0068855_1000622352 | 263 |
| 88 | 3300005577 | Ga0068857_100002306 | Ga0068857_1000023061 | 263 |
| 89 | 3300005577 | Ga0068857_100033859 | Ga0068857_1000338594 | 263 |
| 90 | 3300005840 | Ga0068870_10132769 | Ga0068870_101327691 | 263 |
| 91 | 3300006847 | Ga0075431_100075096 | Ga0075431_1000750964 | 263 |
| 92 | 3300009098 | Ga0105245_10063751 | Ga0105245_100637511 | 263 |
| 93 | 3300009098 | Ga0105245_10190388 | Ga0105245_101903882 | 263 |
| 94 | 3300009174 | Ga0105241_10003882 | Ga0105241_100038822 | 263 |
| 95 | 3300009176 | Ga0105242_10205521 | Ga0105242_102055211 | 263 |
| 96 | 3300009545 | Ga0105237_10040502 | Ga0105237_100405025 | 263 |
| 97 | 3300009551 | Ga0105238_10058234 | Ga0105238_100582342 | 263 |
| 98 | 3300010375 | Ga0105239_10137593 | Ga0105239_101375932 | 263 |
| 99 | 3300013297 | Ga0157378_10073586 | Ga0157378_100735862 | 263 |
| 100 | 3300013306 | Ga0163162_10132530 | Ga0163162_101325302 | 263 |
| 101 | 3300013308 | Ga0157375_10072176 | Ga0157375_100721763 | 263 |
| 102 | 3300013308 | Ga0157375_10394851 | Ga0157375_103948512 | 263 |
| 103 | 3300025911 | Ga0207654_10008080 | Ga0207654_100080803 | 263 |
| 104 | 3300025912 | Ga0207707_10191179 | Ga0207707_101911791 | 263 |
| 105 | 3300025914 | Ga0207671_10043913 | Ga0207671_100439131 | 263 |
| 106 | 3300025917 | Ga0207660_10185247 | Ga0207660_101852471 | 263 |
| 107 | 3300025927 | Ga0207687_10103649 | Ga0207687_101036493 | 263 |
| 108 | 3300025949 | Ga0207667_10046123 | Ga0207667_100461235 | 263 |
| 109 | 3300026023 | Ga0207677_10157095 | Ga0207677_101570951 | 263 |
| 110 | 3300026035 | Ga0207703_10080687 | Ga0207703_100806874 | 263 |
| 111 | 3300026041 | Ga0207639_10002742 | Ga0207639_100027426 | 263 |
| 112 | 3300026041 | Ga0207639_10237204 | Ga0207639_102372042 | 263 |
| 113 | 3300026075 | Ga0207708_10015366 | Ga0207708_100153662 | 263 |
| 114 | 3300026089 | Ga0207648_10178437 | Ga0207648_101784372 | 263 |
| 115 | 3300028379 | Ga0268266_10259621 | Ga0268266_102596212 | 263 |
| 116 | 3300031733 | Ga0316577_10031123 | Ga0316577_100311231 | 263 |
| 117 | 3300036712 | Ga0316584_0061109 | Ga0316584_0061109_702_1499 | 263 |
| 118 | 3300036712 | Ga0316584_0359677 | Ga0316584_0359677_37_849 | 263 |
| 119 | 3300049571 | Ga0501034_0093195 | Ga0501034_0093195_1560_2372 | 263 |
| 120 | 3300049588 | Ga0501072_0010884 | Ga0501072_0010884_4537_5349 | 263 |
| 121 | 3300050512 | nmdc:mga0n895_259242_c1 | nmdc:mga0n895_259242_c1_468_1289 | 263 |
| 122 | 3300031548 | Ga0307408_100054851 | Ga0307408_1000548513 | 264 |
| 123 | 3300031665 | Ga0316575_10003815 | Ga0316575_100038155 | 264 |
| 124 | 3300031691 | Ga0316579_10016561 | Ga0316579_100165612 | 264 |
| 125 | 3300031728 | Ga0316578_10095292 | Ga0316578_100952922 | 264 |
| 126 | 3300031728 | Ga0316578_10127089 | Ga0316578_101270893 | 264 |
| 127 | 3300031733 | Ga0316577_10046411 | Ga0316577_100464112 | 264 |
| 128 | 3300031733 | Ga0316577_10158270 | Ga0316577_101582702 | 264 |
| 129 | 3300032002 | Ga0307416_100076065 | Ga0307416_1000760653 | 264 |
