F340981

General Info

Members Datasets Scaffolds Average Seq Length
228 138 228 269

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10017336|Ga0157372_100173367
Length 305
Sequence MRGEGMGDAWFAFDASIIEGAARRRRTIMNDSTDITVPFAHAVIEAVRRVAADEIMPRYRSVVATRKDDGSLLTEADLASQRALVRALGAIEPVPVMGEEMAPEKQVRIFESAPRFWCVDPIDGTANFAAGIPYFAVSVALMENARPLFGTVYDPVADTAYYAVRGGGAWKDHRPLELAPEAPPLARAHAEVSLRRDTRALRGAIKNHRPYGKRRTSGSSTLSWCDLAQGRIDAMLHSGQKMWDYAAGSLILCEARGALCTIETDDFWSAPAWNRSVIAARSEKLLVEWRQWIRGHLASREPDSP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.63
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10080869 3300005327 Bacteria 2669
2 Ga0070683_100280088 3300005329 Bacteria 1586
3 Ga0070680_100567345 3300005336 Bacteria 973
4 Ga0068868_100276415 3300005338 Bacteria 1420
5 Ga0068868_100364783 3300005338 Bacteria 1240
6 Ga0070689_100193426 3300005340 Bacteria 1657
7 Ga0070689_100362975 3300005340 Bacteria 1217
8 Ga0070661_100059313 3300005344 Bacteria 2806
9 Ga0070692_10018051 3300005345 Bacteria 3385
10 Ga0070674_100040402 3300005356 Bacteria 3156
11 Ga0070674_100178265 3300005356 Bacteria 1625
12 Ga0070659_100010620 3300005366 Bacteria 6781
13 Ga0070659_100130125 3300005366 Bacteria 2043
14 Ga0070659_100501311 3300005366 Bacteria 1035
15 Ga0070700_100000310 3300005441 Bacteria 25261
16 Ga0068867_100131559 3300005459 Bacteria 1945
17 Ga0068867_100175390 3300005459 Bacteria 1701
18 Ga0070685_10094055 3300005466 Bacteria 1819
19 Ga0070679_100063220 3300005530 Bacteria 3690
20 Ga0070684_100060929 3300005535 Bacteria 3302
21 Ga0070684_100354251 3300005535 Bacteria 1350
22 Ga0068853_100025574 3300005539 Bacteria 4955
23 Ga0070672_100194687 3300005543 Bacteria 1694
24 Ga0068855_100050611 3300005563 Bacteria 4895
25 Ga0068855_100062235 3300005563 Bacteria 4357
26 Ga0068857_100002306 3300005577 Bacteria 15509
27 Ga0068857_100017243 3300005577 Bacteria 6327
28 Ga0068857_100033859 3300005577 Bacteria 4519
29 Ga0068852_100001951 3300005616 Bacteria 14045
30 Ga0068852_100022464 3300005616 Bacteria 5059
31 Ga0068852_100024635 3300005616 Bacteria 4867
32 Ga0068859_100011952 3300005617 Bacteria 8720
33 Ga0068859_100130947 3300005617 Bacteria 2580
34 Ga0068851_10007314 3300005834 Bacteria 5064
35 Ga0068870_10132769 3300005840 Bacteria 1448
36 Ga0068863_100119815 3300005841 Bacteria 2508
37 Ga0068858_100002547 3300005842 Bacteria 18383
38 Ga0068860_100324772 3300005843 Bacteria 1511
39 Ga0097621_100027251 3300006237 Bacteria 4491
40 Ga0068871_100231483 3300006358 Bacteria 1604
41 Ga0075431_100075096 3300006847 Bacteria 3488
42 Ga0097620_100011952 3300006931 Bacteria 8720
43 Ga0097620_100130940 3300006931 Bacteria 2580
44 Ga0105240_10077880 3300009093 Bacteria 4084
45 Ga0105245_10063751 3300009098 Bacteria 3329
46 Ga0105245_10190388 3300009098 Bacteria 1965
47 Ga0105243_10514794 3300009148 Bacteria 1137
48 Ga0105241_10003882 3300009174 Bacteria 11084
49 Ga0105241_10392937 3300009174 Bacteria 1215
50 Ga0105242_10205521 3300009176 Bacteria 1751
51 Ga0105248_10043033 3300009177 Bacteria 5064
52 Ga0105237_10040502 3300009545 Bacteria 4698
53 Ga0105238_10039082 3300009551 Bacteria 4814
54 Ga0105238_10058234 3300009551 Bacteria 3873
55 Ga0105239_10137593 3300010375 Bacteria 2719
56 Ga0105239_10162825 3300010375 Bacteria 2493
57 Ga0105246_10031264 3300011119 Bacteria 3522
58 Ga0157373_10059555 3300013100 Bacteria 2706
