F341841

General Info

Members Datasets Scaffolds Average Seq Length
229 146 458 372

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100211044|Ga0068852_1002110442
Length 400
Sequence VVTRFQILVDKFLKLNLKKNINRHRMKNILFFFTLTAFAFTSSTGQKVNISGTMHFSKPVQMVYLTFRSGDERITDSTKLNNEKFHFTEKISEPTFASLMVRFAPNAEEQRPHIERTELFIEPGTMNITVKDSLTLAKISGSKSQKAFEALGKLEKPFNEKEEALGMQYRQYYTSKDTAGMKNVEEEFDKISKEKDEKVYRQYLTQNPNSPIGLYVLEQYAGYDIDANRVESLFKKLSVANRNLPSGIAFKKRIETAKKTGIGAYAMNFTQNDTLEKPVSLSDFKGKYVLLDFWASWCGPCRAENPNVVKAFNNYKDKNFTVLSVSLDRPGKKQSWLDAIHKDGLAWTHVSDLKFWDNAVAKEYGIRAIPQNLLLDPSGKIIAKNIRGEELEKKLDEVIK

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
141 2818991444 Filimonas endophytica 3197 Isolate Unclassified
142 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
143 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
144 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
145 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
146 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.41
Nodule 0
Rhizoplane 0
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100211044 3300005616 Bacteria 1842
2 JGI24740J21852_10001160 3300001979 Bacteria 11892
3 JGI24740J21852_10002002 3300001979 Bacteria 9308
4 JGI24739J22299_10042016 3300001989 Bacteria 1518
5 JGI25154J39366_1000004 3300002738 Bacteria 346460
6 JGI25154J39366_1000040 3300002738 Bacteria 147410
7 JGI25157J39369_1002238 3300002741 Bacteria 5236
8 JGI25152J39213_1000354 3300002773 Bacteria 28590
9 JGI25150J39212_1000015 3300002774 Bacteria 170613
10 JGI25151J46595_10000043 3300003187 Bacteria 170613
11 JGI25153J46596_10000009 3300003215 Bacteria 340925
12 JGI25153J46596_10003586 3300003215 Bacteria 8623
13 JGI25153J46596_10012869 3300003215 Bacteria 3577
14 rootH2_10057836 3300003320 Bacteria 7156
15 rootL2_10236002 3300003322 Bacteria 2641
16 rootH1_10106644 3300003323 Bacteria 2514
17 JGI25160J50197_1001911 3300003354 Bacteria 9971
18 Ga0055528_1000188 3300003790 Bacteria 52620
19 Ga0055543_1009834 3300004625 Bacteria 2034
20 Ga0065165_1000128 3300005262 Bacteria 129513
21 Ga0070658_10015651 3300005327 Bacteria 6066
22 Ga0070658_10039081 3300005327 Bacteria 3827
23 Ga0070658_10043595 3300005327 Bacteria 3623
24 Ga0070658_10113969 3300005327 Bacteria 2242
25 Ga0068868_100003763 3300005338 Bacteria 10599
26 Ga0070660_100024034 3300005339 Bacteria 4520
27 Ga0070660_100176904 3300005339 Bacteria 1726
28 Ga0070687_100002476 3300005343 Bacteria 6945
29 Ga0070669_100301353 3300005353 Bacteria 1289
30 Ga0070659_100120646 3300005366 Bacteria 2123
31 Ga0070667_100001495 3300005367 Bacteria 20929
32 Ga0070681_10005928 3300005458 Bacteria 11826
33 Ga0068867_100079889 3300005459 Bacteria 2462
34 Ga0070685_10100096 3300005466 Unclassified 1769
35 Ga0070679_100266029 3300005530 Bacteria 1669
36 Ga0068853_100287745 3300005539 Unclassified 1516
37 Ga0070672_100078546 3300005543 Bacteria 2641
38 Ga0070686_100001497 3300005544 Bacteria 13135
39 Ga0068855_100005029 3300005563 Bacteria 16134
40 Ga0068855_100013706 3300005563 Bacteria 9774
41 Ga0068855_100375354 3300005563 Bacteria 1562
42 Ga0070664_100055417 3300005564 Bacteria 3365
43 Ga0070664_100289832 3300005564 Bacteria 1478
44 Ga0068857_100341554 3300005577 Unclassified 1385
45 Ga0068856_100000040 3300005614 Bacteria 114443
46 Ga0068856_100050360 3300005614 Bacteria 4106
47 Ga0068856_100128878 3300005614 Bacteria 2534
48 Ga0068852_100000503 3300005616 Bacteria 25688
49 Ga0068852_100032747 3300005616 Bacteria 4307