| 130 | 3300032137 | Ga0316585_10007298 | Ga0316585_100072982 | 264 |
| 131 | 3300032137 | Ga0316585_10091353 | Ga0316585_100913532 | 264 |
| 132 | 3300036647 | Ga0316582_0012213 | Ga0316582_0012213_2651_3451 | 264 |
| 133 | 3300036647 | Ga0316582_0036165 | Ga0316582_0036165_1924_2724 | 264 |
| 134 | 3300036647 | Ga0316582_0131686 | Ga0316582_0131686_844_1644 | 264 |
| 135 | 3300036712 | Ga0316584_0045081 | Ga0316584_0045081_1941_2741 | 264 |
| 136 | 3300036712 | Ga0316584_0096882 | Ga0316584_0096882_241_1041 | 264 |
| 137 | 3300036712 | Ga0316584_0104601 | Ga0316584_0104601_270_1091 | 264 |
| 138 | 3300037588 | Ga0316581_0061899 | Ga0316581_0061899_43_843 | 264 |
| 139 | 3300031250 | Ga0265331_10028752 | Ga0265331_100287523 | 265 |
| 140 | 3300005356 | Ga0070674_100040402 | Ga0070674_1000404025 | 266 |
| 141 | 3300005466 | Ga0070685_10094055 | Ga0070685_100940552 | 266 |
| 142 | 3300005543 | Ga0070672_100194687 | Ga0070672_1001946872 | 266 |
| 143 | 3300005577 | Ga0068857_100017243 | Ga0068857_1000172437 | 266 |
| 144 | 3300005617 | Ga0068859_100130947 | Ga0068859_1001309471 | 266 |
| 145 | 3300005842 | Ga0068858_100002547 | Ga0068858_1000025477 | 266 |
| 146 | 3300006931 | Ga0097620_100130940 | Ga0097620_1001309401 | 266 |
| 147 | 3300009174 | Ga0105241_10392937 | Ga0105241_103929372 | 266 |
| 148 | 3300009551 | Ga0105238_10039082 | Ga0105238_100390826 | 266 |
| 149 | 3300013104 | Ga0157370_10176890 | Ga0157370_101768903 | 266 |
| 150 | 3300013104 | Ga0157370_10216180 | Ga0157370_102161802 | 266 |
| 151 | 3300014745 | Ga0157377_10020441 | Ga0157377_100204413 | 266 |
| 152 | 3300025908 | Ga0207643_10187695 | Ga0207643_101876952 | 266 |
| 153 | 3300025921 | Ga0207652_10417711 | Ga0207652_104177111 | 266 |
| 154 | 3300025926 | Ga0207659_10083711 | Ga0207659_100837113 | 266 |
| 155 | 3300025934 | Ga0207686_10001736 | Ga0207686_100017368 | 266 |
| 156 | 3300025936 | Ga0207670_10176400 | Ga0207670_101764002 | 266 |
| 157 | 3300025942 | Ga0207689_10178949 | Ga0207689_101789492 | 266 |
| 158 | 3300025949 | Ga0207667_10047012 | Ga0207667_100470123 | 266 |
| 159 | 3300026035 | Ga0207703_10037967 | Ga0207703_100379673 | 266 |
| 160 | 3300026116 | Ga0207674_10012942 | Ga0207674_100129427 | 266 |
| 161 | 3300031548 | Ga0307408_100104334 | Ga0307408_1001043343 | 266 |
| 162 | 3300031824 | Ga0307413_10346860 | Ga0307413_103468601 | 266 |
| 163 | 3300032002 | Ga0307416_100069030 | Ga0307416_1000690303 | 266 |
| 164 | 3300032002 | Ga0307416_100214442 | Ga0307416_1002144422 | 266 |
| 165 | 3300045051 | Ga0451576_0783369 | Ga0451576_0783369_54_869 | 266 |
| 166 | 3300049581 | Ga0501047_0108479 | Ga0501047_0108479_1183_2022 | 266 |
| 167 | 3300049585 | Ga0501069_0002634 | Ga0501069_0002634_5711_6550 | 266 |
| 168 | 3300049586 | Ga0501070_0004327 | Ga0501070_0004327_1087_1926 | 266 |
| 169 | 3300049588 | Ga0501072_0452751 | Ga0501072_0452751_136_975 | 266 |
| 170 | 3300049589 | Ga0501073_0010377 | Ga0501073_0010377_3353_4192 | 266 |