59 Ga0157371_10112437 3300013102 Bacteria 1933
60 Ga0157370_10037008 3300013104 Bacteria 4734
61 Ga0157370_10176890 3300013104 Bacteria 1983
62 Ga0157370_10216180 3300013104 Bacteria 1776
63 Ga0157369_10002101 3300013105 Bacteria 24017
64 Ga0157374_10157682 3300013296 Bacteria 2210
65 Ga0157378_10073586 3300013297 Bacteria 3072
66 Ga0157378_10328019 3300013297 Bacteria 1489
67 Ga0163162_10108589 3300013306 Bacteria 2871
68 Ga0163162_10132530 3300013306 Bacteria 2601
69 Ga0157372_10017336 3300013307 Bacteria 7731
70 Ga0157375_10072176 3300013308 Bacteria 3468
71 Ga0157375_10394851 3300013308 Bacteria 1550
72 Ga0163163_10249889 3300014325 Bacteria 1824
73 Ga0157377_10020441 3300014745 Bacteria 3469
74 Ga0157376_10081515 3300014969 Bacteria 2778
75 Ga0207656_10000551 3300025321 Bacteria 12395
76 Ga0207643_10187695 3300025908 Bacteria 1254
77 Ga0207705_10063791 3300025909 Bacteria 2662
78 Ga0207654_10008080 3300025911 Bacteria 5304
79 Ga0207707_10191179 3300025912 Bacteria 1786
80 Ga0207671_10043913 3300025914 Bacteria 3304
81 Ga0207660_10185247 3300025917 Bacteria 1619
82 Ga0207652_10025485 3300025921 Bacteria 4918
83 Ga0207652_10417711 3300025921 Bacteria 1210
84 Ga0207659_10083711 3300025926 Bacteria 2365
85 Ga0207687_10103649 3300025927 Bacteria 2098
86 Ga0207664_10011625 3300025929 Bacteria 6269
87 Ga0207690_10050044 3300025932 Bacteria 2788
88 Ga0207686_10001736 3300025934 Bacteria 12122
89 Ga0207670_10176400 3300025936 Bacteria 1606
90 Ga0207704_10039758 3300025938 Bacteria 2743
91 Ga0207689_10178949 3300025942 Bacteria 1749
92 Ga0207661_10222641 3300025944 Bacteria 1668
93 Ga0207667_10046123 3300025949 Bacteria 4615
94 Ga0207667_10047012 3300025949 Bacteria 4569
95 Ga0207667_10093484 3300025949 Bacteria 3105
96 Ga0207667_10870090 3300025949 Bacteria 894
97 Ga0207658_10340818 3300025986 Unclassified 1303
98 Ga0207677_10019685 3300026023 Bacteria 4082
99 Ga0207677_10157095 3300026023 Bacteria 1762
100 Ga0207703_10026726 3300026035 Bacteria 4545
101 Ga0207703_10037967 3300026035 Bacteria 3840
102 Ga0207703_10080687 3300026035 Bacteria 2710
103 Ga0207639_10002742 3300026041 Bacteria 11819
104 Ga0207639_10237204 3300026041 Bacteria 1584
105 Ga0207708_10015366 3300026075 Bacteria 5742
106 Ga0207648_10178437 3300026089 Bacteria 1879
107 Ga0207674_10012942 3300026116 Bacteria 9304
108 Ga0207675_100221582 3300026118 Bacteria 1823
109 Ga0207683_10114988 3300026121 Bacteria 2412
110 Ga0207698_10001345 3300026142 Bacteria 14324
111 Ga0207698_10031596 3300026142 Bacteria 3824
112 Ga0207698_10037180 3300026142 Bacteria 3583
113 Ga0268266_10259621 3300028379 Bacteria 1610
114 Ga0265331_10001994 3300031250 Bacteria 14251
115 Ga0265331_10003198 3300031250 Bacteria 10693
116 Ga0265331_10004021 3300031250 Bacteria 9279
117 Ga0265331_10028752 3300031250 Bacteria 2778
118 Ga0265327_10000923 3300031251 Bacteria 43037
119 Ga0265327_10009990 3300031251 Bacteria 6754
120 Ga0307408_100054851 3300031548 Bacteria 2883
121 Ga0307408_100104334 3300031548 Bacteria 2166
122 Ga0316575_10003815 3300031665 Bacteria 5251
123 Ga0316575_10016344 3300031665 Bacteria 2807
124 Ga0316579_10005342 3300031691 Bacteria 5176
125 Ga0316579_10016561 3300031691 Bacteria 3222
126 Ga0316578_10095292 3300031728 Bacteria 1781
127 Ga0316578_10127089 3300031728 Bacteria 1533
128 Ga0316577_10029024 3300031733 Bacteria 3088
129 Ga0316577_10031123 3300031733 Bacteria 2981