50 Ga0068852_100226249 3300005616 Bacteria 1781
51 Ga0068859_100019177 3300005617 Bacteria 6871
52 Ga0068864_100051507 3300005618 Bacteria 3547
53 Ga0068864_100128808 3300005618 Bacteria 2271
54 Ga0068851_10025605 3300005834 Bacteria 2895
55 Ga0068860_100015760 3300005843 Bacteria 7379
56 Ga0068860_100031182 3300005843 Bacteria 5126
57 Ga0068860_100227912 3300005843 Bacteria 1810
58 Ga0097621_100129111 3300006237 Bacteria 2150
59 Ga0097620_100019177 3300006931 Bacteria 6871
60 Ga0105240_10003052 3300009093 Bacteria 26340
61 Ga0105247_10003751 3300009101 Bacteria 9849
62 Ga0105237_10042464 3300009545 Bacteria 4585
63 Ga0105238_10448761 3300009551 Bacteria 1287
64 Ga0105249_10042643 3300009553 Bacteria 4128
65 Ga0105239_10007067 3300010375 Bacteria 12921
66 Ga0105239_10104987 3300010375 Bacteria 3128
67 Ga0157373_10011876 3300013100 Bacteria 6399
68 Ga0157373_10023643 3300013100 Bacteria 4454
69 Ga0157371_10004218 3300013102 Bacteria 12643
70 Ga0157371_10008547 3300013102 Bacteria 8147
71 Ga0157371_10064281 3300013102 Bacteria 2600
72 Ga0157370_10031698 3300013104 Bacteria 5169
73 Ga0157370_10064690 3300013104 Bacteria 3462
74 Ga0157370_10095093 3300013104 Bacteria 2795
75 Ga0157370_10112114 3300013104 Bacteria 2549
76 Ga0157369_10041629 3300013105 Bacteria 5013
77 Ga0157374_10004326 3300013296 Bacteria 11944
78 Ga0157374_10070997 3300013296 Bacteria 3282
79 Ga0157374_10113797 3300013296 Bacteria 2604
80 Ga0157374_10124152 3300013296 Bacteria 2494
81 Ga0157374_10135021 3300013296 Bacteria 2391
82 Ga0157374_10219903 3300013296 Bacteria 1864
83 Ga0157378_10011779 3300013297 Bacteria 7656
84 Ga0163162_10000135 3300013306 Bacteria 67187
85 Ga0163162_10038733 3300013306 Bacteria 4758
86 Ga0163162_10091670 3300013306 Bacteria 3122
87 Ga0163162_10091884 3300013306 Bacteria 3118
88 Ga0157372_10006598 3300013307 Bacteria 12350
89 Ga0157372_10008424 3300013307 Bacteria 10946
90 Ga0157372_10220268 3300013307 Bacteria 2200
91 Ga0157372_10231997 3300013307 Bacteria 2140
92 Ga0157372_10323926 3300013307 Bacteria 1794
93 Ga0157372_10672305 3300013307 Bacteria 1205
94 Ga0157375_10120074 3300013308 Bacteria 2737
95 Ga0157377_10011426 3300014745 Bacteria 4432
96 Ga0157379_10140029 3300014968 Bacteria 2181
97 Ga0157379_10154893 3300014968 Unclassified 2067
98 Ga0157376_10232643 3300014969 Bacteria 1713
99 Ga0183373_1001 3300015682 Bacteria 1410374
100 Ga0163161_10033225 3300017792 Bacteria 3687
101 Ga0163161_10083773 3300017792 Bacteria 2351
102 Ga0207425_1000023 3300025245 Bacteria 341339
103 Ga0209646_1000002 3300025246 Bacteria 1425781
104 Ga0209646_1000025 3300025246 Bacteria 406493
105 Ga0209646_1000592 3300025246 Bacteria 14619
106 Ga0209026_1001049 3300025250 Bacteria 13468
107 Ga0209026_1003408 3300025250 Bacteria 5229
108 Ga0209129_1000032 3300025258 Bacteria 341150
109 Ga0209233_1001300 3300025261 Bacteria 9976
110 Ga0209673_1000085 3300025273 Bacteria 215647
111 Ga0209025_1000047 3300025294 Bacteria 341150
112 Ga0209564_1003184 3300025295 Bacteria 11529
113 Ga0209564_1003858 3300025295 Bacteria 9662
114 Ga0209758_1000144 3300025297 Bacteria 170724
115 Ga0209758_1006138 3300025297 Bacteria 8805
116 Ga0209758_1012620 3300025297 Bacteria 4707
117 Ga0209758_1019904 3300025297 Bacteria 3207
118 Ga0209758_1043214 3300025297 Bacteria 1662
119 Ga0209050_1000524 3300025298 Bacteria 63793
120 Ga0207426_1000261 3300025302 Bacteria 112697
121 Ga0207426_1000497 3300025302 Bacteria 58506
122 Ga0209257_1002463 3300025304 Bacteria 18318
123 Ga0207710_10003162 3300025900 Bacteria 7372
124 Ga0207647_10000050 3300025904 Bacteria 88099
125 Ga0207705_10004284 3300025909 Bacteria 10799
126 Ga0207705_10011714 3300025909 Bacteria 6336
127 Ga0207707_10012266 3300025912 Bacteria 7450
128 Ga0207695_10001067 3300025913 Bacteria 47991
129 Ga0207671_10004618 3300025914 Bacteria 13067
130 Ga0207671_10005166 3300025914 Bacteria 12140
131 Ga0207657_10061313 3300025919 Bacteria 3226
132 Ga0207652_10001022 3300025921 Bacteria 25679
133 Ga0207652_10311787 3300025921 Bacteria 1420
134 Ga0207650_10004698 3300025925 Bacteria 9334
135 Ga0207644_10038001 3300025931 Bacteria 3389
136 Ga0207690_10004462 3300025932 Bacteria 8262
137 Ga0207690_10155285 3300025932 Bacteria 1700
138 Ga0207706_10089815 3300025933 Bacteria 2701
139 Ga0207669_10199257 3300025937 Bacteria 1452
140 Ga0207691_10044329 3300025940 Bacteria 4095
141 Ga0207689_10073161 3300025942 Bacteria 2816
142 Ga0207661_10060669 3300025944 Bacteria 3053
143 Ga0207661_10229707 3300025944 Bacteria 1643
144 Ga0207679_10009396 3300025945 Bacteria 6263
145 Ga0207667_10001800 3300025949 Bacteria 27004
146 Ga0207667_10015713 3300025949 Bacteria 8585
147 Ga0207651_10030066 3300025960 Bacteria 3453
148 Ga0207658_10010395 3300025986 Bacteria 6322
149 Ga0207677_10011953 3300026023 Bacteria 4971
150 Ga0207677_10141477 3300026023 Bacteria 1842
151 Ga0207703_10374805 3300026035 Bacteria 1315
152 Ga0207678_10029748 3300026067 Bacteria 4769
153 Ga0207678_10156524 3300026067 Bacteria 1946
154 Ga0207702_10001166 3300026078 Bacteria 26828
155 Ga0207702_10116873 3300026078 Bacteria 2381
156 Ga0207641_10040651 3300026088 Bacteria 3894
157 Ga0207676_10070458 3300026095 Bacteria 2804
158 Ga0207675_100224372 3300026118 Bacteria 1811
159 Ga0207675_100248100 3300026118 Bacteria 1722
160 Ga0207683_10135738 3300026121 Bacteria 2215
161 Ga0207698_10001142 3300026142 Bacteria 15449
162 Ga0207698_10201898 3300026142 Bacteria 1781
163 Ga0268264_10021838 3300028381 Bacteria 5224
164 Ga0268264_10023379 3300028381 Bacteria 5043
165 Ga0307515_10000455 3300028794 Bacteria 97670
166 Ga0265338_10080755 3300028800 Bacteria 2731
167 Ga0265327_10000142 3300031251 Bacteria 157436
168 Ga0265327_10000249 3300031251 Bacteria 107164
169 Ga0307408_100000889 3300031548 Bacteria 23506
170 Ga0307508_10159453 3300031616 Bacteria 1860
171 Ga0395899_0000027 3300037312 Bacteria 337387
172 Ga0395899_0020482 3300037312 Bacteria 5013
173 Ga0395899_0046613 3300037312 Bacteria 3229
174 Ga0395899_0081282 3300037312 Bacteria 2358
175 Ga0395900_0008136 3300037418 Bacteria 10796
176 Ga0395900_0019128 3300037418 Bacteria 6984
177 Ga0395900_0058529 3300037418 Bacteria 3967
178 Ga0395900_0068037 3300037418 Bacteria 3660
179 Ga0395900_0133783 3300037418 Bacteria 2540
180 Ga0395898_0055604 3300037466 Bacteria 3860
181 Ga0395898_0068906 3300037466 Bacteria 3423
182 Ga0395898_0082543 3300037466 Bacteria 3098
183 Ga0395898_0154876 3300037466 Bacteria 2192
184 Ga0439439_0035216 3300041406 Bacteria 1286
185 Ga0439457_007838 3300042014 Bacteria 2544
186 Ga0466969_0000194 3300044656 Bacteria 32715
187 Ga0466972_0115338 3300044658 Bacteria 1268
188 Ga0453684_0106572 3300044712 Bacteria 3415
189 Ga0466968_0006024 3300044735 Bacteria 4550
190 Ga0466957_0004767 3300044842 Bacteria 7591
191 Ga0466957_0073628 3300044842 Bacteria 2117
192 Ga0466957_0159157 3300044842 Bacteria 1466
193 Ga0466959_0000013 3300045049 Bacteria 157000
194 Ga0466959_0119700 3300045049 Bacteria 1873
195 Ga0495638_0140224 3300046460 Bacteria 1412
196 Ga0495610_0000060 3300046512 Bacteria 131116
197 Ga0495625_0037515 3300046660 Bacteria 3556
198 Ga0495672_0023030 3300047320 Bacteria 4038
199 Ga0501034_0265646 3300049571 Bacteria 1658
200 Ga0501036_0068072 3300049572 Bacteria 3013
201 Ga0501037_0025065 3300049573 Bacteria 4408
202 Ga0501037_0065379 3300049573 Bacteria 2650
203 Ga0501043_0009641 3300049579 Bacteria 7569
204 Ga0501046_0018965 3300049580 Bacteria 5710
205 Ga0501047_0016305 3300049581 Bacteria 7088
206 Ga0501047_0052811 3300049581 Bacteria 3929
207 Ga0501067_0170249 3300049583 Bacteria 1213
208 Ga0501070_0146605 3300049586 Bacteria 1948
209 Ga0501073_0011731 3300049589 Bacteria 6398
210 Ga0501074_0026792 3300049590 Bacteria 4179
211 Ga0501080_0039602 3300049742 Bacteria 4398
212 Ga0501035_0086065 3300049822 Bacteria 2770
213 Ga0501044_0103981 3300049823 Bacteria 2854
214 Ga0501044_0261404 3300049823 Bacteria 1669
215 Ga0500562_000027 3300053108 Bacteria 100118
216 Ga0500562_000029 3300053108 Bacteria 94705
217 Ga0500562_000044 3300053108 Bacteria 65482
218 Ga0500652_011528 3300053131 Bacteria 3066
219 Ga0500616_0021738 3300053153 Bacteria 3591
220 Ga0500622_0001233 3300053156 Bacteria 20977
221 Ga0500611_000005 3300053727 Bacteria 228837
222 2819589428 2818991444 Bacteria 6968812
223 2884792862 2884791551 Bacteria 8511252
224 2919190701 2919186247 Bacteria 6244071
225 2929923251 2929921140 Bacteria 8649150
226 2929927446 2929921140 Bacteria 8649150
227 2939669089 2939664404 Bacteria 6364494
228 8003151299 8003151029 Bacteria 8187759
229 8003152123 8003151029 Bacteria 8187759
230 Ga0068852_100211044
231 JGI24740J21852_10001160
232 JGI24740J21852_10002002
233 JGI24739J22299_10042016
234 JGI25154J39366_1000004
235 JGI25154J39366_1000040
236 JGI25157J39369_1002238
237 JGI25152J39213_1000354
238 JGI25150J39212_1000015
239 JGI25151J46595_10000043
240 JGI25153J46596_10000009
241 JGI25153J46596_10003586
242 JGI25153J46596_10012869
243 rootH2_10057836
244 rootL2_10236002
245 rootH1_10106644
246 JGI25160J50197_1001911
247 Ga0055528_1000188
248 Ga0055543_1009834
249 Ga0065165_1000128
250 Ga0070658_10015651
251 Ga0070658_10039081
252 Ga0070658_10043595
253 Ga0070658_10113969
254 Ga0068868_100003763
255 Ga0070660_100024034
256 Ga0070660_100176904
257 Ga0070687_100002476
258 Ga0070669_100301353
259 Ga0070659_100120646
260 Ga0070667_100001495
261 Ga0070681_10005928
262 Ga0068867_100079889
263 Ga0070685_10100096
264 Ga0070679_100266029
265 Ga0068853_100287745
266 Ga0070672_100078546
267 Ga0070686_100001497
268 Ga0068855_100005029
269 Ga0068855_100013706
270 Ga0068855_100375354
271 Ga0070664_100055417
272 Ga0070664_100289832
273 Ga0068857_100341554
274 Ga0068856_100000040
275 Ga0068856_100050360
276 Ga0068856_100128878
277 Ga0068852_100000503
278 Ga0068852_100032747
279 Ga0068852_100226249
280 Ga0068859_100019177
281 Ga0068864_100051507
282 Ga0068864_100128808
283 Ga0068851_10025605
284 Ga0068860_100015760
285 Ga0068860_100031182
286 Ga0068860_100227912
287 Ga0097621_100129111
288 Ga0097620_100019177
289 Ga0105240_10003052
290 Ga0105247_10003751
291 Ga0105237_10042464
292 Ga0105238_10448761
293 Ga0105249_10042643
294 Ga0105239_10007067
295 Ga0105239_10104987
296 Ga0157373_10011876
297 Ga0157373_10023643
298 Ga0157371_10004218
299 Ga0157371_10008547
300 Ga0157371_10064281
301 Ga0157370_10031698
302 Ga0157370_10064690
303 Ga0157370_10095093
304 Ga0157370_10112114
305 Ga0157369_10041629
306 Ga0157374_10004326
307 Ga0157374_10070997
308 Ga0157374_10113797
309 Ga0157374_10124152
310 Ga0157374_10135021
311 Ga0157374_10219903
312 Ga0157378_10011779
313 Ga0163162_10000135
314 Ga0163162_10038733
315 Ga0163162_10091670
316 Ga0163162_10091884
317 Ga0157372_10006598
318 Ga0157372_10008424
319 Ga0157372_10220268
320 Ga0157372_10231997
321 Ga0157372_10323926
322 Ga0157372_10672305
323 Ga0157375_10120074
324 Ga0157377_10011426
325 Ga0157379_10140029
326 Ga0157379_10154893
327 Ga0157376_10232643
328 Ga0183373_1001
329 Ga0163161_10033225
330 Ga0163161_10083773
331 Ga0207425_1000023
332 Ga0209646_1000002
333 Ga0209646_1000025
334 Ga0209646_1000592
335 Ga0209026_1001049
336 Ga0209026_1003408
337 Ga0209129_1000032
338 Ga0209233_1001300
339 Ga0209673_1000085
340 Ga0209025_1000047
341 Ga0209564_1003184
342 Ga0209564_1003858
343 Ga0209758_1000144
344 Ga0209758_1006138
345 Ga0209758_1012620
346 Ga0209758_1019904
347 Ga0209758_1043214
348 Ga0209050_1000524
349 Ga0207426_1000261
350 Ga0207426_1000497
351 Ga0209257_1002463
352 Ga0207710_10003162
353 Ga0207647_10000050
354 Ga0207705_10004284
355 Ga0207705_10011714
356 Ga0207707_10012266
357 Ga0207695_10001067
358 Ga0207671_10004618
359 Ga0207671_10005166
360 Ga0207657_10061313
361 Ga0207652_10001022
362 Ga0207652_10311787
363 Ga0207650_10004698
364 Ga0207644_10038001
365 Ga0207690_10004462
366 Ga0207690_10155285
367 Ga0207706_10089815
368 Ga0207669_10199257
369 Ga0207691_10044329
370 Ga0207689_10073161
371 Ga0207661_10060669
372 Ga0207661_10229707
373 Ga0207679_10009396
374 Ga0207667_10001800
375 Ga0207667_10015713
376 Ga0207651_10030066
377 Ga0207658_10010395
378 Ga0207677_10011953
379 Ga0207677_10141477
380 Ga0207703_10374805
381 Ga0207678_10029748
382 Ga0207678_10156524
383 Ga0207702_10001166
384 Ga0207702_10116873
385 Ga0207641_10040651
386 Ga0207676_10070458
387 Ga0207675_100224372
388 Ga0207675_100248100
389 Ga0207683_10135738
390 Ga0207698_10001142
391 Ga0207698_10201898
392 Ga0268264_10021838
393 Ga0268264_10023379
394 Ga0307515_10000455
395 Ga0265338_10080755
396 Ga0265327_10000142
397 Ga0265327_10000249
398 Ga0307408_100000889
399 Ga0307508_10159453
400 Ga0395899_0000027
401 Ga0395899_0020482
402 Ga0395899_0046613
403 Ga0395899_0081282
404 Ga0395900_0008136
405 Ga0395900_0019128
406 Ga0395900_0058529
407 Ga0395900_0068037
408 Ga0395900_0133783
409 Ga0395898_0055604
410 Ga0395898_0068906
411 Ga0395898_0082543
412 Ga0395898_0154876
413 Ga0439439_0035216
414 Ga0439457_007838
415 Ga0466969_0000194
416 Ga0466972_0115338
417 Ga0453684_0106572
418 Ga0466968_0006024
419 Ga0466957_0004767
420 Ga0466957_0073628
421 Ga0466957_0159157
422 Ga0466959_0000013
423 Ga0466959_0119700
424 Ga0495638_0140224
425 Ga0495610_0000060
426 Ga0495625_0037515
427 Ga0495672_0023030
428 Ga0501034_0265646
429 Ga0501036_0068072
430 Ga0501037_0025065
431 Ga0501037_0065379
432 Ga0501043_0009641
433 Ga0501046_0018965
434 Ga0501047_0016305
435 Ga0501047_0052811
436 Ga0501067_0170249
437 Ga0501070_0146605
438 Ga0501073_0011731
439 Ga0501074_0026792
440 Ga0501080_0039602
441 Ga0501035_0086065
442 Ga0501044_0103981
443 Ga0501044_0261404
444 Ga0500562_000027
445 Ga0500562_000029
446 Ga0500562_000044
447 Ga0500652_011528
448 Ga0500616_0021738
449 Ga0500622_0001233
450 Ga0500611_000005
451 2819589428
452 2884792862
453 2919190701
454 2929923251
455 2929927446
456 2939669089
457 8003151299
458 8003152123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

286

381

0.97

PF00578

AhpC-TSA

AhpC/TSA family

262

384

0.95

PF14289

DUF4369

Domain of unknown function (DUF4369)

48

148

0.92

PF00085

Thioredoxin

Thioredoxin

267

336

0.87

PF08534

Redoxin

Redoxin

262

399

0.87

PF13098

Thioredoxin_2

Thioredoxin-like domain

283

399

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4grf-assembly1.cif.gz_A crystal structure of thioredoxin domain of thiol-disulfide oxidoreductase bvu-2223 (target efi-501010) from bacteroides vulgatus 0.9412 225 361
3fw2-assembly2.cif.gz_D c-terminal domain of putative thiol-disulfide oxidoreductase from bacteroides thetaiotaomicron. 0.9405 222 360
3fkf-assembly1.cif.gz_D thiol-disulfide oxidoreductase from bacteroides fragilis nctc 9343 0.9398 228 359
2lrn-assembly1.cif.gz_A solution structure of a thiol:disulfide interchange protein from bacteroides sp. 0.9183 222 360
4grf-assembly1.cif.gz_A crystal structure of thioredoxin domain of thiol-disulfide oxidoreductase bvu-2223 (target efi-501010) from bacteroides vulgatus 0.9155 225 361
ID Description Score Start End Superfamily
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9412 225 361 3.40.30.10
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9324 228 359 3.40.30.10
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9155 225 361 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.91 226 359 3.40.30.10
3fkfD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8998 228 359 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A848UVZ0-F1-model_v4 TlpA family protein disulfide reductase 0.9928 223 360 GO:0016491
GO:0017004
GO:0030313
AF-A0A7D4B1E6-F1-model_v4 TlpA family protein disulfide reductase 0.9925 226 360 GO:0016209
GO:0016491
AF-A0A847XTS5-F1-model_v4 TlpA family protein disulfide reductase 0.9916 232 360
AF-A0A4Q3QY87-F1-model_v4 deleted 0.9769 226 361
AF-A0A1T5AWV6-F1-model_v4 Peroxiredoxin 0.9708 226 361

Map