F342136

General Info

Members Datasets Scaffolds Average Seq Length
229 171 458 333

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000005|Ga0265327_10000005515
Length 361
Sequence MQNPSTIQRSSLSVFLQESWYGSALWLQLLRPVSWLFRVLVFVRRSLYLRHRSNNPCSIPVIVVGNISVGGAGKTPLLMALAEELKRRGHRVGIVSRGYGGNAKRFPLRVDRNTSPELCGDEPAMMAQRLNIPVVVDPVRKNAVIEALGCASDYPCDVILSDDGLQHYAMPRDIEILVVDAERGFGNGLCLPAGPLREPLSRLRSVDFLVSNGPDSARKLPKQHTFASMMLKPSACVNVTTGERVSIEKFFRRQLVHAVAGIGNPQRFFQSLKDLGSQVIEHPFPDHYIYVPKDLHFGDALPVLMTEKDAVKCKNIPLRNAWYLEVNAVLPDSFYEAVINRLSSLQVARKIGVQRGLFDGH

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
126 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
168 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
169 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
170 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
171 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.87
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 4.37
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10000005 3300031251 Bacteria 790146
2 JGI25162J39368_1001210 3300002737 Bacteria 15021
3 JGI25162J39368_1001215 3300002737 Bacteria 14973
4 JGI25163J39215_1000510 3300002771 Bacteria 11476
5 JGI25164J39214_1000624 3300002772 Bacteria 14975
6 JGI25165J46597_1000467 3300003214 Bacteria 39971
7 Ga0055538_1000088 3300003751 Bacteria 78763
8 Ga0070676_10000409 3300005328 Bacteria 20112
9 Ga0070670_100109653 3300005331 Bacteria 2378
10 Ga0068869_100000798 3300005334 Bacteria 17966
11 Ga0068869_100038775 3300005334 Bacteria 3399
12 Ga0070666_10001270 3300005335 Bacteria 15257
13 Ga0070666_10013074 3300005335 Bacteria 5258
14 Ga0070666_10017801 3300005335 Bacteria 4559
15 Ga0070680_100160648 3300005336 Bacteria 1888
16 Ga0070680_100370071 3300005336 Bacteria 1219
17 Ga0070689_100106287 3300005340 Bacteria 2227
18 Ga0070687_100042256 3300005343 Bacteria 2309
19 Ga0070661_100007995 3300005344 Bacteria 7304
20 Ga0070668_100050779 3300005347 Bacteria 3194
21 Ga0070669_100001002 3300005353 Bacteria 20558
22 Ga0070675_100003433 3300005354 Bacteria 12004
23 Ga0070671_100008388 3300005355 Bacteria 8281
24 Ga0070671_100059140 3300005355 Bacteria 3189
25 Ga0070674_100096673 3300005356 Bacteria 2143
26 Ga0070673_100037989 3300005364 Bacteria 3673
27 Ga0070667_100002050 3300005367 Bacteria 17841
28 Ga0070667_100018398 3300005367 Bacteria 5795
29 Ga0070709_10043287 3300005434 Bacteria 2784
30 Ga0070713_100177900 3300005436 Bacteria 1910
31 Ga0070711_100101051 3300005439 Bacteria 2098
32 Ga0070708_100003166 3300005445 Bacteria 12831
33 Ga0070678_100015251 3300005456 Bacteria 4879
34 Ga0068867_100038368 3300005459 Bacteria 3487
35 Ga0070679_100145083 3300005530 Bacteria 2352
36 Ga0068853_100013178 3300005539 Bacteria 6748
37 Ga0068853_100030264 3300005539 Bacteria 4572
38 Ga0068853_100246869 3300005539 Bacteria 1637
39 Ga0070686_100202971 3300005544 Bacteria 1422
40 Ga0070695_100050148 3300005545 Bacteria 2674
41 Ga0070665_100028902 3300005548 Bacteria 5581
42 Ga0068855_100117883 3300005563 Bacteria 3041
43 Ga0068855_100472680 3300005563 Bacteria 1365
44 Ga0070664_100007865 3300005564 Bacteria 8612
45 Ga0068857_100016796 3300005577 Bacteria 6412
46 Ga0068854_100057304 3300005578 Bacteria 2810
47 Ga0068852_100165387 3300005616 Bacteria 2069
48 Ga0068859_100005483 3300005617 Bacteria 12916
49 Ga0068859_100044030 3300005617 Bacteria 4486
50 Ga0068864_100007975 3300005618 Bacteria 8728
51 Ga0068864_100011776 3300005618 Bacteria 7224
52 Ga0068864_100100071 3300005618 Bacteria 2569
53 Ga0068861_100021470 3300005719 Bacteria 4640
54 Ga0068851_10032997 3300005834 Bacteria 2578
55 Ga0068863_100002766 3300005841 Bacteria 17379
56 Ga0068863_100007862 3300005841 Bacteria 10425
57 Ga0068863_100021028 3300005841 Bacteria 6233
58 Ga0068858_100004446 3300005842 Bacteria 13740
59 Ga0068858_100011251 3300005842 Bacteria 8455
60 Ga0068860_100004132 3300005843 Bacteria 14876
61 Ga0068860_100019813 3300005843 Bacteria 6522
62 Ga0068860_100021377 3300005843 Bacteria 6266
63 Ga0068860_100115450 3300005843 Bacteria 2568
64 Ga0075367_10066316 3300006178 Bacteria 2163
65 Ga0097621_100002004 3300006237 Bacteria 13901
66 Ga0097621_100064761 3300006237 Bacteria 3007
67 Ga0068871_100001493 3300006358 Bacteria 15681
68 Ga0068871_100057763 3300006358 Bacteria 3157
69 Ga0075428_100000729 3300006844 Bacteria 34167
70 Ga0075428_100310847 3300006844 Bacteria 1694
71 Ga0075430_100012906 3300006846 Bacteria 7120
72 Ga0075431_100006916 3300006847 Bacteria 11276
73 Ga0075429_100010098 3300006880 Bacteria 8181
74 Ga0097620_100005484 3300006931 Bacteria 12916
75 Ga0097620_100044029 3300006931 Bacteria 4486
76 Ga0105240_10030417 3300009093 Bacteria 7018
77 Ga0105240_10060715 3300009093 Bacteria 4712
78 Ga0105240_10155188 3300009093 Bacteria 2723
79 Ga0111539_10044489 3300009094 Bacteria 5319
80 Ga0111539_10244958 3300009094 Bacteria 2087
81 Ga0105245_10205744 3300009098 Bacteria 1892
82 Ga0105247_10007270 3300009101 Bacteria 6802
83 Ga0105243_10084846 3300009148 Bacteria 2595
84 Ga0105241_10030001 3300009174 Bacteria 4061
85 Ga0105242_10120681 3300009176 Bacteria 2249
86 Ga0105242_10246733 3300009176 Bacteria 1607
87 Ga0105248_10004264 3300009177 Bacteria 15827
88 Ga0105248_10017821 3300009177 Bacteria 7837
89 Ga0105248_10105239 3300009177 Bacteria 3181
90 Ga0105237_10010061 3300009545 Bacteria 10089
91 Ga0105238_10012110 3300009551 Bacteria 8692
92 Ga0105238_10012954 3300009551 Bacteria 8418
93 Ga0105239_10018292 3300010375 Bacteria 7746
94 Ga0105239_10042897 3300010375 Bacteria 4956
95 Ga0105246_10085165 3300011119 Bacteria 2263
96 Ga0157370_10120929 3300013104 Bacteria 2445
97 Ga0157369_10002721 3300013105 Bacteria 21107
98 Ga0157374_10016651 3300013296 Bacteria 6466
99 Ga0157378_10342704 3300013297 Bacteria 1458
100 Ga0163162_10006034 3300013306 Bacteria 11728
101 Ga0163162_10029935 3300013306 Bacteria 5391
102 Ga0157372_10002373 3300013307 Bacteria 20377
103 Ga0157372_10044225 3300013307 Bacteria 4934
104 Ga0157375_10221933 3300013308 Bacteria 2048
105 Ga0163163_10005082 3300014325 Bacteria 11337
106 Ga0163163_10016778 3300014325 Bacteria 6815
107 Ga0163163_10019235 3300014325 Bacteria 6411
108 Ga0157380_10016332 3300014326 Bacteria 5473