130 Ga0316577_10046411 3300031733 Bacteria 2426
131 Ga0316577_10158270 3300031733 Bacteria 1277
132 Ga0307413_10346860 3300031824 Bacteria 1144
133 Ga0307416_100069030 3300032002 Bacteria 2923
134 Ga0307416_100076065 3300032002 Bacteria 2812
135 Ga0307416_100214442 3300032002 Bacteria 1840
136 Ga0307416_100483386 3300032002 Bacteria 1299
137 Ga0316585_10007298 3300032137 Bacteria 3183
138 Ga0316585_10091353 3300032137 Unclassified 995
139 Ga0316582_0008765 3300036647 Bacteria 5451
140 Ga0316582_0012213 3300036647 Bacteria 4783
141 Ga0316582_0036165 3300036647 Bacteria 3054
142 Ga0316582_0131686 3300036647 Bacteria 1680
143 Ga0316584_0045081 3300036712 Bacteria 3290
144 Ga0316584_0061109 3300036712 Bacteria 2822
145 Ga0316584_0096882 3300036712 Bacteria 2208
146 Ga0316584_0104601 3300036712 Bacteria 2119
147 Ga0316584_0359677 3300036712 Bacteria 1044
148 Ga0316581_0009538 3300037588 Bacteria 2671
149 Ga0316581_0061899 3300037588 Bacteria 1148
150 Ga0395901_0425982 3300038443 Bacteria 1360
151 Ga0451577_0000501 3300042876 Bacteria 65919
152 Ga0451577_0003671 3300042876 Bacteria 16814
153 Ga0451577_0320839 3300042876 Bacteria 1405
154 Ga0466966_0121661 3300044684 Bacteria 1603
155 Ga0453684_0004098 3300044712 Bacteria 31613
156 Ga0453684_0134829 3300044712 Bacteria 2958
157 Ga0466957_0011844 3300044842 Bacteria 5041
158 Ga0466959_0029429 3300045049 Bacteria 4069
159 Ga0451576_0000006 3300045051 Bacteria 949698
160 Ga0451576_0000801 3300045051 Bacteria 61543
161 Ga0451576_0001865 3300045051 Bacteria 34037
162 Ga0451576_0002074 3300045051 Bacteria 31365
163 Ga0451576_0113295 3300045051 Bacteria 2823
164 Ga0451576_0783369 3300045051 Bacteria 1001
165 Ga0466958_0085119 3300045836 Bacteria 1950
166 Ga0496104_0167203 3300048907 Bacteria 2109
167 Ga0496105_0455405 3300048908 Unclassified 1009
168 Ga0496108_0075229 3300048911 Bacteria 2853
169 Ga0496109_0724430 3300048912 Bacteria 932
170 Ga0496110_0070669 3300048913 Bacteria 3094
171 Ga0496114_0001419 3300048917 Bacteria 18174
172 Ga0501031_0043406 3300049568 Bacteria 2934
173 Ga0501032_0004647 3300049569 Bacteria 10317
174 Ga0501032_0071485 3300049569 Bacteria 2312
175 Ga0501032_0179704 3300049569 Bacteria 1385
176 Ga0501033_0003230 3300049570 Bacteria 13484
177 Ga0501033_0013653 3300049570 Bacteria 6182
178 Ga0501033_0021956 3300049570 Bacteria 4814
179 Ga0501034_0001644 3300049571 Bacteria 28871
180 Ga0501034_0093195 3300049571 Bacteria 3008
181 Ga0501036_0120922 3300049572 Unclassified 2211
182 Ga0501036_0135648 3300049572 Bacteria 2077
183 Ga0501037_0113152 3300049573 Bacteria 1954
184 Ga0501038_0013089 3300049574 Bacteria 7568
185 Ga0501038_0035607 3300049574 Bacteria 4369
186 Ga0501038_0047008 3300049574 Bacteria 3740
187 Ga0501038_0073444 3300049574 Bacteria 2896
188 Ga0501038_0270595 3300049574 Bacteria 1340
189 Ga0501039_0007336 3300049575 Bacteria 8401
190 Ga0501040_0003670 3300049576 Bacteria 9940
191 Ga0501042_0002512 3300049578 Bacteria 11297
192 Ga0501043_0018143 3300049579 Bacteria 5516
193 Ga0501043_0018397 3300049579 Bacteria 5479
194 Ga0501043_0030751 3300049579 Bacteria 4222
195 Ga0501043_0192792 3300049579 Unclassified 1584
196 Ga0501046_0005898 3300049580 Bacteria 10921
197 Ga0501046_0010092 3300049580 Bacteria 8128
198 Ga0501046_0342188 3300049580 Unclassified 1087
199 Ga0501047_0003233 3300049581 Bacteria 15446
