F341833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 152 | 458 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100867665|Ga0068855_1008676651 |
| Length | 215 |
| Sequence | MQVEVLNISGKKTTKKVELADSIFNVEPNDHCIYLDVKQHLANKRQGTHKSKERAEIARTTKKLKRQKGTGGARAGSMKSPLFIGGGRVFGPKPRDYSFKLNKKVKVVARASALTYKAKDNAITVLEDFNFEAPKTKNYSELMKNLNMSDKKTLLVLGGHNKNVYLSSRNIHGAKVVNASDLNTYDILNAQNLILSESSVKVIEQILNKQDGNSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 26 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 27 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 28 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 56 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 57 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 58 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 59 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 60 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 61 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 63 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 64 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 65 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 66 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 67 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 68 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 69 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 70 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 71 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 72 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 73 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 76 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 77 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 78 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 81 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 82 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 83 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 87 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 88 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 89 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 90 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 91 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 92 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 93 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 94 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 95 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 96 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 97 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 98 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 99 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 100 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 102 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 103 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 124 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 125 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 126 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 127 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 128 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 129 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 130 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 131 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 132 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 133 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 134 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 136 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 137 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 138 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 139 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 140 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 141 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 142 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 143 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 144 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 150 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 151 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 152 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.86 |
| Metatranscriptomes | 21.4 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.04 |
| Nodule | 0 |
| Rhizoplane | 3.49 |
| Rhizosphere | 76.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100867665 | 3300005563 | Bacteria | 955 |
| 2 | JGI24740J21852_10008519 | 3300001979 | Bacteria | 4080 |
| 3 | rootH1_10010612 | 3300003316 | Bacteria | 9244 |
| 4 | rootH2_10003970 | 3300003320 | Bacteria | 33753 |
| 5 | rootH2_10173412 | 3300003320 | Bacteria | 1915 |
| 6 | rootL2_10010167 | 3300003322 | Bacteria | 22542 |
| 7 | rootL2_10011247 | 3300003322 | Bacteria | 9421 |
| 8 | rootL2_10015593 | 3300003322 | Bacteria | 11855 |
| 9 | rootH1_10009782 | 3300003323 | Bacteria | 19748 |
| 10 | rootH1_10012094 | 3300003323 | Bacteria | 18730 |
| 11 | rootH1_10108515 | 3300003323 | Bacteria | 1780 |
| 12 | rootH1_10109910 | 3300003323 | Bacteria | 1897 |
| 13 | Ga0007417J51691_1063811 | 3300003544 | Bacteria | 1562 |
| 14 | Ga0055531_10000409 | 3300003794 | Bacteria | 41322 |
| 15 | Ga0058860_12155377 | 3300004801 | Bacteria | 1355 |
| 16 | Ga0065165_1000831 | 3300005262 | Bacteria | 40595 |
| 17 | Ga0065165_1059034 | 3300005262 | Bacteria | 1057 |
| 18 | Ga0065714_10007641 | 3300005288 | Bacteria | 3489 |
| 19 | Ga0070682_100678995 | 3300005337 | Bacteria | 823 |
| 20 | Ga0070668_100181543 | 3300005347 | Bacteria | 1719 |
| 21 | Ga0070688_100041186 | 3300005365 | Bacteria | 2834 |
| 22 | Ga0070714_100091865 | 3300005435 | Bacteria | 2660 |
| 23 | Ga0070713_101169406 | 3300005436 | Bacteria | 744 |
| 24 | Ga0070678_100351006 | 3300005456 | Bacteria | 1268 |
| 25 | Ga0068855_100289382 | 3300005563 | Bacteria | 1817 |
| 26 | Ga0068857_100236793 | 3300005577 | Bacteria | 1670 |
| 27 | Ga0068856_100031219 | 3300005614 | Bacteria | 5212 |
| 28 | Ga0068856_100077827 | 3300005614 | Bacteria | 3287 |
| 29 | Ga0068852_101439434 | 3300005616 | Unclassified | 711 |
| 30 | Ga0068864_100677165 | 3300005618 | Bacteria | 1006 |
| 31 | Ga0068863_100436656 | 3300005841 | Bacteria | 1283 |
| 32 | Ga0070715_10085294 | 3300006163 | Bacteria | 1442 |
| 33 | Ga0070716_100039818 | 3300006173 | Bacteria | 2611 |
| 34 | Ga0075370_10341066 | 3300006353 | Bacteria | 894 |
| 35 | Ga0075428_100013576 | 3300006844 | Bacteria | 9071 |
| 36 | Ga0075428_100182361 | 3300006844 | Bacteria | 2272 |
| 37 | Ga0075430_100076161 | 3300006846 | Bacteria | 2812 |
| 38 | Ga0075431_100328003 | 3300006847 | Bacteria | 1542 |
