F341864

General Info

Members Datasets Scaffolds Average Seq Length
229 147 458 280

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10159854|Ga0081455_101598542
Length 302
Sequence LIGSRLAFGCGAPSHNVRVAYLGPPGTFSEDALRAAVGDQHVEAIPSPSVYDAIVAIRKGTADRALVPFENSIEGAVTATLDTLAFDADGLTLVGEYDLPIRHCLIAKEEIPLERIEVVLSHPQPSAQCARFIRENLPHAEVRAAPSTADAVRTVAESDKPWAALGAESAARLYGAAVLRHGVEDEPDNITRFVWVAPEGTSPSGSGPWRTSMVFSELGEDHPGALVDALQVFSAREVNLTRIESRPLRRGLGRYQFFLDIEGGAKDEPLASAIDALRSKAETVRVLGSWPIATPPGVPGAS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 16.59
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10159854 3300005937 Unclassified 1728
2 JGI24746J21847_1000031 3300001977 Bacteria 13254
3 Ga0070683_100066435 3300005329 Bacteria 3359
4 Ga0070683_100210726 3300005329 Bacteria 1846
5 Ga0070682_100000029 3300005337 Bacteria 183516
6 Ga0068868_100001232 3300005338 Bacteria 17590
7 Ga0068868_100024129 3300005338 Bacteria 4611
8 Ga0070687_100050112 3300005343 Bacteria 2155
9 Ga0070668_100016335 3300005347 Bacteria 5550
10 Ga0070688_100293138 3300005365 Bacteria 1173
11 Ga0070711_100016234 3300005439 Bacteria 4726
12 Ga0070700_100031469 3300005441 Bacteria 3180
13 Ga0070700_100320018 3300005441 Bacteria 1139
14 Ga0070694_100030006 3300005444 Bacteria 3554
15 Ga0070678_100019621 3300005456 Bacteria 4415
16 Ga0070681_10025643 3300005458 Bacteria 5930
17 Ga0070707_100288742 3300005468 Bacteria 1594
18 Ga0070679_100000812 3300005530 Bacteria 27087
19 Ga0070684_100161826 3300005535 Bacteria 2031
20 Ga0068853_100046302 3300005539 Bacteria 3729
21 Ga0070686_100003263 3300005544 Bacteria 8876
22 Ga0070704_100087791 3300005549 Bacteria 2309
23 Ga0068855_100118433 3300005563 Bacteria 3033
24 Ga0070664_100334196 3300005564 Unclassified 1375
25 Ga0068857_100371918 3300005577 Unclassified 1326
26 Ga0068856_100051524 3300005614 Bacteria 4058
27 Ga0068856_100487896 3300005614 Unclassified 1253
28 Ga0068864_100000044 3300005618 Bacteria 157919
29 Ga0068860_100050472 3300005843 Bacteria 3961
30 Ga0081455_10000105 3300005937 Bacteria 93356
31 Ga0081455_10061372 3300005937 Bacteria 3164
32 Ga0081455_10085192 3300005937 Bacteria 2577
33 Ga0081455_10113187 3300005937 Bacteria 2152
34 Ga0081455_10125978 3300005937 Unclassified 2010
35 Ga0081538_10001487 3300005981 Bacteria 24067
36 Ga0081538_10003031 3300005981 Bacteria 16000
37 Ga0081538_10063154 3300005981 Bacteria 2105
38 Ga0081540_1012731 3300005983 Bacteria 5514
39 Ga0075365_10001381 3300006038 Bacteria 10927
40 Ga0075365_10012204 3300006038 Bacteria 5090
41 Ga0075365_10033704 3300006038 Bacteria 3302
42 Ga0075364_10084090 3300006051 Bacteria 2107
43 Ga0070716_100025562 3300006173 Bacteria 3152
44 Ga0070712_100001585 3300006175 Bacteria 13897
45 Ga0075430_100002062 3300006846 Bacteria 16578
46 Ga0075430_100006430 3300006846 Bacteria 9907
47 Ga0075431_100000236 3300006847 Bacteria 41558
48 Ga0075431_100011378 3300006847 Bacteria 8963
49 Ga0075431_100034878 3300006847 Bacteria 5183
50 Ga0075431_100072986 3300006847 Bacteria 3540
51 Ga0075433_10042994 3300006852 Bacteria 3921
52 Ga0075433_10076938 3300006852 Unclassified 2939
53 Ga0075434_100001701 3300006871 Bacteria 18831
54 Ga0075434_100102041 3300006871 Bacteria 2876
55 Ga0075429_100011940 3300006880 Bacteria 7530
56 Ga0075429_100290379 3300006880 Bacteria 1432
57 Ga0068865_100356522 3300006881 Bacteria 1186
58 Ga0075435_100035175 3300007076 Unclassified 3974