| 171 | 3300049590 | Ga0501074_0016578 | Ga0501074_0016578_1189_2028 | 266 |
| 172 | 3300049741 | Ga0501079_0004017 | Ga0501079_0004017_4149_4988 | 266 |
| 173 | 3300049744 | Ga0501083_0001055 | Ga0501083_0001055_889_1728 | 266 |
| 174 | 3300050515 | nmdc:mga0a205_54011_c1 | nmdc:mga0a205_54011_c1_2761_3585 | 266 |
| 175 | 3300060353 | Ga0501082_0109680 | Ga0501082_0109680_782_1621 | 266 |
| 176 | 3300009148 | Ga0105243_10514794 | Ga0105243_105147942 | 267 |
| 177 | 3300049583 | Ga0501067_0084518 | Ga0501067_0084518_402_1226 | 267 |
| 178 | 3300049584 | Ga0501068_0000509 | Ga0501068_0000509_17512_18336 | 267 |
| 179 | 3300049589 | Ga0501073_0001888 | Ga0501073_0001888_6266_7090 | 267 |
| 180 | 3300049590 | Ga0501074_0029097 | Ga0501074_0029097_1552_2376 | 267 |
| 181 | 3300049742 | Ga0501080_0007029 | Ga0501080_0007029_1001_1825 | 267 |
| 182 | 3300031250 | Ga0265331_10001994 | Ga0265331_1000199412 | 268 |
| 183 | 3300031251 | Ga0265327_10009990 | Ga0265327_100099907 | 268 |
| 184 | 3300042876 | Ga0451577_0000501 | Ga0451577_0000501_13955_14764 | 268 |
| 185 | 3300042876 | Ga0451577_0003671 | Ga0451577_0003671_997_1806 | 268 |
| 186 | 3300044712 | Ga0453684_0004098 | Ga0453684_0004098_24437_25246 | 268 |
| 187 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_484430_485257 | 268 |
| 188 | 3300045051 | Ga0451576_0000801 | Ga0451576_0000801_49072_49896 | 268 |
| 189 | 3300045051 | Ga0451576_0002074 | Ga0451576_0002074_28648_29457 | 268 |
| 190 | 3300045051 | Ga0451576_0113295 | Ga0451576_0113295_1655_2464 | 268 |
| 191 | 3300014325 | Ga0163163_10249889 | Ga0163163_102498892 | 269 |
| 192 | 3300005327 | Ga0070658_10080869 | Ga0070658_100808692 | 270 |
| 193 | 3300005329 | Ga0070683_100280088 | Ga0070683_1002800882 | 270 |
| 194 | 3300005344 | Ga0070661_100059313 | Ga0070661_1000593133 | 270 |
| 195 | 3300005366 | Ga0070659_100130125 | Ga0070659_1001301252 | 270 |
| 196 | 3300005366 | Ga0070659_100501311 | Ga0070659_1005013111 | 270 |
| 197 | 3300005530 | Ga0070679_100063220 | Ga0070679_1000632202 | 270 |
| 198 | 3300005535 | Ga0070684_100060929 | Ga0070684_1000609293 | 270 |
| 199 | 3300005539 | Ga0068853_100025574 | Ga0068853_1000255743 | 270 |
| 200 | 3300005563 | Ga0068855_100050611 | Ga0068855_1000506113 | 270 |
| 201 | 3300005616 | Ga0068852_100001951 | Ga0068852_1000019518 | 270 |
| 202 | 3300005616 | Ga0068852_100022464 | Ga0068852_1000224643 | 270 |
| 203 | 3300005616 | Ga0068852_100024635 | Ga0068852_1000246354 | 270 |
| 204 | 3300005834 | Ga0068851_10007314 | Ga0068851_100073144 | 270 |
| 205 | 3300006237 | Ga0097621_100027251 | Ga0097621_1000272512 | 270 |
| 206 | 3300009093 | Ga0105240_10077880 | Ga0105240_100778803 | 270 |
| 207 | 3300013102 | Ga0157371_10112437 | Ga0157371_101124373 | 270 |
| 208 | 3300013105 | Ga0157369_10002101 | Ga0157369_100021017 | 270 |
| 209 | 3300013307 | Ga0157372_10017336 | Ga0157372_100173367 | 270 |
| 210 | 3300025321 | Ga0207656_10000551 | Ga0207656_1000055111 | 270 |