200 Ga0501047_0108479 3300049581 Bacteria 2658
201 Ga0501048_0034431 3300049582 Bacteria 3653
202 Ga0501067_0084518 3300049583 Bacteria 1760
203 Ga0501068_0000509 3300049584 Bacteria 19755
204 Ga0501068_0227513 3300049584 Bacteria 1186
205 Ga0501069_0002634 3300049585 Bacteria 9157
206 Ga0501070_0004327 3300049586 Bacteria 12206
207 Ga0501072_0010884 3300049588 Bacteria 6938
208 Ga0501072_0452751 3300049588 Unclassified 1016
209 Ga0501073_0001888 3300049589 Bacteria 15612
210 Ga0501073_0010377 3300049589 Bacteria 6831
211 Ga0501074_0016578 3300049590 Bacteria 5348
212 Ga0501074_0029097 3300049590 Bacteria 4002
213 Ga0501077_0214979 3300049593 Bacteria 1222
214 Ga0501079_0004017 3300049741 Bacteria 10885
215 Ga0501080_0007029 3300049742 Bacteria 10162
216 Ga0501083_0001055 3300049744 Bacteria 18371
217 Ga0501035_0000258 3300049822 Bacteria 63033
218 Ga0501035_0007708 3300049822 Bacteria 10054
219 Ga0501035_0013795 3300049822 Bacteria 7459
220 Ga0501044_0000186 3300049823 Bacteria 77642
221 Ga0501044_0012433 3300049823 Bacteria 9217
222 Ga0501044_0022421 3300049823 Bacteria 6729
223 Ga0501044_0405614 3300049823 Bacteria 1275
224 Ga0501045_0001846 3300049824 Bacteria 14316
225 Ga0501045_0432075 3300049824 Bacteria 979
226 nmdc:mga0n895_259242_c1 3300050512 Bacteria 1764
227 nmdc:mga0a205_54011_c1 3300050515 Bacteria 3878
228 Ga0501082_0109680 3300060353 Bacteria 2389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0075229 Ga0496108_0075229_754_1500 247
2 3300005336 Ga0070680_100567345 Ga0070680_1005673451 259
3 3300005340 Ga0070689_100193426 Ga0070689_1001934262 259
4 3300005356 Ga0070674_100178265 Ga0070674_1001782652 259
5 3300005366 Ga0070659_100010620 Ga0070659_1000106206 259
6 3300005459 Ga0068867_100175390 Ga0068867_1001753902 259
7 3300005617 Ga0068859_100011952 Ga0068859_1000119525 259
8 3300005841 Ga0068863_100119815 Ga0068863_1001198153 259
9 3300005843 Ga0068860_100324772 Ga0068860_1003247722 259
10 3300006358 Ga0068871_100231483 Ga0068871_1002314831 259
11 3300006931 Ga0097620_100011952 Ga0097620_1000119525 259
12 3300009177 Ga0105248_10043033 Ga0105248_100430332 259
13 3300010375 Ga0105239_10162825 Ga0105239_101628252 259
14 3300011119 Ga0105246_10031264 Ga0105246_100312642 259
15 3300013100 Ga0157373_10059555 Ga0157373_100595554 259
16 3300013104 Ga0157370_10037008 Ga0157370_100370084 259
17 3300013296 Ga0157374_10157682 Ga0157374_101576823 259
18 3300013297 Ga0157378_10328019 Ga0157378_103280191 259
19 3300013306 Ga0163162_10108589 Ga0163162_101085893 259
20 3300014969 Ga0157376_10081515 Ga0157376_100815152 259
21 3300025929 Ga0207664_10011625 Ga0207664_100116256 259
22 3300025938 Ga0207704_10039758 Ga0207704_100397583 259
23 3300025986 Ga0207658_10340818 Ga0207658_103408182 259
24 3300026035 Ga0207703_10026726 Ga0207703_100267263 259
25 3300026118 Ga0207675_100221582 Ga0207675_1002215823 259
26 3300026121 Ga0207683_10114988 Ga0207683_101149882 259
27 3300042876 Ga0451577_0320839 Ga0451577_0320839_348_1130 259
28 3300044712 Ga0453684_0134829 Ga0453684_0134829_1754_2536 259
29 3300045051 Ga0451576_0001865 Ga0451576_0001865_10823_11605 259
30 3300048907 Ga0496104_0167203 Ga0496104_0167203_119_901 259
31 3300048917 Ga0496114_0001419 Ga0496114_0001419_11526_12308 259
32 3300049568 Ga0501031_0043406 Ga0501031_0043406_1007_1789 259
33 3300049569 Ga0501032_0004647 Ga0501032_0004647_8149_8931 259
34 3300049569 Ga0501032_0071485 Ga0501032_0071485_1192_1974 259
35 3300049569 Ga0501032_0179704 Ga0501032_0179704_433_1215 259
36 3300049570 Ga0501033_0003230 Ga0501033_0003230_3354_4136 259
37 3300049570 Ga0501033_0013653 Ga0501033_0013653_1194_1976 259
38 3300049570 Ga0501033_0021956 Ga0501033_0021956_1633_2415 259
39 3300049571 Ga0501034_0001644 Ga0501034_0001644_16100_16882 259
40 3300049572 Ga0501036_0120922 Ga0501036_0120922_1195_1977 259
41 3300049572 Ga0501036_0135648 Ga0501036_0135648_848_1630 259
42 3300049573 Ga0501037_0113152 Ga0501037_0113152_890_1672 259
43 3300049574 Ga0501038_0013089 Ga0501038_0013089_5102_5884 259
44 3300049574 Ga0501038_0035607 Ga0501038_0035607_2997_3779 259
45 3300049574 Ga0501038_0047008 Ga0501038_0047008_2921_3703 259
46 3300049574 Ga0501038_0073444 Ga0501038_0073444_93_875 259
47 3300049574 Ga0501038_0270595 Ga0501038_0270595_289_1071 259
48 3300049575 Ga0501039_0007336 Ga0501039_0007336_6239_7021 259
49 3300049576 Ga0501040_0003670 Ga0501040_0003670_6356_7138 259
50 3300049578 Ga0501042_0002512 Ga0501042_0002512_4098_4880 259
51 3300049579 Ga0501043_0018143 Ga0501043_0018143_3571_4353 259
52 3300049579 Ga0501043_0018397 Ga0501043_0018397_4380_5162 259
53 3300049579 Ga0501043_0030751 Ga0501043_0030751_2295_3077 259
54 3300049579 Ga0501043_0192792 Ga0501043_0192792_10_792 259
55 3300049580 Ga0501046_0005898 Ga0501046_0005898_9755_10537 259
56 3300049580 Ga0501046_0010092 Ga0501046_0010092_1309_2091 259
57 3300049580 Ga0501046_0342188 Ga0501046_0342188_245_1027 259
58 3300049581 Ga0501047_0003233 Ga0501047_0003233_9800_10582 259
59 3300049582 Ga0501048_0034431 Ga0501048_0034431_2132_2914 259
60 3300049584 Ga0501068_0227513 Ga0501068_0227513_201_983 259
61 3300049593 Ga0501077_0214979 Ga0501077_0214979_327_1109 259
62 3300049822 Ga0501035_0000258 Ga0501035_0000258_46063_46845 259
63 3300049822 Ga0501035_0007708 Ga0501035_0007708_3183_3965 259
64 3300049822 Ga0501035_0013795 Ga0501035_0013795_5664_6446 259
65 3300049823 Ga0501044_0000186 Ga0501044_0000186_10419_11201 259
66 3300049823 Ga0501044_0012433 Ga0501044_0012433_1192_1974 259
67 3300049823 Ga0501044_0022421 Ga0501044_0022421_5046_5828 259
68 3300049823 Ga0501044_0405614 Ga0501044_0405614_16_798 259
69 3300049824 Ga0501045_0001846 Ga0501045_0001846_5493_6275 259
70 3300049824 Ga0501045_0432075 Ga0501045_0432075_41_823 259
71 3300031665 Ga0316575_10016344 Ga0316575_100163442 261
72 3300031691 Ga0316579_10005342 Ga0316579_100053428 261
73 3300031733 Ga0316577_10029024 Ga0316577_100290244 261
74 3300036647 Ga0316582_0008765 Ga0316582_0008765_1542_2345 261
75 3300037588 Ga0316581_0009538 Ga0316581_0009538_1445_2248 261
76 3300031250 Ga0265331_10003198 Ga0265331_100031981 262
77 3300031250 Ga0265331_10004021 Ga0265331_100040212 262
78 3300031251 Ga0265327_10000923 Ga0265327_1000092318 262
79 3300032002 Ga0307416_100483386 Ga0307416_1004833862 262
80 3300005338 Ga0068868_100276415 Ga0068868_1002764151 263
81 3300005338 Ga0068868_100364783 Ga0068868_1003647831 263
82 3300005340 Ga0070689_100362975 Ga0070689_1003629752 263
83 3300005345 Ga0070692_10018051 Ga0070692_100180514 263
84 3300005441 Ga0070700_100000310 Ga0070700_1000003102 263
85 3300005459 Ga0068867_100131559 Ga0068867_1001315592 263
86 3300005535 Ga0070684_100354251 Ga0070684_1003542512 263
87 3300005563 Ga0068855_100062235 Ga0068855_1000622352 263
88 3300005577 Ga0068857_100002306 Ga0068857_1000023061 263
89 3300005577 Ga0068857_100033859 Ga0068857_1000338594 263
90 3300005840 Ga0068870_10132769 Ga0068870_101327691 263
91 3300006847 Ga0075431_100075096 Ga0075431_1000750964 263
92 3300009098 Ga0105245_10063751 Ga0105245_100637511 263
93 3300009098 Ga0105245_10190388 Ga0105245_101903882 263
94 3300009174 Ga0105241_10003882 Ga0105241_100038822 263
95 3300009176 Ga0105242_10205521 Ga0105242_102055211 263
96 3300009545 Ga0105237_10040502 Ga0105237_100405025 263
97 3300009551 Ga0105238_10058234 Ga0105238_100582342 263
98 3300010375 Ga0105239_10137593 Ga0105239_101375932 263
99 3300013297 Ga0157378_10073586 Ga0157378_100735862 263
100 3300013306 Ga0163162_10132530 Ga0163162_101325302 263
101 3300013308 Ga0157375_10072176 Ga0157375_100721763 263
102 3300013308 Ga0157375_10394851 Ga0157375_103948512 263
103 3300025911 Ga0207654_10008080 Ga0207654_100080803 263
104 3300025912 Ga0207707_10191179 Ga0207707_101911791 263
105 3300025914 Ga0207671_10043913 Ga0207671_100439131 263
106 3300025917 Ga0207660_10185247 Ga0207660_101852471 263
107 3300025927 Ga0207687_10103649 Ga0207687_101036493 263
108 3300025949 Ga0207667_10046123 Ga0207667_100461235 263
109 3300026023 Ga0207677_10157095 Ga0207677_101570951 263
110 3300026035 Ga0207703_10080687 Ga0207703_100806874 263
111 3300026041 Ga0207639_10002742 Ga0207639_100027426 263
112 3300026041 Ga0207639_10237204 Ga0207639_102372042 263
113 3300026075 Ga0207708_10015366 Ga0207708_100153662 263
114 3300026089 Ga0207648_10178437 Ga0207648_101784372 263
115 3300028379 Ga0268266_10259621 Ga0268266_102596212 263
116 3300031733 Ga0316577_10031123 Ga0316577_100311231 263
117 3300036712 Ga0316584_0061109 Ga0316584_0061109_702_1499 263
118 3300036712 Ga0316584_0359677 Ga0316584_0359677_37_849 263
119 3300049571 Ga0501034_0093195 Ga0501034_0093195_1560_2372 263
120 3300049588 Ga0501072_0010884 Ga0501072_0010884_4537_5349 263
121 3300050512 nmdc:mga0n895_259242_c1 nmdc:mga0n895_259242_c1_468_1289 263
122 3300031548 Ga0307408_100054851 Ga0307408_1000548513 264
123 3300031665 Ga0316575_10003815 Ga0316575_100038155 264
124 3300031691 Ga0316579_10016561 Ga0316579_100165612 264
125 3300031728 Ga0316578_10095292 Ga0316578_100952922 264
126 3300031728 Ga0316578_10127089 Ga0316578_101270893 264
127 3300031733 Ga0316577_10046411 Ga0316577_100464112 264
128 3300031733 Ga0316577_10158270 Ga0316577_101582702 264
129 3300032002 Ga0307416_100076065 Ga0307416_1000760653 264
130 3300032137 Ga0316585_10007298 Ga0316585_100072982 264
131 3300032137 Ga0316585_10091353 Ga0316585_100913532 264
132 3300036647 Ga0316582_0012213 Ga0316582_0012213_2651_3451 264
133 3300036647 Ga0316582_0036165 Ga0316582_0036165_1924_2724 264
134 3300036647 Ga0316582_0131686 Ga0316582_0131686_844_1644 264
135 3300036712 Ga0316584_0045081 Ga0316584_0045081_1941_2741 264
136 3300036712 Ga0316584_0096882 Ga0316584_0096882_241_1041 264
137 3300036712 Ga0316584_0104601 Ga0316584_0104601_270_1091 264
138 3300037588 Ga0316581_0061899 Ga0316581_0061899_43_843 264
139 3300031250 Ga0265331_10028752 Ga0265331_100287523 265
140 3300005356 Ga0070674_100040402 Ga0070674_1000404025 266
141 3300005466 Ga0070685_10094055 Ga0070685_100940552 266
142 3300005543 Ga0070672_100194687 Ga0070672_1001946872 266
143 3300005577 Ga0068857_100017243 Ga0068857_1000172437 266
144 3300005617 Ga0068859_100130947 Ga0068859_1001309471 266
145 3300005842 Ga0068858_100002547 Ga0068858_1000025477 266
146 3300006931 Ga0097620_100130940 Ga0097620_1001309401 266
147 3300009174 Ga0105241_10392937 Ga0105241_103929372 266
148 3300009551 Ga0105238_10039082 Ga0105238_100390826 266
149 3300013104 Ga0157370_10176890 Ga0157370_101768903 266
150 3300013104 Ga0157370_10216180 Ga0157370_102161802 266
151 3300014745 Ga0157377_10020441 Ga0157377_100204413 266
152 3300025908 Ga0207643_10187695 Ga0207643_101876952 266
153 3300025921 Ga0207652_10417711 Ga0207652_104177111 266
154 3300025926 Ga0207659_10083711 Ga0207659_100837113 266
155 3300025934 Ga0207686_10001736 Ga0207686_100017368 266
156 3300025936 Ga0207670_10176400 Ga0207670_101764002 266
157 3300025942 Ga0207689_10178949 Ga0207689_101789492 266
158 3300025949 Ga0207667_10047012 Ga0207667_100470123 266
159 3300026035 Ga0207703_10037967 Ga0207703_100379673 266
160 3300026116 Ga0207674_10012942 Ga0207674_100129427 266
161 3300031548 Ga0307408_100104334 Ga0307408_1001043343 266
162 3300031824 Ga0307413_10346860 Ga0307413_103468601 266
163 3300032002 Ga0307416_100069030 Ga0307416_1000690303 266
164 3300032002 Ga0307416_100214442 Ga0307416_1002144422 266
165 3300045051 Ga0451576_0783369 Ga0451576_0783369_54_869 266
166 3300049581 Ga0501047_0108479 Ga0501047_0108479_1183_2022 266
167 3300049585 Ga0501069_0002634 Ga0501069_0002634_5711_6550 266
168 3300049586 Ga0501070_0004327 Ga0501070_0004327_1087_1926 266
169 3300049588 Ga0501072_0452751 Ga0501072_0452751_136_975 266
170 3300049589 Ga0501073_0010377 Ga0501073_0010377_3353_4192 266
171 3300049590 Ga0501074_0016578 Ga0501074_0016578_1189_2028 266
172 3300049741 Ga0501079_0004017 Ga0501079_0004017_4149_4988 266
173 3300049744 Ga0501083_0001055 Ga0501083_0001055_889_1728 266
174 3300050515 nmdc:mga0a205_54011_c1 nmdc:mga0a205_54011_c1_2761_3585 266
175 3300060353 Ga0501082_0109680 Ga0501082_0109680_782_1621 266
176 3300009148 Ga0105243_10514794 Ga0105243_105147942 267
177 3300049583 Ga0501067_0084518 Ga0501067_0084518_402_1226 267
178 3300049584 Ga0501068_0000509 Ga0501068_0000509_17512_18336 267
179 3300049589 Ga0501073_0001888 Ga0501073_0001888_6266_7090 267
180 3300049590 Ga0501074_0029097 Ga0501074_0029097_1552_2376 267
181 3300049742 Ga0501080_0007029 Ga0501080_0007029_1001_1825 267
182 3300031250 Ga0265331_10001994 Ga0265331_1000199412 268
183 3300031251 Ga0265327_10009990 Ga0265327_100099907 268
184 3300042876 Ga0451577_0000501 Ga0451577_0000501_13955_14764 268
185 3300042876 Ga0451577_0003671 Ga0451577_0003671_997_1806 268
186 3300044712 Ga0453684_0004098 Ga0453684_0004098_24437_25246 268
187 3300045051 Ga0451576_0000006 Ga0451576_0000006_484430_485257 268
188 3300045051 Ga0451576_0000801 Ga0451576_0000801_49072_49896 268
189 3300045051 Ga0451576_0002074 Ga0451576_0002074_28648_29457 268
190 3300045051 Ga0451576_0113295 Ga0451576_0113295_1655_2464 268
191 3300014325 Ga0163163_10249889 Ga0163163_102498892 269
192 3300005327 Ga0070658_10080869 Ga0070658_100808692 270
193 3300005329 Ga0070683_100280088 Ga0070683_1002800882 270
194 3300005344 Ga0070661_100059313 Ga0070661_1000593133 270
195 3300005366 Ga0070659_100130125 Ga0070659_1001301252 270
196 3300005366 Ga0070659_100501311 Ga0070659_1005013111 270
197 3300005530 Ga0070679_100063220 Ga0070679_1000632202 270
198 3300005535 Ga0070684_100060929 Ga0070684_1000609293 270
199 3300005539 Ga0068853_100025574 Ga0068853_1000255743 270
200 3300005563 Ga0068855_100050611 Ga0068855_1000506113 270
201 3300005616 Ga0068852_100001951 Ga0068852_1000019518 270
202 3300005616 Ga0068852_100022464 Ga0068852_1000224643 270
203 3300005616 Ga0068852_100024635 Ga0068852_1000246354 270
204 3300005834 Ga0068851_10007314 Ga0068851_100073144 270
205 3300006237 Ga0097621_100027251 Ga0097621_1000272512 270
206 3300009093 Ga0105240_10077880 Ga0105240_100778803 270
207 3300013102 Ga0157371_10112437 Ga0157371_101124373 270
208 3300013105 Ga0157369_10002101 Ga0157369_100021017 270
209 3300013307 Ga0157372_10017336 Ga0157372_100173367 270
210 3300025321 Ga0207656_10000551 Ga0207656_1000055111 270
211 3300025909 Ga0207705_10063791 Ga0207705_100637912 270
212 3300025921 Ga0207652_10025485 Ga0207652_100254855 270
213 3300025932 Ga0207690_10050044 Ga0207690_100500443 270
214 3300025944 Ga0207661_10222641 Ga0207661_102226412 270
215 3300025949 Ga0207667_10093484 Ga0207667_100934843 270
216 3300025949 Ga0207667_10870090 Ga0207667_108700901 270
217 3300026023 Ga0207677_10019685 Ga0207677_100196854 270
218 3300026142 Ga0207698_10001345 Ga0207698_100013458 270
219 3300026142 Ga0207698_10031596 Ga0207698_100315963 270
220 3300026142 Ga0207698_10037180 Ga0207698_100371803 270
221 3300038443 Ga0395901_0425982 Ga0395901_0425982_34_891 270
222 3300044684 Ga0466966_0121661 Ga0466966_0121661_161_985 270
223 3300044842 Ga0466957_0011844 Ga0466957_0011844_2604_3428 270
224 3300045049 Ga0466959_0029429 Ga0466959_0029429_1620_2444 270
225 3300045836 Ga0466958_0085119 Ga0466958_0085119_476_1300 270
226 3300048908 Ga0496105_0455405 Ga0496105_0455405_139_987 270
227 3300048912 Ga0496109_0724430 Ga0496109_0724430_24_872 270
228 3300048913 Ga0496110_0070669 Ga0496110_0070669_1423_2271 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

33

295

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g61-assembly1.cif.gz_A crystal structure of impase/nadp phosphatase complexed with mg2+ and phosphate 0.8704 6 265
3lv0-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.8672 10 269
6ib8-assembly1.cif.gz_B structure of a complex of suhb and nusa ar2 domain 0.867 7 270
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.8632 7 266
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.8557 9 269
ID Description Score Start End Superfamily
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9142 13 147 3.30.540.10
3lv0B01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.879 10 147 3.30.540.10
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8753 13 147 3.30.540.10
3lv0B01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8604 10 147 3.30.540.10
af_Q54U72_1_145_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.86 6 146 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A248LDI2-F1-model_v4 SuhB2 0.9497 6 268 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A2M7N7L1-F1-model_v4 Inositol monophosphatase 0.9433 8 93 GO:0046872
AF-A0A2G6DJB5-F1-model_v4 Inositol monophosphatase 0.941 7 268 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A2T6NSI5-F1-model_v4 Inositol monophosphatase 0.9373 7 268 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A3M2FHR4-F1-model_v4 Inositol monophosphatase family protein 0.9314 9 269 GO:0006020
GO:0007165
GO:0008934
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map