109 Ga0157380_10096199 3300014326 Bacteria 2454
110 Ga0157379_10001305 3300014968 Bacteria 20314
111 Ga0157379_10009035 3300014968 Bacteria 8682
112 Ga0157379_10043631 3300014968 Bacteria 4004
113 Ga0157376_10350121 3300014969 Bacteria 1413
114 Ga0163161_10159301 3300017792 Bacteria 1721
115 Ga0209760_100269 3300025207 Bacteria 19191
116 Ga0207427_100008 3300025231 Bacteria 740731
117 Ga0209437_100014 3300025233 Bacteria 740714
118 Ga0209233_1000008 3300025261 Bacteria 1356712
119 Ga0207710_10024427 3300025900 Bacteria 2603
120 Ga0207680_10007767 3300025903 Bacteria 5240
121 Ga0207680_10040168 3300025903 Bacteria 2720
122 Ga0207699_10052963 3300025906 Bacteria 2405
123 Ga0207645_10010997 3300025907 Bacteria 6191
124 Ga0207707_10017944 3300025912 Bacteria 6169
125 Ga0207695_10001006 3300025913 Bacteria 49914
126 Ga0207695_10116570 3300025913 Bacteria 2644
127 Ga0207671_10007468 3300025914 Bacteria 9483
128 Ga0207663_10049963 3300025916 Bacteria 2597
129 Ga0207662_10145213 3300025918 Bacteria 1505
130 Ga0207657_10002920 3300025919 Bacteria 18349
131 Ga0207649_10002313 3300025920 Bacteria 10705
132 Ga0207652_10123730 3300025921 Bacteria 2303
133 Ga0207681_10004261 3300025923 Bacteria 8827
134 Ga0207681_10078762 3300025923 Bacteria 2320
135 Ga0207694_10008631 3300025924 Bacteria 7693
136 Ga0207650_10045296 3300025925 Bacteria 3236
137 Ga0207650_10058987 3300025925 Bacteria 2859
138 Ga0207659_10002846 3300025926 Bacteria 10316
139 Ga0207706_10043127 3300025933 Bacteria 3998
140 Ga0207706_10151510 3300025933 Bacteria 2039
141 Ga0207670_10190478 3300025936 Bacteria 1552
142 Ga0207691_10001585 3300025940 Bacteria 22586
143 Ga0207711_10049699 3300025941 Bacteria 3590
144 Ga0207689_10001604 3300025942 Bacteria 21396
145 Ga0207689_10059859 3300025942 Bacteria 3132
146 Ga0207689_10083215 3300025942 Bacteria 2631
147 Ga0207661_10092697 3300025944 Bacteria 2519
148 Ga0207667_10105587 3300025949 Bacteria 2906
149 Ga0207668_10003044 3300025972 Bacteria 9827
150 Ga0207640_10032197 3300025981 Bacteria 3249
151 Ga0207677_10020838 3300026023 Bacteria 3992
152 Ga0207703_10065910 3300026035 Bacteria 2977
153 Ga0207639_10001736 3300026041 Bacteria 14682
154 Ga0207639_10012116 3300026041 Bacteria 6000
155 Ga0207639_10048285 3300026041 Bacteria 3221
156 Ga0207678_10146866 3300026067 Bacteria 2013
157 Ga0207702_10211786 3300026078 Bacteria 1802
158 Ga0207641_10002861 3300026088 Bacteria 15679
159 Ga0207648_10000126 3300026089 Bacteria 75403
160 Ga0207648_10134607 3300026089 Bacteria 2176
161 Ga0207676_10070256 3300026095 Bacteria 2807
162 Ga0207674_10004736 3300026116 Bacteria 16310
163 Ga0207675_100062301 3300026118 Bacteria 3483
164 Ga0207683_10001731 3300026121 Bacteria 19437
165 Ga0207698_10084114 3300026142 Bacteria 2578
166 Ga0207698_10119877 3300026142 Bacteria 2224
167 Ga0268266_10021476 3300028379 Bacteria 5499
168 Ga0268266_10038129 3300028379 Bacteria 4092
169 Ga0268264_10010635 3300028381 Bacteria 7603
170 Ga0268264_10141054 3300028381 Bacteria 2149
171 Ga0265334_10000097 3300028573 Bacteria 61159
172 Ga0307408_100273690 3300031548 Bacteria 1403
173 Ga0316579_10003608 3300031691 Bacteria 6073
174 Ga0316578_10025775 3300031728 Bacteria 3309
175 Ga0307414_10286386 3300032004 Bacteria 1387
176 Ga0316583_10008839 3300032133 Bacteria 3632
177 Ga0316593_10000283 3300032168 Bacteria 8557
178 Ga0307510_10264833 3300033180 Bacteria 1198
179 Ga0316596_1001080 3300033541 Bacteria 5288
180 Ga0373924_0032199 3300035410 Bacteria 2112
181 Ga0373937_0005402 3300036401 Bacteria 10934
182 Ga0373937_0039259 3300036401 Bacteria 4315
183 Ga0316582_0070978 3300036647 Bacteria 2254
184 Ga0395900_0001450 3300037418 Bacteria 28297
185 Ga0316581_0009343 3300037588 Bacteria 2692
186 Ga0436364_1336806 3300037853 Bacteria 2986
187 Ga0400483_105831 3300039062 Bacteria 8934
188 Ga0436361_0265002 3300039447 Bacteria 2196
189 Ga0453684_0002052 3300044712 Bacteria 51252
190 Ga0451576_0093339 3300045051 Bacteria 3129
191 Ga0495640_0203788 3300046533 Bacteria 1253
192 Ga0495604_0238403 3300047317 Bacteria 1245
193 Ga0495673_0121628 3300047469 Bacteria 1033
194 Ga0496104_0001671 3300048907 Bacteria 19141
195 Ga0496104_0049451 3300048907 Bacteria 3965
196 Ga0496105_0000293 3300048908 Bacteria 32964
197 Ga0496107_0037951 3300048910 Bacteria 3458
198 Ga0496107_0070668 3300048910 Bacteria 2535
199 Ga0496109_0152725 3300048912 Bacteria 2162
200 Ga0496112_0012599 3300048915 Bacteria 7771
201 Ga0496114_0000240 3300048917 Bacteria 39991
202 Ga0496115_0001302 3300048918 Bacteria 17773
203 Ga0496115_0197253 3300048918 Bacteria 1663
204 Ga0501034_0176995 3300049571 Bacteria 2099
205 Ga0501036_0329264 3300049572 Bacteria 1276
206 Ga0501046_0081200 3300049580 Bacteria 2504
207 Ga0501047_0462572 3300049581 Bacteria 1097
208 Ga0501067_0124952 3300049583 Bacteria 1432
209 Ga0501080_0127271 3300049742 Bacteria 2358
210 Ga0501044_0000112 3300049823 Bacteria 98748
211 nmdc:mga03683_61668_c1 3300050489 Bacteria 1586
212 nmdc:mga09592_31385_c1 3300050508 Bacteria 4427
213 nmdc:mga0qj67_71655_c1 3300050509 Bacteria 2766
214 nmdc:mga06r32_18886_c1 3300050510 Bacteria 6320
215 nmdc:mga08y16_29234_c1 3300050511 Bacteria 5808
216 nmdc:mga08y16_78786_c1 3300050511 Bacteria 3435
217 Ga0495601_0009294 3300053077 Bacteria 5812
218 Ga0500556_0002389 3300053104 Bacteria 6064
219 Ga0500568_0009284 3300053139 Bacteria 4685
220 Ga0500568_0066804 3300053139 Bacteria 1382
221 Ga0500622_0021842 3300053156 Bacteria 3395
222 Ga0500622_0062581 3300053156 Bacteria 1895
223 Ga0501084_0075350 3300054114 Bacteria 2827
224 Ga0501082_0395228 3300060353 Bacteria 1206
225 2597864493 2597489888 Bacteria 6179543
226 2745160189 2744054655 Bacteria 3552603
227 2842841996 2842837860 Bacteria 6066181
228 2919507817 2919506607 Bacteria 3392955
229 8033232743 8033232454 Bacteria 3202805
230 Ga0265327_10000005
231 JGI25162J39368_1001210
232 JGI25162J39368_1001215
233 JGI25163J39215_1000510
234 JGI25164J39214_1000624
235 JGI25165J46597_1000467
236 Ga0055538_1000088
237 Ga0070676_10000409
238 Ga0070670_100109653
239 Ga0068869_100000798
240 Ga0068869_100038775
241 Ga0070666_10001270
242 Ga0070666_10013074
243 Ga0070666_10017801
244 Ga0070680_100160648
245 Ga0070680_100370071
246 Ga0070689_100106287
247 Ga0070687_100042256
248 Ga0070661_100007995
249 Ga0070668_100050779
250 Ga0070669_100001002
251 Ga0070675_100003433
252 Ga0070671_100008388
253 Ga0070671_100059140
254 Ga0070674_100096673
255 Ga0070673_100037989
256 Ga0070667_100002050
257 Ga0070667_100018398
258 Ga0070709_10043287
259 Ga0070713_100177900
260 Ga0070711_100101051
261 Ga0070708_100003166
262 Ga0070678_100015251
263 Ga0068867_100038368
264 Ga0070679_100145083
265 Ga0068853_100013178
266 Ga0068853_100030264
267 Ga0068853_100246869
268 Ga0070686_100202971
269 Ga0070695_100050148
270 Ga0070665_100028902
271 Ga0068855_100117883
272 Ga0068855_100472680
273 Ga0070664_100007865
274 Ga0068857_100016796
275 Ga0068854_100057304
276 Ga0068852_100165387
277 Ga0068859_100005483
278 Ga0068859_100044030
279 Ga0068864_100007975
280 Ga0068864_100011776
281 Ga0068864_100100071
282 Ga0068861_100021470
283 Ga0068851_10032997
284 Ga0068863_100002766
285 Ga0068863_100007862
286 Ga0068863_100021028
287 Ga0068858_100004446
288 Ga0068858_100011251
289 Ga0068860_100004132
290 Ga0068860_100019813
291 Ga0068860_100021377
292 Ga0068860_100115450
293 Ga0075367_10066316
294 Ga0097621_100002004
295 Ga0097621_100064761
296 Ga0068871_100001493
297 Ga0068871_100057763
298 Ga0075428_100000729
299 Ga0075428_100310847
300 Ga0075430_100012906
301 Ga0075431_100006916
302 Ga0075429_100010098
303 Ga0097620_100005484
304 Ga0097620_100044029
305 Ga0105240_10030417
306 Ga0105240_10060715
307 Ga0105240_10155188
308 Ga0111539_10044489
309 Ga0111539_10244958
310 Ga0105245_10205744
311 Ga0105247_10007270
312 Ga0105243_10084846
313 Ga0105241_10030001
314 Ga0105242_10120681
315 Ga0105242_10246733
316 Ga0105248_10004264
317 Ga0105248_10017821
318 Ga0105248_10105239
319 Ga0105237_10010061
320 Ga0105238_10012110
321 Ga0105238_10012954
322 Ga0105239_10018292
323 Ga0105239_10042897
324 Ga0105246_10085165
325 Ga0157370_10120929
326 Ga0157369_10002721
327 Ga0157374_10016651
328 Ga0157378_10342704
329 Ga0163162_10006034
330 Ga0163162_10029935
331 Ga0157372_10002373
332 Ga0157372_10044225
333 Ga0157375_10221933
334 Ga0163163_10005082
335 Ga0163163_10016778
336 Ga0163163_10019235
337 Ga0157380_10016332
338 Ga0157380_10096199
339 Ga0157379_10001305
340 Ga0157379_10009035
341 Ga0157379_10043631
342 Ga0157376_10350121
343 Ga0163161_10159301
344 Ga0209760_100269
345 Ga0207427_100008
346 Ga0209437_100014
347 Ga0209233_1000008
348 Ga0207710_10024427
349 Ga0207680_10007767
350 Ga0207680_10040168
351 Ga0207699_10052963
352 Ga0207645_10010997
353 Ga0207707_10017944
354 Ga0207695_10001006
355 Ga0207695_10116570
356 Ga0207671_10007468
357 Ga0207663_10049963
358 Ga0207662_10145213
359 Ga0207657_10002920
360 Ga0207649_10002313
361 Ga0207652_10123730
362 Ga0207681_10004261
363 Ga0207681_10078762
364 Ga0207694_10008631
365 Ga0207650_10045296
366 Ga0207650_10058987
367 Ga0207659_10002846
368 Ga0207706_10043127
369 Ga0207706_10151510
370 Ga0207670_10190478
371 Ga0207691_10001585
372 Ga0207711_10049699
373 Ga0207689_10001604
374 Ga0207689_10059859
375 Ga0207689_10083215
376 Ga0207661_10092697
377 Ga0207667_10105587
378 Ga0207668_10003044
379 Ga0207640_10032197
380 Ga0207677_10020838
381 Ga0207703_10065910
382 Ga0207639_10001736
383 Ga0207639_10012116
384 Ga0207639_10048285
385 Ga0207678_10146866
386 Ga0207702_10211786
387 Ga0207641_10002861
388 Ga0207648_10000126
389 Ga0207648_10134607
390 Ga0207676_10070256
391 Ga0207674_10004736
392 Ga0207675_100062301
393 Ga0207683_10001731
394 Ga0207698_10084114
395 Ga0207698_10119877
396 Ga0268266_10021476
397 Ga0268266_10038129
398 Ga0268264_10010635
399 Ga0268264_10141054
400 Ga0265334_10000097
401 Ga0307408_100273690
402 Ga0316579_10003608
403 Ga0316578_10025775
404 Ga0307414_10286386
405 Ga0316583_10008839
406 Ga0316593_10000283
407 Ga0307510_10264833
408 Ga0316596_1001080
409 Ga0373924_0032199
410 Ga0373937_0005402
411 Ga0373937_0039259
412 Ga0316582_0070978
413 Ga0395900_0001450
414 Ga0316581_0009343
415 Ga0436364_1336806
416 Ga0400483_105831
417 Ga0436361_0265002
418 Ga0453684_0002052
419 Ga0451576_0093339
420 Ga0495640_0203788
421 Ga0495604_0238403
422 Ga0495673_0121628
423 Ga0496104_0001671
424 Ga0496104_0049451
425 Ga0496105_0000293
426 Ga0496107_0037951
427 Ga0496107_0070668
428 Ga0496109_0152725
429 Ga0496112_0012599
430 Ga0496114_0000240
431 Ga0496115_0001302
432 Ga0496115_0197253
433 Ga0501034_0176995
434 Ga0501036_0329264
435 Ga0501046_0081200
436 Ga0501047_0462572
437 Ga0501067_0124952
438 Ga0501080_0127271
439 Ga0501044_0000112
440 nmdc:mga03683_61668_c1
441 nmdc:mga09592_31385_c1
442 nmdc:mga0qj67_71655_c1
443 nmdc:mga06r32_18886_c1
444 nmdc:mga08y16_29234_c1
445 nmdc:mga08y16_78786_c1
446 Ga0495601_0009294
447 Ga0500556_0002389
448 Ga0500568_0009284
449 Ga0500568_0066804
450 Ga0500622_0021842
451 Ga0500622_0062581
452 Ga0501084_0075350
453 Ga0501082_0395228
454 2597864493
455 2745160189
456 2842841996
457 2919507817
458 8033232743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

26

343

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.7927 17 315
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.7851 51 91
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.7539 17 315
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.7105 51 186
2j37-assembly1.cif.gz_W model of mammalian srp bound to 80s rncs 0.6877 44 185
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.912 18 310 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8889 18 310 3.40.50.300
af_A0A0P0X1P5_1_135_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8702 85 187 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8597 18 310 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8153 18 310 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M5X691-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9948 111 315 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A3M5X691-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.99 111 315 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-V7D6J7-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9855 167 313 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-Q02PE4-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9845 1 313 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2R7T0N3-F1-model_v4 deleted 0.9831 145 320

Map