| 39 | Ga0111539_10013971 | 3300009094 | Bacteria | 10037 |
| 40 | Ga0111539_10015243 | 3300009094 | Bacteria | 9574 |
| 41 | Ga0105242_10103549 | 3300009176 | Bacteria | 2415 |
| 42 | Ga0105242_10639314 | 3300009176 | Bacteria | 1033 |
| 43 | Ga0105249_11637997 | 3300009553 | Bacteria | 716 |
| 44 | Ga0157371_10054786 | 3300013102 | Bacteria | 2831 |
| 45 | Ga0157370_10145310 | 3300013104 | Bacteria | 2209 |
| 46 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 47 | Ga0157372_10965536 | 3300013307 | Bacteria | 988 |
| 48 | Ga0157380_10000051 | 3300014326 | Bacteria | 68466 |
| 49 | Ga0157380_10006042 | 3300014326 | Bacteria | 8483 |
| 50 | Ga0157376_10670759 | 3300014969 | Bacteria | 1039 |
| 51 | Ga0206356_10873539 | 3300020070 | Bacteria | 1011 |
| 52 | Ga0209050_1005534 | 3300025298 | Bacteria | 7892 |
| 53 | Ga0209050_1049461 | 3300025298 | Bacteria | 1077 |
| 54 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 55 | Ga0209257_1024055 | 3300025304 | Bacteria | 2120 |
| 56 | Ga0207685_10046839 | 3300025905 | Bacteria | 1647 |
| 57 | Ga0207695_10634758 | 3300025913 | Bacteria | 949 |
| 58 | Ga0207687_10089938 | 3300025927 | Bacteria | 2236 |
| 59 | Ga0207686_10198597 | 3300025934 | Bacteria | 1435 |
| 60 | Ga0207665_10050775 | 3300025939 | Bacteria | 2790 |
| 61 | Ga0207667_10182531 | 3300025949 | Bacteria | 2154 |
| 62 | Ga0207667_10189183 | 3300025949 | Bacteria | 2112 |
| 63 | Ga0207667_10939292 | 3300025949 | Bacteria | 855 |
| 64 | Ga0207639_10470787 | 3300026041 | Bacteria | 1144 |
| 65 | Ga0207678_10258902 | 3300026067 | Bacteria | 1491 |
| 66 | Ga0207702_10023144 | 3300026078 | Bacteria | 5153 |
| 67 | Ga0207641_10450750 | 3300026088 | Bacteria | 1243 |
| 68 | Ga0207676_10567325 | 3300026095 | Bacteria | 1086 |
| 69 | Ga0207676_10896913 | 3300026095 | Bacteria | 869 |
| 70 | Ga0207674_10145777 | 3300026116 | Bacteria | 2326 |
| 71 | Ga0207683_10772674 | 3300026121 | Unclassified | 891 |
| 72 | Ga0209995_1030097 | 3300027471 | Bacteria | 908 |
| 73 | Ga0209974_10056787 | 3300027876 | Bacteria | 1321 |
| 74 | Ga0207428_10076578 | 3300027907 | Bacteria | 2619 |
| 75 | Ga0207428_10313406 | 3300027907 | Bacteria | 1159 |
| 76 | Ga0265334_10018191 | 3300028573 | Bacteria | 2898 |
| 77 | Ga0265323_10000040 | 3300028653 | Bacteria | 70373 |
| 78 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 79 | Ga0307515_10536201 | 3300028794 | Bacteria | 780 |
| 80 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 81 | Ga0265338_10001855 | 3300028800 | Bacteria | 33207 |
| 82 | Ga0265338_10143556 | 3300028800 | Bacteria | 1866 |
| 83 | Ga0265324_10056854 | 3300029957 | Bacteria | 1340 |
| 84 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 85 | Ga0265327_10127644 | 3300031251 | Bacteria | 1199 |
| 86 | Ga0265316_10000486 | 3300031344 | Bacteria | 45040 |
| 87 | Ga0307513_10127710 | 3300031456 | Bacteria | 2494 |
| 88 | Ga0307509_10007469 | 3300031507 | Bacteria | 14263 |
| 89 | Ga0307509_10165518 | 3300031507 | Bacteria | 2101 |
| 90 | Ga0307408_100000648 | 3300031548 | Bacteria | 29197 |
| 91 | Ga0307408_100038382 | 3300031548 | Bacteria | 3379 |
| 92 | Ga0307514_10127372 | 3300031649 | Bacteria | 1761 |
| 93 | Ga0316576_10021298 | 3300031727 | Bacteria | 4482 |
| 94 | Ga0316578_10015477 | 3300031728 | Bacteria | 4102 |