59 Ga0111539_10012825 3300009094 Bacteria 10490
60 Ga0111539_10968263 3300009094 Unclassified 989
61 Ga0105245_10000476 3300009098 Bacteria 36689
62 Ga0114129_10013766 3300009147 Bacteria 11528
63 Ga0114129_10017943 3300009147 Bacteria 10075
64 Ga0114129_10035714 3300009147 Bacteria 7021
65 Ga0114129_10045760 3300009147 Bacteria 6151
66 Ga0114129_10057503 3300009147 Bacteria 5442
67 Ga0114129_10144176 3300009147 Bacteria 3263
68 Ga0105242_10001663 3300009176 Bacteria 17592
69 Ga0105239_10030210 3300010375 Bacteria 5957
70 Ga0105246_10027735 3300011119 Bacteria 3714
71 Ga0157378_10053503 3300013297 Bacteria 3594
72 Ga0157375_10025584 3300013308 Bacteria 5488
73 Ga0157377_10308959 3300014745 Bacteria 1046
74 Ga0207688_10006987 3300025901 Bacteria 6142
75 Ga0207707_10013265 3300025912 Bacteria 7179
76 Ga0207693_10001133 3300025915 Bacteria 23878
77 Ga0207663_10023658 3300025916 Bacteria 3529
78 Ga0207652_10000544 3300025921 Bacteria 38182
79 Ga0207646_10486426 3300025922 Bacteria 1112
80 Ga0207687_10041840 3300025927 Bacteria 3149
81 Ga0207690_10146021 3300025932 Bacteria 1749
82 Ga0207686_10000189 3300025934 Bacteria 47718
83 Ga0207669_10134970 3300025937 Bacteria 1703
84 Ga0207665_10007109 3300025939 Bacteria 7409
85 Ga0207661_10187594 3300025944 Bacteria 1811
86 Ga0207679_10107356 3300025945 Bacteria 2196
87 Ga0207667_10240122 3300025949 Bacteria 1854
88 Ga0207668_10141705 3300025972 Bacteria 1850
89 Ga0207677_10000444 3300026023 Bacteria 28037
90 Ga0207639_10004291 3300026041 Bacteria 9607
91 Ga0207708_10035780 3300026075 Bacteria 3778
92 Ga0207702_10009144 3300026078 Bacteria 8338
93 Ga0207641_10031065 3300026088 Bacteria 4428
94 Ga0207676_10000043 3300026095 Bacteria 161948
95 Ga0207683_10023416 3300026121 Bacteria 5312
96 Ga0207428_10028686 3300027907 Bacteria 4621
97 Ga0207428_10240313 3300027907 Bacteria 1353
98 Ga0268264_10037490 3300028381 Bacteria 3997
99 Ga0307409_100046784 3300031995 Bacteria 3278
100 Ga0307415_100034049 3300032126 Bacteria 3312
101 Ga0395900_0011558 3300037418 Bacteria 9034
102 Ga0395900_0122877 3300037418 Bacteria 2663
103 Ga0395898_0006114 3300037466 Bacteria 12905
104 Ga0395898_0226933 3300037466 Bacteria 1781
105 Ga0395898_0296333 3300037466 Unclassified 1543
106 Ga0395905_0002714 3300037471 Bacteria 19395
107 Ga0395901_0006268 3300038443 Bacteria 12054
108 Ga0395901_0046918 3300038443 Bacteria 4488
109 Ga0395901_0242795 3300038443 Bacteria 1878
110 Ga0451849_1098185 3300041505 Bacteria 1779
111 Ga0451853_1834083 3300041512 Bacteria 2891
112 Ga0466963_0006167 3300044694 Bacteria 7076
113 Ga0466967_0286350 3300045976 Unclassified 1582
114 Ga0495592_0000518 3300046454 Bacteria 27890
115 Ga0495641_0026832 3300046461 Bacteria 2807
116 Ga0495653_0186611 3300046463 Bacteria 1418
117 Ga0495594_0000004 3300046499 Bacteria 195881
118 Ga0495620_0000580 3300046515 Bacteria 22923
119 Ga0495628_0049121 3300046516 Bacteria 3341
120 Ga0495630_0074849 3300046517 Bacteria 2551
121 Ga0495644_0000253 3300046523 Bacteria 24763
122 Ga0495652_0091178 3300046529 Bacteria 2492
123 Ga0495622_0000016 3300046557 Bacteria 177089
124 Ga0495625_0000020 3300046660 Bacteria 290440
125 Ga0495599_0005091 3300046678 Bacteria 7827
126 Ga0495658_0131823 3300046683 Bacteria 1522
127 Ga0495670_0175705 3300046691 Bacteria 1129
128 Ga0495674_0000007 3300047319 Bacteria 336257
129 Ga0495676_0000091 3300047321 Bacteria 66575
130 Ga0495676_0000563 3300047321 Bacteria 30429
131 Ga0495676_0024223 3300047321 Bacteria 5258
132 Ga0495675_0008681 3300047444 Bacteria 6304
133 Ga0495686_0017724 3300047472 Bacteria 4793
134 Ga0496100_0000008 3300048903 Bacteria 231974
135 Ga0496100_0043688 3300048903 Bacteria 2867
136 Ga0496101_0000016 3300048904 Bacteria 240753
137 Ga0496101_0031426 3300048904 Bacteria 3732
138 Ga0496102_0007857 3300048905 Bacteria 9116
139 Ga0496102_0017780 3300048905 Bacteria 6233
140 Ga0496104_0000063 3300048907 Bacteria 116618
141 Ga0496104_0011929 3300048907 Bacteria 7795
142 Ga0496104_0361174 3300048907 Bacteria 1365
143 Ga0496105_0000041 3300048908 Bacteria 116618
144 Ga0496105_0000209 3300048908 Bacteria 39293
145 Ga0496105_0017716 3300048908 Bacteria 5714
146 Ga0496106_0000052 3300048909 Bacteria 94849
147 Ga0496106_0000085 3300048909 Bacteria 74004
148 Ga0496106_0029632 3300048909 Bacteria 4080
149 Ga0496106_0224588 3300048909 Bacteria 1498
150 Ga0496107_0000009 3300048910 Bacteria 231682
151 Ga0496107_0033246 3300048910 Bacteria 3690
152 Ga0496107_0034649 3300048910 Bacteria 3616
153 Ga0496108_0006167 3300048911 Bacteria 9698
154 Ga0496109_0137313 3300048912 Unclassified 2285
155 Ga0496109_0158501 3300048912 Unclassified 2120
156 Ga0496110_0022739 3300048913 Bacteria 5327
157 Ga0496110_0075150 3300048913 Bacteria 3002
158 Ga0496110_0289899 3300048913 Bacteria 1490
159 Ga0496110_0407915 3300048913 Bacteria 1239
160 Ga0496111_0087043 3300048914 Bacteria 2286
161 Ga0496111_0115088 3300048914 Unclassified 1982
162 Ga0496111_0163502 3300048914 Bacteria 1653
163 Ga0496112_0001303 3300048915 Bacteria 18939
164 Ga0496112_0142064 3300048915 Bacteria 2370
165 Ga0496112_0187276 3300048915 Bacteria 2033
166 Ga0496112_0546516 3300048915 Bacteria 1092
167 Ga0496113_0098645 3300048916 Unclassified 2262
168 Ga0496113_0284470 3300048916 Bacteria 1323
169 Ga0496114_0001545 3300048917 Bacteria 17456
170 Ga0496115_0000074 3300048918 Bacteria 90267
171 Ga0496115_0030356 3300048918 Bacteria 4251
172 Ga0496118_0197716 3300048921 Bacteria 1195
173 Ga0496119_0010541 3300048922 Bacteria 7761
174 Ga0501036_0043302 3300049572 Bacteria 3812
175 Ga0501036_0443482 3300049572 Bacteria 1082
176 Ga0501038_0224411 3300049574 Unclassified 1498
177 Ga0501040_0046692 3300049576 Bacteria 2956
178 Ga0501041_0041216 3300049577 Bacteria 2804
179 Ga0501041_0056478 3300049577 Unclassified 2399
180 Ga0501041_0100174 3300049577 Unclassified 1793
181 Ga0501048_0098045 3300049582 Unclassified 2068
182 Ga0501067_0022885 3300049583 Bacteria 3460
183 Ga0501068_0147269 3300049584 Bacteria 1478
184 Ga0501071_0015516 3300049587 Bacteria 5231
185 Ga0501071_0236916 3300049587 Bacteria 1376
186 Ga0501072_0210932 3300049588 Bacteria 1548
187 Ga0501074_0114798 3300049590 Bacteria 1927
188 Ga0501075_0008369 3300049591 Bacteria 7214
189 Ga0501075_0278426 3300049591 Bacteria 1275
190 Ga0501076_0027247 3300049592 Bacteria 4432
191 Ga0501079_0038776 3300049741 Bacteria 3674
192 Ga0501081_0130625 3300049743 Bacteria 1794
193 Ga0501081_0272777 3300049743 Bacteria 1237
194 Ga0501035_0225423 3300049822 Unclassified 1599
195 Ga0501045_0014356 3300049824 Bacteria 5613
196 nmdc:mga00v17_135308_c1 3300050491 Unclassified 1577
197 nmdc:mga0yw44_2433_c1 3300050492 Bacteria 7933
198 nmdc:mga0yw44_45041_c1 3300050492 Bacteria 2643
199 nmdc:mga05p37_194974_c1 3300050507 Bacteria 2456
200 nmdc:mga05p37_35605_c2 3300050507 Bacteria 5529
201 nmdc:mga05p37_48746_c1 3300050507 Bacteria 5209