| 211 | 3300025909 | Ga0207705_10063791 | Ga0207705_100637912 | 270 |
| 212 | 3300025921 | Ga0207652_10025485 | Ga0207652_100254855 | 270 |
| 213 | 3300025932 | Ga0207690_10050044 | Ga0207690_100500443 | 270 |
| 214 | 3300025944 | Ga0207661_10222641 | Ga0207661_102226412 | 270 |
| 215 | 3300025949 | Ga0207667_10093484 | Ga0207667_100934843 | 270 |
| 216 | 3300025949 | Ga0207667_10870090 | Ga0207667_108700901 | 270 |
| 217 | 3300026023 | Ga0207677_10019685 | Ga0207677_100196854 | 270 |
| 218 | 3300026142 | Ga0207698_10001345 | Ga0207698_100013458 | 270 |
| 219 | 3300026142 | Ga0207698_10031596 | Ga0207698_100315963 | 270 |
| 220 | 3300026142 | Ga0207698_10037180 | Ga0207698_100371803 | 270 |
| 221 | 3300038443 | Ga0395901_0425982 | Ga0395901_0425982_34_891 | 270 |
| 222 | 3300044684 | Ga0466966_0121661 | Ga0466966_0121661_161_985 | 270 |
| 223 | 3300044842 | Ga0466957_0011844 | Ga0466957_0011844_2604_3428 | 270 |
| 224 | 3300045049 | Ga0466959_0029429 | Ga0466959_0029429_1620_2444 | 270 |
| 225 | 3300045836 | Ga0466958_0085119 | Ga0466958_0085119_476_1300 | 270 |
| 226 | 3300048908 | Ga0496105_0455405 | Ga0496105_0455405_139_987 | 270 |
| 227 | 3300048912 | Ga0496109_0724430 | Ga0496109_0724430_24_872 | 270 |
| 228 | 3300048913 | Ga0496110_0070669 | Ga0496110_0070669_1423_2271 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g61-assembly1.cif.gz_A | crystal structure of impase/nadp phosphatase complexed with mg2+ and phosphate | 0.8704 | 6 | 265 |
| 3lv0-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, native | 0.8672 | 10 | 269 |
| 6ib8-assembly1.cif.gz_B | structure of a complex of suhb and nusa ar2 domain | 0.867 | 7 | 270 |
| 3luz-assembly1.cif.gz_B | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.8632 | 7 | 266 |
| 2p3v-assembly1.cif.gz_A | thermotoga maritima impase tm1415 | 0.8557 | 9 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p3nA01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9142 | 13 | 147 | 3.30.540.10 |
| 3lv0B01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.879 | 10 | 147 | 3.30.540.10 |
| 2p3nA01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.8753 | 13 | 147 | 3.30.540.10 |
| 3lv0B01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.8604 | 10 | 147 | 3.30.540.10 |
| af_Q54U72_1_145_3.30.540.10 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.86 | 6 | 146 | 3.30.540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A248LDI2-F1-model_v4 | SuhB2 | 0.9497 | 6 | 268 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A2M7N7L1-F1-model_v4 | Inositol monophosphatase | 0.9433 | 8 | 93 |
GO:0046872
|
| AF-A0A2G6DJB5-F1-model_v4 | Inositol monophosphatase | 0.941 | 7 | 268 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A2T6NSI5-F1-model_v4 | Inositol monophosphatase | 0.9373 | 7 | 268 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A3M2FHR4-F1-model_v4 | Inositol monophosphatase family protein | 0.9314 | 9 | 269 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar