F341069

General Info

Members Datasets Scaffolds Average Seq Length
228 186 456 191

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10000065|Ga0207678_1000006528
Length 213
Sequence VEWLEPQYYVWSGVNVMVRRNPERRAALLDAAIEVLANEGARGLTFRAVDQQAGVPVGTASNYFSSRDEILKHAGERVYERLVDEGVIADGLEGPRDRARVTELMHALVDRVAAFPTGFLALLELRLEATRRPELQDVLTRRIRADVDFNVSYHEKSGLPGDGTMVVLLWLGLNWLIMERLTLPDLFTDEQRHDLVTALVERLLAGQPALPPA

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
33 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
34 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
35 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
48 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
49 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
50 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
51 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
59 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
60 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
61 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
62 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
63 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
64 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
81 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
87 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 2547132424 Nocardia nova SH22a Isolate Unclassified
103 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
104 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
105 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
106 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
107 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
108 2643221548 Streptomyces sp. Root55 Isolate Unclassified
109 2643221578 Streptomyces sp. Root63 Isolate Unclassified
110 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
111 2643221647 Streptomyces sp. Root369 Isolate Unclassified
112 2643221670 Streptomyces sp. Root431 Isolate Unclassified
113 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
114 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
115 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
116 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
117 2643221692 Nocardia sp. Root136 Isolate Unclassified
118 2643221714 Streptomyces sp. Root264 Isolate Unclassified
119 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
120 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
121 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
122 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
123 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
124 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
125 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
126 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
127 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
128 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
129 2808606448 Streptomyces sp. 193411 Isolate Unclassified
130 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
131 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
132 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
133 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
134 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
135 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
136 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
137 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
138 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
139 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
140 2867369537 Streptomyces sp. Z26 Isolate Unclassified
141 2867428634 Streptomyces sp. RP5T Isolate Unclassified
142 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
143 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
144 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
145 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
146 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
147 2891562705 Microbispora tritici MT50 Isolate Unclassified
148 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
149 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
150 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
151 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
152 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
153 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
154 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
155 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
156 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
157 2922554459 Rhodococcus sp. 66b Isolate Unclassified
158 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
159 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
160 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
161 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
162 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
163 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
164 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
165 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
166 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
167 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
168 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
169 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
170 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
171 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
172 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
173 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
174 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
175 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
176 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
177 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
178 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
179 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
180 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
181 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
182 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
183 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
184 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
185 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
186 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.96
Metatranscriptomes 0.88
Isolates 38.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0.88
Rhizoplane 1.32
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10000065 3300026067 Bacteria 83028
2 rootH1_10003189 3300003316 Bacteria 7602
3 rootH2_10004696 3300003320 Bacteria 7475
4 rootH2_10080325 3300003320 Bacteria 1013
5 rootH1_10019242 3300003323 Bacteria 3328
6 rootH1_10019252 3300003323 Bacteria 4046
7 rootH1_10074544 3300003323 Bacteria 2483
8 Ga0006562J51391_1182584 3300003578 Bacteria 2855
9 Ga0006562J51391_1182585 3300003578 Bacteria 1580
10 Ga0070710_10000775 3300005437 Bacteria 15263
11 Ga0070711_100458854 3300005439 Bacteria 1044
12 Ga0070663_100000249 3300005455 Bacteria 27248
13 Ga0070681_11018218 3300005458 Bacteria 748
14 Ga0068853_100112949 3300005539 Bacteria 2415
15 Ga0068856_100439439 3300005614 Bacteria 1325
16 Ga0081538_10236003 3300005981 Bacteria 710
17 Ga0075363_100003786 3300006048 Bacteria 6520
18 Ga0075363_100106672 3300006048 Bacteria 1554
19 Ga0075428_100005123 3300006844 Bacteria 14564
20 Ga0075430_100001516 3300006846 Bacteria 18950
21 Ga0075431_100002814 3300006847 Bacteria 16835
22 Ga0075429_100003015 3300006880 Bacteria 14277
23 Ga0114129_10005409 3300009147 Bacteria 18033
24 Ga0105243_10000571 3300009148 Bacteria 37133
25 Ga0157378_10770920 3300013297 Bacteria 986
26 Ga0183367_1002 3300015688 Bacteria 1101531
27 Ga0163161_10348460 3300017792 Bacteria 1177
28 Ga0207426_1035577 3300025302 Bacteria 1588
29 Ga0207692_10008431 3300025898 Bacteria 4262
30 Ga0207687_10456492 3300025927 Bacteria 1060
31 Ga0207668_10050764 3300025972 Bacteria 2860
32 Ga0207675_100893364 3300026118 Bacteria 904
33 Ga0209371_1040525 3300027312 Bacteria 947
34 Ga0307515_10404061 3300028794 Bacteria 990
35 Ga0268256_1046014 3300030500 Bacteria 947
36 Ga0307512_10070429 3300030522 Bacteria 2604
37 Ga0316177_1033049 3300030731 Bacteria 898
38 Ga0316177_1077249 3300030731 Bacteria 2003
39 Ga0316176_1067418 3300030732 Bacteria 3530
40 Ga0314311_1174787 3300030733 Bacteria 3637
41 Ga0316180_1045854 3300030736 Bacteria 2005
42 Ga0316180_1182629 3300030736 Bacteria 1484
43 Ga0307513_10000005 3300031456 Bacteria 553227
44 Ga0307513_10031524 3300031456 Bacteria 6001
45 Ga0307513_10281434 3300031456 Bacteria 1440
46 Ga0307513_10360768 3300031456 Bacteria 1198
47 Ga0307513_10509826 3300031456 Bacteria 919
48 Ga0307508_10008187 3300031616 Bacteria 9692
49 Ga0307514_10030004 3300031649 Bacteria 4366
50 Ga0307516_10253808 3300031730 Bacteria 1452
51 Ga0307518_10279997 3300031838 Bacteria 1033
52 Ga0307410_10332496 3300031852 Bacteria 1209
53 Ga0307416_101117998 3300032002 Bacteria 893
54 Ga0307411_10145513 3300032005 Bacteria 1754
55 Ga0307507_10142283 3300033179 Bacteria 1835
56 Ga0395900_0239187 3300037418 Bacteria 1822
57 Ga0395900_1197075 3300037418 Bacteria 675
58 Ga0395898_0003329 3300037466 Bacteria 18046
59 Ga0395898_0612678 3300037466 Bacteria 1031
60 Ga0395901_0218260 3300038443 Bacteria 1994
61 Ga0439436_0002582 3300041404 Bacteria 5448
62 Ga0439436_0006346 3300041404 Bacteria 3629
63 Ga0439438_071085 3300041405 Bacteria 861
64 Ga0439439_0004051 3300041406 Bacteria 3274
65 Ga0439439_0014422 3300041406 Bacteria 1924
66 Ga0439439_0081760 3300041406 Bacteria 874
67 Ga0439466_0060996 3300041411 Bacteria 1215
68 Ga0439466_0075303 3300041411 Bacteria 1070
69 Ga0451853_0079623 3300041512 Bacteria 2373
70 Ga0451853_1373222 3300041512 Bacteria 2469
71 Ga0451853_2076158 3300041512 Bacteria 1855
72 Ga0439433_0001673 3300041999 Bacteria 4623
73 Ga0439433_0067351 3300041999 Bacteria 859
74 Ga0439442_062190 3300042002 Bacteria 792
75 Ga0439449_0001232 3300042007 Bacteria 10025
76 Ga0439449_0004363 3300042007 Bacteria 5459
77 Ga0439449_0013060 3300042007 Bacteria 3124
78 Ga0439449_0025111 3300042007 Bacteria 2227
79 Ga0439449_0093461 3300042007 Bacteria 1110
80 Ga0439455_0017353 3300042012 Bacteria 1676
81 Ga0439457_000408 3300042014 Bacteria 12281
82 Ga0439457_001534 3300042014 Bacteria 6930
83 Ga0439457_001862 3300042014 Bacteria 6233
84 Ga0450894_001383 3300042131 Bacteria 3507
85 Ga0450896_015547 3300042133 Bacteria 1090
86 Ga0450900_000794 3300042136 Bacteria 2755
87 Ga0450903_000629 3300042138 Bacteria 7135
88 Ga0450906_007805 3300042145 Bacteria 2098
89 Ga0450906_020337 3300042145 Bacteria 1188
90 Ga0450907_050400 3300042146 Bacteria 716
91 Ga0439458_0019962 3300042157 Bacteria 1545
92 Ga0466972_0003926 3300044658 Bacteria 7416
93 Ga0466972_0009303 3300044658 Bacteria 4938
94 Ga0466972_0096170 3300044658 Bacteria 1403
95 Ga0466965_0002990 3300044683 Bacteria 7334
96 Ga0466965_0016744 3300044683 Bacteria 3495
97 Ga0466965_0053067 3300044683 Bacteria 2014
98 Ga0466961_0351662 3300044693 Bacteria 897
99 Ga0466968_0009017 3300044735 Bacteria 3835
100 Ga0466970_0009715 3300044765 Bacteria 4867
101 Ga0466970_0032069 3300044765 Bacteria 2776
102 Ga0466970_0113455 3300044765 Bacteria 1481
103 Ga0466960_0072066 3300044901 Bacteria 1721
104 Ga0466960_0110139 3300044901 Bacteria 1429
105 Ga0466960_0114220 3300044901 Bacteria 1407
106 Ga0466967_1475328 3300045976 Bacteria 677
107 Ga0495603_0143889 3300046455 Bacteria 1386
108 Ga0495603_0651576 3300046455 Bacteria 603
109 Ga0495629_0005303 3300046459 Bacteria 9637
110 Ga0495638_0256242 3300046460 Bacteria 962
111 Ga0495594_0000431 3300046499 Bacteria 21108
112 Ga0495631_0009932 3300046518 Bacteria 4733
113 Ga0495622_0003921 3300046557 Bacteria 6950
114 Ga0495668_0000573 3300046616 Bacteria 45058
115 Ga0495625_0039496 3300046660 Bacteria 3446
116 Ga0495649_0132360 3300046694 Bacteria 1315
117 Ga0495589_0219921 3300046794 Bacteria 892
118 Ga0495636_0000350 3300047318 Bacteria 17602
119 Ga0495636_0003680 3300047318 Bacteria 5960
120 Ga0495672_0009166 3300047320 Bacteria 7208
121 Ga0495676_0002124 3300047321 Bacteria 17506
122 Ga0495687_003433 3300047443 Bacteria 11495
123 Ga0495677_0080135 3300047445 Bacteria 1223
124 Ga0495685_004600 3300047447 Bacteria 4471
125 Ga0495685_027224 3300047447 Bacteria 1966
126 Ga0495685_031410 3300047447 Bacteria 1825
127 Ga0495686_0021794 3300047472 Bacteria 4249
128 Ga0496105_0851299 3300048908 Bacteria 690
129 Ga0496113_0921675 3300048916 Bacteria 690
130 Ga0496125_0029988 3300048928 Bacteria 4874
131 Ga0501034_0121190 3300049571 Bacteria 2602
132 Ga0501037_0093125 3300049573 Bacteria 2179
133 Ga0501047_0023874 3300049581 Bacteria 5872
134 Ga0501048_0079806 3300049582 Bacteria 2309
135 Ga0501035_0596731 3300049822 Bacteria 900
136 Ga0501044_0058155 3300049823 Bacteria 3966
137 nmdc:mga03n38_260931_c1 3300050490 Bacteria 918
138 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
139 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
140 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
141 nmdc:mga06r32_384404_c1 3300050510 Bacteria 885
142 2548692572 2547132424 Bacteria 8348532
143 2552105126 2551306166 Bacteria 9731570
144 2554257832 2554235005 Bacteria 6457341
145 2566993082 2565956761 Bacteria 6601618
146 2585298480 2582581312 Bacteria 7308206
147 2616902096 2616644941 Bacteria 8510691
148 2643763138 2643221548 Bacteria 8053412
149 2643900150 2643221578 Bacteria 9213798
150 2643943777 2643221587 Bacteria 7586415
151 2644269594 2643221647 Bacteria 10741251
152 2644386783 2643221670 Bacteria 6497041
153 2644405626 2643221673 Bacteria 9196637
154 2644434515 2643221677 Bacteria 7584031
155 2644439911 2643221678 Bacteria 9540101
156 2644463992 2643221682 Bacteria 6743283
157 2644517192 2643221692 Bacteria 7282860
158 2644632758 2643221714 Bacteria 9015452
159 2676492839 2675903060 Bacteria 10051191
160 2738889955 2738541308 Bacteria 7020677
161 2739237096 2738543011 Bacteria 5731169
162 2753070063 2751185734 Bacteria 8863695
163 2784588632 2784132148 Bacteria 8627943
164 2785343074 2784746763 Bacteria 9783172
165 2785371366 2784746768 Bacteria 10036182
166 2791916201 2791354901 Bacteria 8322202
167 2793977795 2791355406 Bacteria 11364898
168 2808843918 2808606359 Bacteria 9866990
169 2809232245 2808606448 Bacteria 8656184
170 2812357026 2811994879 Bacteria 9313447
171 2812477225 2811994917 Bacteria 7761064
172 2816427846 2816332119 Bacteria 8120218
173 2852640894 2852635781 Bacteria 8251373
174 2856742291 2856741275 Bacteria 8096094
175 2861522634 2861520306 Bacteria 8348283
176 2862284873 2862281513 Bacteria 9621493
177 2862384107 2862382967 Bacteria 10317375
178 2862709172 2862705112 Bacteria 6563286
179 2866612577 2866612099 Bacteria 7543886
180 2867372309 2867369537 Bacteria 6501581
181 2867431465 2867428634 Bacteria 9590268
182 2870727442 2870721527 Bacteria 9689237
183 2873157460 2873151551 Bacteria 8625867
184 2875395178 2875391855 Bacteria 7600475
185 2884699482 2884693830 Bacteria 11273186
186 2889301321 2889300758 Bacteria 5690814
187 2891565433 2891562705 Bacteria 8039471
188 2895437746 2895427314 Bacteria 13147766
189 2895438445 2895427314 Bacteria 13147766
190 2895443307 2895442618 Bacteria 11027144
191 2899364433 2899359706 Bacteria 10940472
192 2904538924 2904535858 Bacteria 6308016
193 2912717833 2912715099 Bacteria 9460473
194 2912760748 2912757875 Bacteria 7940295
195 2917743692 2917736166 Bacteria 9690793
196 2918506383 2918501144 Bacteria 8668083
197 2919471601 2919468124 Bacteria 9133025
198 2922556778 2922554459 Bacteria 6683962
199 2939744789 2939743619 Bacteria 5762299
200 2946049483 2946045630 Bacteria 8527308
201 2946068854 2946064051 Bacteria 8957905
202 2946077628 2946072368 Bacteria 8999607
203 2947227051 2947224130 Bacteria 9938529
204 2947227776 2947224130 Bacteria 9938529
205 2954384120 2954380949 Bacteria 10050426
206 2954694939 2954691527 Bacteria 10720516
207 2954710116 2954701450 Bacteria 10834262
208 2954714435 2954711539 Bacteria 10867210
209 2954724381 2954721474 Bacteria 10456478
210 2954737437 2954731030 Bacteria 10243860
211 2954743303 2954740390 Bacteria 10229294
212 2954756291 2954749733 Bacteria 10366972
213 2954762260 2954759201 Bacteria 9358192
214 2997606809 2997600082 Bacteria 9896405
215 3006498144 3006493962 Bacteria 8825450
216 8003322293 8003314358 Bacteria 10575343
217 8008488388 8008485437 Bacteria 7198341
218 8008565277 8008558824 Bacteria 10610750
219 8023629800 8023623736 Bacteria 8593882
220 8025527265 8025524527 Bacteria 7197316
221 8025534630 8025530807 Bacteria 8495698
222 8047899045 8047893842 Bacteria 11723082
223 8048359875 8048356638 Bacteria 11044339
224 8048376009 8048369669 Bacteria 11666822
225 8048382111 8048379754 Bacteria 11877923
226 8056058275 8056054917 Bacteria 5736694
227 8056060933 8056060235 Bacteria 7259403
228 8056449337 8056447290 Bacteria 7680491
229 Ga0207678_10000065
230 rootH1_10003189
231 rootH2_10004696
232 rootH2_10080325
233 rootH1_10019242
234 rootH1_10019252
235 rootH1_10074544
236 Ga0006562J51391_1182584
237 Ga0006562J51391_1182585
238 Ga0070710_10000775
239 Ga0070711_100458854
240 Ga0070663_100000249
241 Ga0070681_11018218
242 Ga0068853_100112949
243 Ga0068856_100439439
244 Ga0081538_10236003
245 Ga0075363_100003786
246 Ga0075363_100106672
247 Ga0075428_100005123
248 Ga0075430_100001516
249 Ga0075431_100002814
250 Ga0075429_100003015
251 Ga0114129_10005409
252 Ga0105243_10000571
253 Ga0157378_10770920
254 Ga0183367_1002
255 Ga0163161_10348460
256 Ga0207426_1035577
257 Ga0207692_10008431
258 Ga0207687_10456492
259 Ga0207668_10050764
260 Ga0207675_100893364
261 Ga0209371_1040525
262 Ga0307515_10404061
263 Ga0268256_1046014
264 Ga0307512_10070429
265 Ga0316177_1033049
266 Ga0316177_1077249
267 Ga0316176_1067418
268 Ga0314311_1174787
269 Ga0316180_1045854
270 Ga0316180_1182629
271 Ga0307513_10000005
272 Ga0307513_10031524
273 Ga0307513_10281434
274 Ga0307513_10360768
275 Ga0307513_10509826
276 Ga0307508_10008187
277 Ga0307514_10030004
278 Ga0307516_10253808
279 Ga0307518_10279997
280 Ga0307410_10332496
281 Ga0307416_101117998
282 Ga0307411_10145513
283 Ga0307507_10142283
284 Ga0395900_0239187
285 Ga0395900_1197075
286 Ga0395898_0003329
287 Ga0395898_0612678
288 Ga0395901_0218260
289 Ga0439436_0002582
290 Ga0439436_0006346
291 Ga0439438_071085
292 Ga0439439_0004051
293 Ga0439439_0014422
294 Ga0439439_0081760
295 Ga0439466_0060996
296 Ga0439466_0075303
297 Ga0451853_0079623
298 Ga0451853_1373222
299 Ga0451853_2076158
300 Ga0439433_0001673
301 Ga0439433_0067351
302 Ga0439442_062190
303 Ga0439449_0001232
304 Ga0439449_0004363
305 Ga0439449_0013060
306 Ga0439449_0025111
307 Ga0439449_0093461
308 Ga0439455_0017353
309 Ga0439457_000408
310 Ga0439457_001534
311 Ga0439457_001862
312 Ga0450894_001383
313 Ga0450896_015547
314 Ga0450900_000794
315 Ga0450903_000629
316 Ga0450906_007805
317 Ga0450906_020337
318 Ga0450907_050400
319 Ga0439458_0019962
320 Ga0466972_0003926
321 Ga0466972_0009303
322 Ga0466972_0096170
323 Ga0466965_0002990
324 Ga0466965_0016744
325 Ga0466965_0053067
326 Ga0466961_0351662
327 Ga0466968_0009017
328 Ga0466970_0009715
329 Ga0466970_0032069
330 Ga0466970_0113455
331 Ga0466960_0072066
332 Ga0466960_0110139
333 Ga0466960_0114220
334 Ga0466967_1475328
335 Ga0495603_0143889
336 Ga0495603_0651576
337 Ga0495629_0005303
338 Ga0495638_0256242
339 Ga0495594_0000431
340 Ga0495631_0009932
341 Ga0495622_0003921
342 Ga0495668_0000573
343 Ga0495625_0039496
344 Ga0495649_0132360
345 Ga0495589_0219921
346 Ga0495636_0000350
347 Ga0495636_0003680
348 Ga0495672_0009166
349 Ga0495676_0002124
350 Ga0495687_003433
351 Ga0495677_0080135
352 Ga0495685_004600
353 Ga0495685_027224
354 Ga0495685_031410
355 Ga0495686_0021794
356 Ga0496105_0851299
357 Ga0496113_0921675
358 Ga0496125_0029988
359 Ga0501034_0121190
360 Ga0501037_0093125
361 Ga0501047_0023874
362 Ga0501048_0079806
363 Ga0501035_0596731
364 Ga0501044_0058155
365 nmdc:mga03n38_260931_c1
366 nmdc:mga05p37_5508_c1
367 nmdc:mga09592_20965_c1
368 nmdc:mga06r32_2991_c1
369 nmdc:mga06r32_384404_c1
370 2548692572
371 2552105126
372 2554257832
373 2566993082
374 2585298480
375 2616902096
376 2643763138
377 2643900150
378 2643943777
379 2644269594
380 2644386783
381 2644405626
382 2644434515
383 2644439911
384 2644463992
385 2644517192
386 2644632758
387 2676492839
388 2738889955
389 2739237096
390 2753070063
391 2784588632
392 2785343074
393 2785371366
394 2791916201
395 2793977795
396 2808843918
397 2809232245
398 2812357026
399 2812477225
400 2816427846
401 2852640894
402 2856742291
403 2861522634
404 2862284873
405 2862384107
406 2862709172
407 2866612577
408 2867372309
409 2867431465
410 2870727442
411 2873157460
412 2875395178
413 2884699482
414 2889301321
415 2891565433
416 2895437746
417 2895438445
418 2895443307
419 2899364433
420 2904538924
421 2912717833
422 2912760748
423 2917743692
424 2918506383
425 2919471601
426 2922556778
427 2939744789
428 2946049483
429 2946068854
430 2946077628
431 2947227051
432 2947227776
433 2954384120
434 2954694939
435 2954710116
436 2954714435
437 2954724381
438 2954737437
439 2954743303
440 2954756291
441 2954762260
442 2997606809
443 3006498144
444 8003322293
445 8008488388
446 8008565277
447 8023629800
448 8025527265
449 8025534630
450 8047899045
451 8048359875
452 8048376009
453 8048382111
454 8056058275
455 8056060933
456 8056449337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

28

74

0.97

PF17940

TetR_C_31

Tetracyclin repressor-like, C-terminal domain

96

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qko-assembly1.cif.gz_A crystal structure of transcriptional regulator rha06399 from rhodococcus sp. rha1 0.9384 7 193
2qko-assembly1.cif.gz_A crystal structure of transcriptional regulator rha06399 from rhodococcus sp. rha1 0.9228 7 193
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.825 6 191
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8227 9 66
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.8165 6 191
ID Description Score Start End Superfamily
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9199 9 61 1.10.10.60
2qkoD00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9194 5 193 1.10.357.10
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9162 9 58 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9086 9 61 1.10.10.60
2qkoD00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9042 5 193 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A7U9DX65-F1-model_v4 Transcriptional regulator, TetR family 0.9949 2 193 GO:0003677
GO:0006355
AF-A0A7U9DX65-F1-model_v4 Transcriptional regulator, TetR family 0.9847 2 193 GO:0003677
GO:0006355
AF-H0BHI6-F1-model_v4 TetR family transcriptional regulator 0.9724 12 190 GO:0000976
GO:0003700
AF-A0A387H9I4-F1-model_v4 HTH-type transcriptional regulator BetI 0.9695 7 191 GO:0000976
GO:0003700
AF-A0A7V8NCK1-F1-model_v4 TetR family transcriptional regulator 0.9695 7 190 GO:0000976
GO:0003700

Map