| 95 | Ga0307516_10090261 | 3300031730 | Bacteria | 2893 |
| 96 | Ga0307413_10081698 | 3300031824 | Bacteria | 2073 |
| 97 | Ga0307410_10788448 | 3300031852 | Bacteria | 807 |
| 98 | Ga0307412_10010885 | 3300031911 | Bacteria | 5251 |
| 99 | Ga0307412_10276740 | 3300031911 | Bacteria | 1316 |
| 100 | Ga0307409_100054022 | 3300031995 | Bacteria | 3091 |
| 101 | Ga0307416_100000249 | 3300032002 | Bacteria | 28628 |
| 102 | Ga0307414_10010589 | 3300032004 | Bacteria | 5360 |
| 103 | Ga0307411_10133368 | 3300032005 | Bacteria | 1819 |
| 104 | Ga0307415_100035567 | 3300032126 | Bacteria | 3254 |
| 105 | Ga0307415_100840353 | 3300032126 | Unclassified | 842 |
| 106 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 107 | Ga0316596_1006083 | 3300033541 | Bacteria | 2790 |
| 108 | Ga0373931_0139815 | 3300035691 | Bacteria | 1401 |
| 109 | Ga0373927_0006959 | 3300035695 | Bacteria | 7677 |
| 110 | Ga0373937_1032720 | 3300036401 | Bacteria | 771 |
| 111 | Ga0316582_0115197 | 3300036647 | Bacteria | 1793 |
| 112 | Ga0316584_0001842 | 3300036712 | Bacteria | 13121 |
| 113 | Ga0316584_0028755 | 3300036712 | Bacteria | 4102 |
| 114 | Ga0395899_0000673 | 3300037312 | Bacteria | 34566 |
| 115 | Ga0395900_0541447 | 3300037418 | Bacteria | 1110 |
| 116 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 117 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 118 | Ga0395905_0308049 | 3300037471 | Bacteria | 1472 |
| 119 | Ga0395901_0002865 | 3300038443 | Bacteria | 17414 |
| 120 | Ga0400488_36638 | 3300038741 | Bacteria | 1290 |
| 121 | Ga0451799_02770 | 3300041454 | Bacteria | 1535 |
| 122 | Ga0451801_20542 | 3300041455 | Bacteria | 768 |
| 123 | Ga0451795_0578569 | 3300041456 | Bacteria | 1331 |
| 124 | Ga0451795_1060327 | 3300041456 | Bacteria | 2256 |
| 125 | Ga0451798_0296397 | 3300041458 | Bacteria | 1150 |
| 126 | Ga0451802_1246725 | 3300041460 | Bacteria | 1269 |
| 127 | Ga0451805_091713 | 3300041461 | Bacteria | 3245 |
| 128 | Ga0451808_16930 | 3300041464 | Bacteria | 2421 |
| 129 | Ga0451837_1468151 | 3300041494 | Bacteria | 1012 |
| 130 | Ga0452271_55409 | 3300041916 | Bacteria | 1788 |
| 131 | Ga0439460_0002577 | 3300042461 | Bacteria | 4377 |
| 132 | Ga0451577_0058001 | 3300042876 | Bacteria | 3451 |
| 133 | Ga0451577_0092287 | 3300042876 | Bacteria | 2703 |
| 134 | Ga0453683_0041549 | 3300044673 | Bacteria | 2888 |
| 135 | Ga0453683_0130278 | 3300044673 | Bacteria | 1585 |
| 136 | Ga0453684_0001121 | 3300044712 | Bacteria | 83919 |
| 137 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 138 | Ga0453684_0005611 | 3300044712 | Bacteria | 24695 |
| 139 | Ga0453684_0007136 | 3300044712 | Bacteria | 20809 |
| 140 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 141 | Ga0453684_0092022 | 3300044712 | Bacteria | 3741 |
| 142 | Ga0453684_0164783 | 3300044712 | Bacteria | 2618 |
| 143 | Ga0453684_0315852 | 3300044712 | Bacteria | 1771 |
| 144 | Ga0453684_0414653 | 3300044712 | Bacteria | 1506 |
| 145 | Ga0453684_0422724 | 3300044712 | Bacteria | 1488 |
| 146 | Ga0453684_0777061 | 3300044712 | Bacteria | 1035 |
| 147 | Ga0453684_1397031 | 3300044712 | Bacteria | 726 |
| 148 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 149 | Ga0451576_0010522 | 3300045051 | Bacteria | 10601 |
| 150 | Ga0451576_0018019 | 3300045051 | Bacteria | 7749 |