202 nmdc:mga05p37_50715_c1 3300050507 Bacteria 4728
203 nmdc:mga05p37_574375_c1 3300050507 Unclassified 1278
204 nmdc:mga05p37_63195_c1 3300050507 Bacteria 4556
205 nmdc:mga09592_222658_c1 3300050508 Bacteria 1634
206 nmdc:mga09592_9608_c1 3300050508 Bacteria 7857
207 nmdc:mga0qj67_5765_c1 3300050509 Bacteria 9065
208 nmdc:mga0qj67_9228_c1 3300050509 Bacteria 7330
209 nmdc:mga06r32_13612_c1 3300050510 Bacteria 7375
210 nmdc:mga06r32_29193_c1 3300050510 Bacteria 5167
211 nmdc:mga06r32_81729_c1 3300050510 Bacteria 3147
212 nmdc:mga08y16_10600_c1 3300050511 Bacteria 9671
213 nmdc:mga08y16_459821_c1 3300050511 Bacteria 1297
214 nmdc:mga0n895_414073_c1 3300050512 Bacteria 1363
215 nmdc:mga0n895_6282_c1 3300050512 Bacteria 10068
216 nmdc:mga0rr50_27068_c1 3300050513 Bacteria 4010
217 nmdc:mga0rr50_51854_c1 3300050513 Unclassified 3046
218 nmdc:mga0a205_75185_c1 3300050515 Unclassified 3264
219 Ga0495601_0000120 3300053077 Bacteria 43540
220 Ga0495601_0016469 3300053077 Bacteria 4480
221 Ga0495612_0000495 3300053078 Bacteria 15696
222 Ga0495612_0034630 3300053078 Bacteria 2045
223 Ga0501084_0083788 3300054114 Unclassified 2676
224 Ga0501084_0138758 3300054114 Bacteria 2047
225 Ga0501082_0003991 3300060353 Bacteria 12882
226 Ga0501082_0104575 3300060353 Unclassified 2449
227 Ga0530510_0000681 3300061734 Bacteria 21917
228 Ga0530510_0101641 3300061734 Unclassified 2102
229 Ga0530510_0415920 3300061734 Bacteria 1014
230 Ga0081455_10159854
231 JGI24746J21847_1000031
232 Ga0070683_100066435
233 Ga0070683_100210726
234 Ga0070682_100000029
235 Ga0068868_100001232
236 Ga0068868_100024129
237 Ga0070687_100050112
238 Ga0070668_100016335
239 Ga0070688_100293138
240 Ga0070711_100016234
241 Ga0070700_100031469
242 Ga0070700_100320018
243 Ga0070694_100030006
244 Ga0070678_100019621
245 Ga0070681_10025643
246 Ga0070707_100288742
247 Ga0070679_100000812
248 Ga0070684_100161826
249 Ga0068853_100046302
250 Ga0070686_100003263
251 Ga0070704_100087791
252 Ga0068855_100118433
253 Ga0070664_100334196
254 Ga0068857_100371918
255 Ga0068856_100051524
256 Ga0068856_100487896
257 Ga0068864_100000044
258 Ga0068860_100050472
259 Ga0081455_10000105
260 Ga0081455_10061372
261 Ga0081455_10085192
262 Ga0081455_10113187
263 Ga0081455_10125978
264 Ga0081538_10001487
265 Ga0081538_10003031
266 Ga0081538_10063154
267 Ga0081540_1012731
268 Ga0075365_10001381
269 Ga0075365_10012204
270 Ga0075365_10033704
271 Ga0075364_10084090
272 Ga0070716_100025562
273 Ga0070712_100001585
274 Ga0075430_100002062
275 Ga0075430_100006430
276 Ga0075431_100000236
277 Ga0075431_100011378
278 Ga0075431_100034878
279 Ga0075431_100072986
280 Ga0075433_10042994
281 Ga0075433_10076938
282 Ga0075434_100001701
283 Ga0075434_100102041
284 Ga0075429_100011940
285 Ga0075429_100290379
286 Ga0068865_100356522
287 Ga0075435_100035175
288 Ga0111539_10012825
289 Ga0111539_10968263
290 Ga0105245_10000476
291 Ga0114129_10013766
292 Ga0114129_10017943
293 Ga0114129_10035714
294 Ga0114129_10045760
295 Ga0114129_10057503
296 Ga0114129_10144176
297 Ga0105242_10001663
298 Ga0105239_10030210
299 Ga0105246_10027735
300 Ga0157378_10053503
301 Ga0157375_10025584
302 Ga0157377_10308959
303 Ga0207688_10006987
304 Ga0207707_10013265
305 Ga0207693_10001133
306 Ga0207663_10023658
307 Ga0207652_10000544
308 Ga0207646_10486426
309 Ga0207687_10041840
310 Ga0207690_10146021
311 Ga0207686_10000189
312 Ga0207669_10134970
313 Ga0207665_10007109
314 Ga0207661_10187594
315 Ga0207679_10107356
316 Ga0207667_10240122
317 Ga0207668_10141705
318 Ga0207677_10000444
319 Ga0207639_10004291
320 Ga0207708_10035780
321 Ga0207702_10009144
322 Ga0207641_10031065
323 Ga0207676_10000043
324 Ga0207683_10023416
325 Ga0207428_10028686
326 Ga0207428_10240313
327 Ga0268264_10037490
328 Ga0307409_100046784
329 Ga0307415_100034049
330 Ga0395900_0011558
331 Ga0395900_0122877
332 Ga0395898_0006114
333 Ga0395898_0226933
334 Ga0395898_0296333
335 Ga0395905_0002714
336 Ga0395901_0006268
337 Ga0395901_0046918
338 Ga0395901_0242795
339 Ga0451849_1098185
340 Ga0451853_1834083
341 Ga0466963_0006167
342 Ga0466967_0286350
343 Ga0495592_0000518
344 Ga0495641_0026832
345 Ga0495653_0186611
346 Ga0495594_0000004
347 Ga0495620_0000580
348 Ga0495628_0049121
349 Ga0495630_0074849
350 Ga0495644_0000253
351 Ga0495652_0091178
352 Ga0495622_0000016
353 Ga0495625_0000020
354 Ga0495599_0005091
355 Ga0495658_0131823
356 Ga0495670_0175705
357 Ga0495674_0000007
358 Ga0495676_0000091
359 Ga0495676_0000563
360 Ga0495676_0024223
361 Ga0495675_0008681
362 Ga0495686_0017724
363 Ga0496100_0000008
364 Ga0496100_0043688
365 Ga0496101_0000016
366 Ga0496101_0031426
367 Ga0496102_0007857
368 Ga0496102_0017780
369 Ga0496104_0000063
370 Ga0496104_0011929
371 Ga0496104_0361174
372 Ga0496105_0000041
373 Ga0496105_0000209
374 Ga0496105_0017716
375 Ga0496106_0000052
376 Ga0496106_0000085
377 Ga0496106_0029632
378 Ga0496106_0224588
379 Ga0496107_0000009
380 Ga0496107_0033246
381 Ga0496107_0034649
382 Ga0496108_0006167
383 Ga0496109_0137313
384 Ga0496109_0158501
385 Ga0496110_0022739
386 Ga0496110_0075150
387 Ga0496110_0289899
388 Ga0496110_0407915
389 Ga0496111_0087043
390 Ga0496111_0115088
391 Ga0496111_0163502
392 Ga0496112_0001303
393 Ga0496112_0142064
394 Ga0496112_0187276
395 Ga0496112_0546516
396 Ga0496113_0098645
397 Ga0496113_0284470
398 Ga0496114_0001545
399 Ga0496115_0000074
400 Ga0496115_0030356
401 Ga0496118_0197716
402 Ga0496119_0010541
403 Ga0501036_0043302
404 Ga0501036_0443482
405 Ga0501038_0224411
406 Ga0501040_0046692
407 Ga0501041_0041216
408 Ga0501041_0056478
409 Ga0501041_0100174
410 Ga0501048_0098045
411 Ga0501067_0022885
412 Ga0501068_0147269
413 Ga0501071_0015516
414 Ga0501071_0236916
415 Ga0501072_0210932
416 Ga0501074_0114798
417 Ga0501075_0008369
418 Ga0501075_0278426
419 Ga0501076_0027247
420 Ga0501079_0038776
421 Ga0501081_0130625
422 Ga0501081_0272777
423 Ga0501035_0225423
424 Ga0501045_0014356
425 nmdc:mga00v17_135308_c1
426 nmdc:mga0yw44_2433_c1
427 nmdc:mga0yw44_45041_c1
428 nmdc:mga05p37_194974_c1
429 nmdc:mga05p37_35605_c2
430 nmdc:mga05p37_48746_c1
431 nmdc:mga05p37_50715_c1
432 nmdc:mga05p37_574375_c1
433 nmdc:mga05p37_63195_c1
434 nmdc:mga09592_222658_c1
435 nmdc:mga09592_9608_c1
436 nmdc:mga0qj67_5765_c1
437 nmdc:mga0qj67_9228_c1
438 nmdc:mga06r32_13612_c1
439 nmdc:mga06r32_29193_c1
440 nmdc:mga06r32_81729_c1
441 nmdc:mga08y16_10600_c1
442 nmdc:mga08y16_459821_c1
443 nmdc:mga0n895_414073_c1
444 nmdc:mga0n895_6282_c1
445 nmdc:mga0rr50_27068_c1
446 nmdc:mga0rr50_51854_c1
447 nmdc:mga0a205_75185_c1
448 Ga0495601_0000120
449 Ga0495601_0016469
450 Ga0495612_0000495
451 Ga0495612_0034630
452 Ga0501084_0083788
453 Ga0501084_0138758
454 Ga0501082_0003991
455 Ga0501082_0104575
456 Ga0530510_0000681
457 Ga0530510_0101641
458 Ga0530510_0415920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00800

PDT

Prephenate dehydratase

19

201

0.96

PF01842

ACT

ACT domain

217

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mwb-assembly1.cif.gz_A the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9249 1 275
3mwb-assembly1.cif.gz_B the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9226 1 275
3mwb-assembly1.cif.gz_A the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9153 1 275
7am0-assembly2.cif.gz_C gqqa- a novel type of quorum quenching acylases 0.9093 1 277
3mwb-assembly1.cif.gz_B the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9036 1 275
ID Description Score Start End Superfamily
af_P0A9J8_291_383_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.965 193 275 3.30.70.260
af_A0A1D6ELY8_206_287_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9504 91 170 3.40.190.10
af_P9WIC3_193_284_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9478 187 275 3.30.70.260
2qmxB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9391 87 170 3.40.190.10
af_P9WIC3_99_178_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9377 91 170 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4R4R6V4-F1-model_v4 ACT domain-containing protein 0.9702 193 275 GO:0004664
GO:0005737
GO:0009094
AF-A0A7X7CCG4-F1-model_v4 Prephenate dehydratase 0.9682 193 277 GO:0004664
GO:0005737
GO:0009094
AF-A0A6J7AIS7-F1-model_v4 Unannotated protein 0.9679 193 275
AF-A0A350UTM8-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9602 75 275 GO:0004664
GO:0005737
GO:0009094
AF-A0A0P9HEC0-F1-model_v4 Prephenate dehydratase 0.9568 195 275 GO:0004664
GO:0005737
GO:0009094

Map