| 151 | Ga0451576_0051376 | 3300045051 | Bacteria | 4322 |
| 152 | Ga0451576_0063555 | 3300045051 | Bacteria | 3848 |
| 153 | Ga0451576_0275888 | 3300045051 | Bacteria | 1758 |
| 154 | Ga0451576_0409141 | 3300045051 | Bacteria | 1423 |
| 155 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 156 | Ga0495625_0247105 | 3300046660 | Bacteria | 1159 |
| 157 | Ga0501306_000385 | 3300049127 | Bacteria | 3273 |
| 158 | Ga0501306_025537 | 3300049127 | Bacteria | 851 |
| 159 | Ga0501308_000775 | 3300049128 | Bacteria | 2277 |
| 160 | Ga0501309_001746 | 3300049129 | Bacteria | 2213 |
| 161 | Ga0501309_004788 | 3300049129 | Bacteria | 1588 |
| 162 | Ga0501309_058333 | 3300049129 | Bacteria | 617 |
| 163 | Ga0501310_001315 | 3300049130 | Bacteria | 2236 |
| 164 | Ga0501310_003146 | 3300049130 | Bacteria | 1605 |
| 165 | Ga0501304_000312 | 3300049160 | Bacteria | 2329 |
| 166 | Ga0501305_002286 | 3300049161 | Bacteria | 2044 |
| 167 | Ga0501305_006141 | 3300049161 | Bacteria | 1482 |
| 168 | Ga0501305_011468 | 3300049161 | Bacteria | 1198 |
| 169 | Ga0501307_000311 | 3300049162 | Bacteria | 3032 |
| 170 | Ga0501307_000849 | 3300049162 | Bacteria | 2333 |
| 171 | Ga0501307_007393 | 3300049162 | Bacteria | 1210 |
| 172 | Ga0501311_028137 | 3300049527 | Bacteria | 801 |
| 173 | Ga0501312_001574 | 3300049528 | Bacteria | 2277 |
| 174 | Ga0501312_001811 | 3300049528 | Bacteria | 2194 |
| 175 | Ga0501312_006953 | 3300049528 | Bacteria | 1429 |
| 176 | Ga0501312_015404 | 3300049528 | Bacteria | 1084 |
| 177 | Ga0501313_000962 | 3300049529 | Bacteria | 2282 |
| 178 | Ga0501315_001052 | 3300049531 | Bacteria | 2214 |
| 179 | Ga0501315_003624 | 3300049531 | Bacteria | 1557 |
| 180 | Ga0501316_001063 | 3300049532 | Bacteria | 2214 |
| 181 | Ga0501316_039431 | 3300049532 | Bacteria | 655 |
| 182 | Ga0501317_001012 | 3300049533 | Bacteria | 2282 |
| 183 | Ga0501317_001377 | 3300049533 | Bacteria | 2090 |
| 184 | Ga0501320_005075 | 3300049536 | Bacteria | 1186 |
| 185 | Ga0501323_001214 | 3300049539 | Bacteria | 2216 |
| 186 | Ga0501323_001344 | 3300049539 | Bacteria | 2153 |
| 187 | Ga0501335_018507 | 3300049551 | Unclassified | 730 |
| 188 | Ga0501340_003465 | 3300049556 | Bacteria | 958 |
| 189 | Ga0501032_0375687 | 3300049569 | Bacteria | 914 |
| 190 | Ga0501198_012021 | 3300049649 | Bacteria | 1297 |
| 191 | Ga0501207_023748 | 3300049654 | Bacteria | 997 |
| 192 | Ga0501217_019788 | 3300049661 | Bacteria | 1575 |
| 193 | Ga0501217_091876 | 3300049661 | Bacteria | 853 |
| 194 | Ga0501222_007248 | 3300049662 | Bacteria | 1481 |
| 195 | Ga0501223_003765 | 3300049663 | Bacteria | 3276 |
| 196 | Ga0501242_023640 | 3300049674 | Bacteria | 803 |
| 197 | Ga0501257_003554 | 3300049686 | Bacteria | 3354 |
| 198 | Ga0501257_010822 | 3300049686 | Bacteria | 2075 |
| 199 | Ga0501257_034459 | 3300049686 | Bacteria | 1229 |
| 200 | Ga0501259_006914 | 3300049688 | Bacteria | 1810 |
| 201 | Ga0501241_000113 | 3300049758 | Bacteria | 17544 |
| 202 | Ga0501264_000532 | 3300049761 | Bacteria | 5587 |
| 203 | nmdc:mga0k408_111057_c1 | 3300050493 | Bacteria | 1620 |
| 204 | nmdc:mga0k408_296364_c1 | 3300050493 | Bacteria | 965 |
| 205 | nmdc:mga08y16_10401_c1 | 3300050511 | Bacteria | 9761 |
| 206 | Ga0500578_0263911 | 3300053086 | Bacteria | 1033 |
| 207 | Ga0500644_0037696 | 3300053088 | Bacteria | 1582 |
| 208 | Ga0500556_0011703 | 3300053104 | Bacteria | 2603 |
| 209 | Ga0500562_021611 | 3300053108 | Bacteria | 1676 |
| 210 | Ga0500562_046999 | 3300053108 | Bacteria | 1151 |
| 211 | Ga0500652_076474 | 3300053131 | Bacteria | 1392 |
| 212 | Ga0500655_013596 | 3300053133 | Bacteria | 1486 |
| 213 | Ga0500604_0048634 | 3300053151 | Bacteria | 1302 |
| 214 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 215 | Ga0500616_0044405 | 3300053153 | Bacteria | 2371 |
| 216 | Ga0500622_0000113 | 3300053156 | Bacteria | 83196 |
| 217 | Ga0500622_0000133 | 3300053156 | Bacteria | 78532 |
| 218 | Ga0500622_0007455 | 3300053156 | Bacteria | 6212 |
| 219 | Ga0587077_044862 | 3300059493 | Bacteria | 902 |
| 220 | Ga0587101_016841 | 3300059623 | Bacteria | 1006 |
| 221 | Ga0587068_002145 | 3300059641 | Bacteria | 2359 |
| 222 | Ga0587068_006340 | 3300059641 | Bacteria | 1653 |
| 223 | Ga0587068_006852 | 3300059641 | Bacteria | 1608 |
| 224 | Ga0587076_007530 | 3300059645 | Bacteria | 1490 |
| 225 | Ga0587079_000249 | 3300059647 | Bacteria | 4161 |
| 226 | 2884637382 | 2884634485 | Bacteria | 3928637 |
| 227 | 2890807163 | 2890804823 | Bacteria | 3717572 |
| 228 | 2910249760 | 2910245624 | Bacteria | 6935613 |
| 229 | 2919697453 | 2919692658 | Bacteria | 5943958 |
| 230 | Ga0068855_100867665 | |||
| 231 | JGI24740J21852_10008519 | |||
| 232 | rootH1_10010612 | |||
| 233 | rootH2_10003970 | |||
| 234 | rootH2_10173412 | |||
| 235 | rootL2_10010167 | |||
| 236 | rootL2_10011247 | |||
| 237 | rootL2_10015593 | |||
| 238 | rootH1_10009782 | |||
| 239 | rootH1_10012094 | |||
| 240 | rootH1_10108515 | |||
| 241 | rootH1_10109910 | |||
| 242 | Ga0007417J51691_1063811 | |||
| 243 | Ga0055531_10000409 | |||
| 244 | Ga0058860_12155377 | |||
| 245 | Ga0065165_1000831 | |||
| 246 | Ga0065165_1059034 | |||
| 247 | Ga0065714_10007641 | |||
| 248 | Ga0070682_100678995 | |||
| 249 | Ga0070668_100181543 | |||
| 250 | Ga0070688_100041186 | |||
| 251 | Ga0070714_100091865 | |||
| 252 | Ga0070713_101169406 | |||
| 253 | Ga0070678_100351006 | |||
| 254 | Ga0068855_100289382 | |||
| 255 | Ga0068857_100236793 | |||
| 256 | Ga0068856_100031219 | |||
| 257 | Ga0068856_100077827 | |||
| 258 | Ga0068852_101439434 | |||
| 259 | Ga0068864_100677165 | |||
| 260 | Ga0068863_100436656 | |||
| 261 | Ga0070715_10085294 | |||
| 262 | Ga0070716_100039818 | |||
| 263 | Ga0075370_10341066 | |||
| 264 | Ga0075428_100013576 | |||
| 265 | Ga0075428_100182361 | |||
| 266 | Ga0075430_100076161 | |||
| 267 | Ga0075431_100328003 | |||
| 268 | Ga0111539_10013971 | |||
| 269 | Ga0111539_10015243 | |||
| 270 | Ga0105242_10103549 | |||
| 271 | Ga0105242_10639314 | |||
| 272 | Ga0105249_11637997 | |||
| 273 | Ga0157371_10054786 | |||
| 274 | Ga0157370_10145310 | |||
| 275 | Ga0157372_10000332 | |||
| 276 | Ga0157372_10965536 | |||
| 277 | Ga0157380_10000051 | |||
| 278 | Ga0157380_10006042 | |||
| 279 | Ga0157376_10670759 | |||
| 280 | Ga0206356_10873539 | |||
| 281 | Ga0209050_1005534 | |||
| 282 | Ga0209050_1049461 | |||
| 283 | Ga0209257_1000007 | |||
| 284 | Ga0209257_1024055 | |||
| 285 | Ga0207685_10046839 | |||
| 286 | Ga0207695_10634758 | |||
| 287 | Ga0207687_10089938 | |||
| 288 | Ga0207686_10198597 | |||
| 289 | Ga0207665_10050775 | |||
| 290 | Ga0207667_10182531 | |||
| 291 | Ga0207667_10189183 | |||
| 292 | Ga0207667_10939292 | |||
| 293 | Ga0207639_10470787 | |||
| 294 | Ga0207678_10258902 | |||
| 295 | Ga0207702_10023144 | |||
| 296 | Ga0207641_10450750 | |||
| 297 | Ga0207676_10567325 | |||
| 298 | Ga0207676_10896913 | |||
| 299 | Ga0207674_10145777 | |||
| 300 | Ga0207683_10772674 | |||
| 301 | Ga0209995_1030097 | |||
| 302 | Ga0209974_10056787 | |||
| 303 | Ga0207428_10076578 | |||
| 304 | Ga0207428_10313406 | |||
| 305 | Ga0265334_10018191 | |||
| 306 | Ga0265323_10000040 | |||
| 307 | Ga0307515_10000009 | |||
| 308 | Ga0307515_10536201 | |||
| 309 | Ga0265338_10001162 | |||
| 310 | Ga0265338_10001855 | |||
| 311 | Ga0265338_10143556 | |||
| 312 | Ga0265324_10056854 | |||
| 313 | Ga0265327_10000370 | |||
| 314 | Ga0265327_10127644 | |||
| 315 | Ga0265316_10000486 | |||
| 316 | Ga0307513_10127710 | |||
| 317 | Ga0307509_10007469 | |||
| 318 | Ga0307509_10165518 | |||
| 319 | Ga0307408_100000648 | |||
| 320 | Ga0307408_100038382 | |||
| 321 | Ga0307514_10127372 | |||
| 322 | Ga0316576_10021298 | |||
| 323 | Ga0316578_10015477 | |||
| 324 | Ga0307516_10090261 | |||
| 325 | Ga0307413_10081698 | |||
| 326 | Ga0307410_10788448 | |||
| 327 | Ga0307412_10010885 | |||
| 328 | Ga0307412_10276740 | |||
| 329 | Ga0307409_100054022 | |||
| 330 | Ga0307416_100000249 | |||
| 331 | Ga0307414_10010589 | |||
| 332 | Ga0307411_10133368 | |||
| 333 | Ga0307415_100035567 | |||
| 334 | Ga0307415_100840353 | |||
| 335 | Ga0316596_1000052 | |||
| 336 | Ga0316596_1006083 | |||
| 337 | Ga0373931_0139815 | |||
| 338 | Ga0373927_0006959 | |||
| 339 | Ga0373937_1032720 | |||
| 340 | Ga0316582_0115197 | |||
| 341 | Ga0316584_0001842 | |||
| 342 | Ga0316584_0028755 | |||
| 343 | Ga0395899_0000673 | |||
| 344 | Ga0395900_0541447 | |||
| 345 | Ga0395905_0000001 | |||
| 346 | Ga0395905_0000376 | |||
| 347 | Ga0395905_0308049 | |||
| 348 | Ga0395901_0002865 | |||
| 349 | Ga0400488_36638 | |||
| 350 | Ga0451799_02770 | |||
| 351 | Ga0451801_20542 | |||
| 352 | Ga0451795_0578569 | |||
| 353 | Ga0451795_1060327 | |||
| 354 | Ga0451798_0296397 | |||
| 355 | Ga0451802_1246725 | |||
| 356 | Ga0451805_091713 | |||
| 357 | Ga0451808_16930 | |||
| 358 | Ga0451837_1468151 | |||
| 359 | Ga0452271_55409 | |||
| 360 | Ga0439460_0002577 | |||
| 361 | Ga0451577_0058001 | |||
| 362 | Ga0451577_0092287 | |||
| 363 | Ga0453683_0041549 | |||
| 364 | Ga0453683_0130278 | |||
| 365 | Ga0453684_0001121 | |||
| 366 | Ga0453684_0001193 | |||
| 367 | Ga0453684_0005611 | |||
| 368 | Ga0453684_0007136 | |||
| 369 | Ga0453684_0012498 | |||
| 370 | Ga0453684_0092022 | |||
| 371 | Ga0453684_0164783 | |||
| 372 | Ga0453684_0315852 | |||
| 373 | Ga0453684_0414653 | |||
| 374 | Ga0453684_0422724 | |||
| 375 | Ga0453684_0777061 | |||
| 376 | Ga0453684_1397031 | |||
| 377 | Ga0451576_0000003 | |||
| 378 | Ga0451576_0010522 | |||
| 379 | Ga0451576_0018019 | |||
| 380 | Ga0451576_0051376 | |||
| 381 | Ga0451576_0063555 | |||
| 382 | Ga0451576_0275888 | |||
| 383 | Ga0451576_0409141 | |||
| 384 | Ga0495638_0000040 | |||
| 385 | Ga0495625_0247105 | |||
| 386 | Ga0501306_000385 | |||
| 387 | Ga0501306_025537 | |||
| 388 | Ga0501308_000775 | |||
| 389 | Ga0501309_001746 | |||
| 390 | Ga0501309_004788 | |||
| 391 | Ga0501309_058333 | |||
| 392 | Ga0501310_001315 | |||
| 393 | Ga0501310_003146 | |||
| 394 | Ga0501304_000312 | |||
| 395 | Ga0501305_002286 | |||
| 396 | Ga0501305_006141 | |||
| 397 | Ga0501305_011468 | |||
| 398 | Ga0501307_000311 | |||
| 399 | Ga0501307_000849 | |||
| 400 | Ga0501307_007393 | |||
| 401 | Ga0501311_028137 | |||
| 402 | Ga0501312_001574 | |||
| 403 | Ga0501312_001811 | |||
| 404 | Ga0501312_006953 | |||
| 405 | Ga0501312_015404 | |||
| 406 | Ga0501313_000962 | |||
| 407 | Ga0501315_001052 | |||
| 408 | Ga0501315_003624 | |||
| 409 | Ga0501316_001063 | |||
| 410 | Ga0501316_039431 | |||
| 411 | Ga0501317_001012 | |||
| 412 | Ga0501317_001377 | |||
| 413 | Ga0501320_005075 | |||
| 414 | Ga0501323_001214 | |||
| 415 | Ga0501323_001344 | |||
| 416 | Ga0501335_018507 | |||
| 417 | Ga0501340_003465 | |||
| 418 | Ga0501032_0375687 | |||
| 419 | Ga0501198_012021 | |||
| 420 | Ga0501207_023748 | |||
| 421 | Ga0501217_019788 | |||
| 422 | Ga0501217_091876 | |||
| 423 | Ga0501222_007248 | |||
| 424 | Ga0501223_003765 | |||
| 425 | Ga0501242_023640 | |||
| 426 | Ga0501257_003554 | |||
| 427 | Ga0501257_010822 | |||
| 428 | Ga0501257_034459 | |||
| 429 | Ga0501259_006914 | |||
| 430 | Ga0501241_000113 | |||
| 431 | Ga0501264_000532 | |||
| 432 | nmdc:mga0k408_111057_c1 | |||
| 433 | nmdc:mga0k408_296364_c1 | |||
| 434 | nmdc:mga08y16_10401_c1 | |||
| 435 | Ga0500578_0263911 | |||
| 436 | Ga0500644_0037696 | |||
| 437 | Ga0500556_0011703 | |||
| 438 | Ga0500562_021611 | |||
| 439 | Ga0500562_046999 | |||
| 440 | Ga0500652_076474 | |||
| 441 | Ga0500655_013596 | |||
| 442 | Ga0500604_0048634 | |||
| 443 | Ga0500616_0000013 | |||
| 444 | Ga0500616_0044405 | |||
| 445 | Ga0500622_0000113 | |||
| 446 | Ga0500622_0000133 | |||
| 447 | Ga0500622_0007455 | |||
| 448 | Ga0587077_044862 | |||
| 449 | Ga0587101_016841 | |||
| 450 | Ga0587068_002145 | |||
| 451 | Ga0587068_006340 | |||
| 452 | Ga0587068_006852 | |||
| 453 | Ga0587076_007530 | |||
| 454 | Ga0587079_000249 | |||
| 455 | 2884637382 | |||
| 456 | 2890807163 | |||
| 457 | 2910249760 | |||
| 458 | 2919697453 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9201 | 10 | 208 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9112 | 1 | 208 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9025 | 10 | 208 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8997 | 1 | 208 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8974 | 3 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8167 | 1 | 208 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8075 | 1 | 208 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7737 | 1 | 207 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7648 | 1 | 207 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7474 | 1 | 210 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645EVZ5-F1-model_v4 | 50S ribosomal protein L4 | 0.96 | 101 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A645EVZ5-F1-model_v4 | 50S ribosomal protein L4 | 0.9429 | 101 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2N0BF71-F1-model_v4 | deleted | 0.9253 | 91 | 210 |
|
| AF-A0A7S2Z7X8-F1-model_v4 | 50S ribosomal protein L4 | 0.909 | 112 | 210 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A538BFE4-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9075 | 101 | 210 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |