F342274

General Info

Members Datasets Scaffolds Average Seq Length
229 181 458 299

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0000036|Ga0466970_0000036_14568_15566
Length 332
Sequence MAHGETTGGFTKSEGWLDWYDGPSTPTFRLPDGAVDAHCHVFGPGAEFPYAPERKYTPCDASAAQLFALRDHLCFDRNVIVQATCHGADNRALVDALRRSDGRARGVATVRRDVTPEQLAELHEAGVRGVRFNFVKRLVDRVPTDSLDEIVAKIAPLGWHVVIYFEAEDLPELYDFFSAIPTDVVVDHMGRPDVTKDPDGPEFELFLRFMRENPNVWTKVSCPERLSVTGPRALDGEQQAYADVVPFARRVVEEVPGRVLWGTDWPHPNLKDHMPDDGLLVDFIPQIAPTPELQRKLLVDNPARLYWAEQTPADHTQSAEQDRASARITEGA

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
101 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
166 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
167 2643221597 Microbacterium sp. Root180 Isolate Unclassified
168 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
169 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
170 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
171 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
172 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
173 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
174 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
175 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
176 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
177 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
178 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
179 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
180 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
181 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.14
Metatranscriptomes 0.44
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 1.31
Rhizoplane 7.86
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0000036 3300044765 Bacteria 48597
2 rootL2_10005700 3300003322 Bacteria 43298
3 Ga0055529_1001271 3300003763 Bacteria 9037
4 Ga0055524_1000117 3300003775 Bacteria 93643
5 Ga0070680_100407747 3300005336 Bacteria 1159
6 Ga0070711_100119130 3300005439 Bacteria 1949
7 Ga0070663_100081936 3300005455 Bacteria 2373
8 Ga0070706_100166721 3300005467 Bacteria 2057
9 Ga0070698_100003926 3300005471 Bacteria 16349
10 Ga0070679_100217454 3300005530 Bacteria 1873
11 Ga0070684_100395104 3300005535 Bacteria 1274
12 Ga0070696_100024326 3300005546 Bacteria 4116
13 Ga0070665_100002566 3300005548 Bacteria 19913
14 Ga0070717_10016174 3300006028 Bacteria 5780
15 Ga0075432_10000268 3300006058 Bacteria 14347
16 Ga0075366_10208346 3300006195 Bacteria 1190
17 Ga0075431_100024976 3300006847 Bacteria 6125
18 Ga0075429_100196277 3300006880 Bacteria 1768
19 Ga0105240_10299882 3300009093 Bacteria 1838
20 Ga0105245_10425337 3300009098 Bacteria 1332
21 Ga0105243_10000250 3300009148 Bacteria 61801
22 Ga0105237_10015974 3300009545 Bacteria 7806
23 Ga0157319_1000026 3300012497 Bacteria 63349
24 Ga0157370_10106092 3300013104 Bacteria 2629
25 Ga0157378_10193588 3300013297 Bacteria 1919
26 Ga0163162_10041295 3300013306 Bacteria 4615
27 Ga0157375_10177663 3300013308 Bacteria 2279
28 Ga0163163_10337769 3300014325 Bacteria 1561
29 Ga0157380_10017000 3300014326 Bacteria 5373
30 Ga0182005_1004059 3300015265 Bacteria 4802
31 Ga0213872_10027135 3300021361 Bacteria 2630
32 Ga0213876_10104252 3300021384 Bacteria 1504
33 Ga0209455_1000337 3300025272 Bacteria 44758
34 Ga0209256_1000075 3300025299 Bacteria 236149
35 Ga0209257_1000244 3300025304 Bacteria 126098
36 Ga0207699_10011283 3300025906 Bacteria 4507
37 Ga0207699_10012944 3300025906 Bacteria 4254
38 Ga0207695_10069530 3300025913 Bacteria 3602
39 Ga0207693_10022149 3300025915 Bacteria 5051
40 Ga0207693_10064713 3300025915 Bacteria 2864
41 Ga0207660_10063288 3300025917 Bacteria 2667
42 Ga0207652_10186222 3300025921 Bacteria 1867
43 Ga0207650_10033881 3300025925 Bacteria 3702
44 Ga0207700_10366998 3300025928 Bacteria 1256
45 Ga0207664_10024659 3300025929 Bacteria 4521
46 Ga0207664_10325087 3300025929 Bacteria 1357
47 Ga0207665_10016681 3300025939 Bacteria 4824
48 Ga0207702_10239184 3300026078 Bacteria 1700
49 Ga0207674_10134468 3300026116 Bacteria 2435
50 Ga0268266_10018457 3300028379 Bacteria 5944
51 Ga0265337_1000042 3300028556 Bacteria 56158
52 Ga0265337_1001602 3300028556 Bacteria 11051
53 Ga0265326_10004751 3300028558 Bacteria 4320
54 Ga0265319_1002822 3300028563 Bacteria 9278
55 Ga0265334_10000375 3300028573 Bacteria 23930
56 Ga0265318_10011550 3300028577 Bacteria 3796
57 Ga0265323_10011323 3300028653 Bacteria 3601
58 Ga0265336_10000003 3300028666 Bacteria 423158
59 Ga0265336_10007357 3300028666 Bacteria 3915
60 Ga0307515_10049556 3300028794 Bacteria 6314
61 Ga0265338_10004381 3300028800 Bacteria 19092
62 Ga0265338_10244988 3300028800 Bacteria 1325
63 Ga0265324_10001160 3300029957 Bacteria 15689
64 Ga0265324_10003293 3300029957 Bacteria 7760
65 Ga0265763_1000963 3300030763 Bacteria 1935
66 Ga0265332_10000083 3300031238 Bacteria 83040
67 Ga0265332_10000626 3300031238 Bacteria 23073
68 Ga0265320_10017209 3300031240 Bacteria 4022
69 Ga0265320_10031679 3300031240 Bacteria 2714
70 Ga0265340_10026517 3300031247 Bacteria 2928
71 Ga0265340_10038158 3300031247 Bacteria 2377
72 Ga0265316_10021381 3300031344 Bacteria 5480
73 Ga0307513_10000006 3300031456 Bacteria 470848
74 Ga0307408_100000205 3300031548 Bacteria 63434
75 Ga0265313_10015228 3300031595 Bacteria 4495
76 Ga0265314_10025002 3300031711 Bacteria 4514
77 Ga0265342_10081334 3300031712 Bacteria 1870
78 Ga0316576_10004360 3300031727 Bacteria 8474
79 Ga0316578_10011530 3300031728 Bacteria 4630
80 Ga0307516_10002101 3300031730 Bacteria 27049
81 Ga0307406_10015406 3300031901 Bacteria 4423
82 Ga0307412_10000876 3300031911 Bacteria 17305
83 Ga0307409_100126228 3300031995 Bacteria 2177
84 Ga0307411_10420277 3300032005 Bacteria 1110
85 Ga0307415_100176192 3300032126 Bacteria 1673
86 Ga0316583_10015037 3300032133 Bacteria 2785
87 Ga0316585_10010740 3300032137 Bacteria 2691
88 Ga0373938_0016815 3300034957 Bacteria 1434
89 Ga0373934_0001020 3300035086 Bacteria 10119
90 Ga0373934_0003290 3300035086 Bacteria 5912
91 Ga0373923_0002059 3300035111 Bacteria 6070
92 Ga0373932_0072176 3300035112 Bacteria 1073
93 Ga0373953_0000026 3300035117 Bacteria 40030
94 Ga0373953_0007096 3300035117 Bacteria 3733
95 Ga0373954_0010228 3300035118 Bacteria 4137
96 Ga0373956_0000442 3300035119 Bacteria 16877
97 Ga0373956_0028579 3300035119 Bacteria 2427
98 Ga0373957_0000038 3300035120 Bacteria 34200
99 Ga0373957_0016394 3300035120 Bacteria 2563
100 Ga0373955_0000231 3300035172 Bacteria 23261
101 Ga0373955_0006619 3300035172 Bacteria 5286
102 Ga0373924_0000552 3300035410 Bacteria 11501
103 Ga0373924_0003392 3300035410 Bacteria 5475
104 Ga0373935_0043610 3300035692 Bacteria 2823
105 Ga0373933_0000839 3300035724 Bacteria 18804
106 Ga0373947_0034944 3300035725 Bacteria 2975
107 Ga0373937_0000138 3300036401 Bacteria 70068
108 Ga0373937_0204960 3300036401 Bacteria 1854
109 Ga0316582_0000235 3300036647 Bacteria 18349
110 Ga0316584_0024658 3300036712 Bacteria 4404
111 Ga0316584_0064372 3300036712 Bacteria 2745
112 Ga0373925_0150958 3300037068 Bacteria 1825
113 Ga0373925_0231768 3300037068 Bacteria 1477
114 Ga0395899_0011489 3300037312 Bacteria 6778
115 Ga0395900_0072915 3300037418 Bacteria 3529
116 Ga0395900_0126698 3300037418 Bacteria 2619
117 Ga0395905_0056064 3300037471 Bacteria 3688
118 Ga0436364_0354346 3300037853 Bacteria 3120
119 Ga0395901_0043260 3300038443 Bacteria 4673
120 Ga0395901_0080987 3300038443 Bacteria 3391
121 Ga0400490_37707 3300038726 Bacteria 3018
122 Ga0400487_27772 3300039110 Bacteria 3483
123 Ga0436365_0433346 3300039437 Bacteria 2446
124 Ga0436360_0041017 3300039438 Bacteria 1258
125 Ga0436363_1718774 3300039450 Bacteria 14558
126 Ga0451802_0909224 3300041460 Bacteria 1360
127 Ga0439459_0001761 3300042438 Bacteria 3240
128 Ga0466966_0099480 3300044684 Bacteria 1800
129 Ga0466967_0185273 3300045976 Bacteria 1965
130 Ga0495592_0000041 3300046454 Bacteria 123431
131 Ga0495592_0000519 3300046454 Bacteria 27856
132 Ga0495651_0000018 3300046462 Bacteria 123195
133 Ga0495651_0021971 3300046462 Bacteria 4962
134 Ga0495653_0055207 3300046463 Bacteria 3032
135 Ga0495608_0000039 3300046511 Bacteria 123195
136 Ga0495608_0040305 3300046511 Bacteria 3129
137 Ga0495618_0013068 3300046514 Bacteria 5046
138 Ga0495628_0000219 3300046516 Bacteria 50121
139 Ga0495628_0025777 3300046516 Bacteria 4800
140 Ga0495630_0086282 3300046517 Bacteria 2370
141 Ga0495652_0000092 3300046529 Bacteria 96258
142 Ga0495652_0039030 3300046529 Bacteria 4107
143 Ga0495665_0008768 3300046531 Bacteria 5490
144 Ga0495665_0133297 3300046531 Bacteria 1300
145 Ga0495640_0041058 3300046533 Bacteria 3235
146 Ga0495586_0043992 3300046535 Bacteria 2404
147 Ga0495587_0000034 3300046536 Bacteria 123432
148 Ga0495587_0021836 3300046536 Bacteria 3948
149 Ga0495645_0025334 3300046543 Bacteria 4304
150 Ga0495667_0000150 3300046559 Bacteria 47612
151 Ga0495667_0002416 3300046559 Bacteria 12473
152 Ga0495667_0213754 3300046559 Bacteria 1232
153 Ga0495634_0039011 3300046642 Bacteria 3236
154 Ga0495635_0016799 3300046663 Bacteria 5111
155 Ga0495635_0191527 3300046663 Bacteria 1388
156 Ga0495657_0000247 3300046675 Bacteria 49117
157 Ga0495657_0013370 3300046675 Bacteria 6060
158 Ga0495657_0203025 3300046675 Bacteria 1207
159 Ga0495599_0000108 3300046678 Bacteria 56078
160 Ga0495599_0008955 3300046678 Bacteria 6096
161 Ga0495623_0000287 3300046679 Bacteria 32946
162 Ga0495646_0041255 3300046680 Bacteria 2836
163 Ga0495613_0210625 3300046689 Bacteria 1367
164 Ga0495600_0010134 3300046809 Bacteria 5843
165 Ga0495600_0244147 3300046809 Bacteria 1143
166 Ga0495604_0000039 3300047317 Bacteria 123431
167 Ga0495604_0015752 3300047317 Bacteria 6034
168 Ga0495636_0058854 3300047318 Bacteria 1621
169 Ga0495674_0059527 3300047319 Bacteria 3335
170 Ga0495680_0000028 3300047322 Bacteria 112865
171 Ga0495680_0223718 3300047322 Bacteria 1342
172 Ga0495675_0000355 3300047444 Bacteria 32066
173 Ga0495675_0234150 3300047444 Bacteria 1107
174 Ga0495673_0101034 3300047469 Bacteria 1165
175 Ga0495684_0060770 3300047471 Bacteria 2875
176 Ga0495684_0099264 3300047471 Bacteria 2201
177 Ga0495602_0000043 3300048088 Bacteria 123431
178 Ga0495602_0047037 3300048088 Bacteria 3891
179 Ga0496100_0006015 3300048903 Bacteria 6585
180 Ga0496102_0017412 3300048905 Bacteria 6296
181 Ga0496102_0231784 3300048905 Bacteria 1741
182 Ga0496103_0298556 3300048906 Bacteria 1036
183 Ga0496104_0058235 3300048907 Bacteria 3657
184 Ga0496104_0150355 3300048907 Bacteria 2235
185 Ga0496104_0225063 3300048907 Bacteria 1788
186 Ga0496105_0220364 3300048908 Bacteria 1545
187 Ga0496105_0440190 3300048908 Bacteria 1030
188 Ga0496109_0046275 3300048912 Bacteria 3951
189 Ga0496109_0049942 3300048912 Bacteria 3810
190 Ga0496110_0029300 3300048913 Bacteria 4736
191 Ga0496110_0091823 3300048913 Bacteria 2716
192 Ga0496112_0058928 3300048915 Bacteria 3783
193 Ga0496113_0129558 3300048916 Bacteria 1978
194 Ga0496114_0009211 3300048917 Bacteria 7829
195 Ga0496115_0332481 3300048918 Bacteria 1241
196 Ga0496117_0128166 3300048920 Bacteria 1544
197 Ga0496125_0000591 3300048928 Bacteria 61843
198 Ga0496126_0066033 3300048929 Bacteria 3236
199 Ga0496126_0256744 3300048929 Bacteria 1455
200 Ga0501034_0449864 3300049571 Bacteria 1206
201 Ga0501038_0023790 3300049574 Bacteria 5473
202 Ga0501038_0282206 3300049574 Bacteria 1307
203 Ga0501040_0436406 3300049576 Bacteria 942
204 Ga0501046_0185890 3300049580 Bacteria 1552
205 Ga0501077_0054081 3300049593 Bacteria 2550
206 Ga0501044_0000515 3300049823 Bacteria 47051
207 Ga0501045_0160558 3300049824 Bacteria 1673
208 Ga0495601_0044217 3300053077 Bacteria 2799
209 Ga0495595_0007679 3300053084 Bacteria 4419
210 Ga0500583_0173368 3300053092 Unclassified 1074
211 Ga0500566_0076396 3300053094 Bacteria 1872
212 Ga0500658_0112303 3300053134 Unclassified 1201
213 2517041259 2516653077 Bacteria 7555578
214 2616905920 2616644941 Bacteria 8510691
215 2643994654 2643221597 Bacteria 3347721
216 2644431501 2643221677 Bacteria 7584031
217 2808876898 2808606366 Bacteria 4415912
218 2821271523 2821268502 Bacteria 3750023
219 2842221529 2842217011 Bacteria 7497767
220 2852688479 2852684882 Bacteria 5463342
221 2866557009 2866552031 Bacteria 5824618
222 2870628731 2870628048 Bacteria 3696012
223 2905929600 2905926851 Bacteria 4423176
224 2919054993 2919051321 Bacteria 4210889
225 2939602117 2939598168 Bacteria 4687164
226 8004028495 8004025490 Bacteria 4327753
227 8025535350 8025530807 Bacteria 8495698
228 8055914166 8055909800 Bacteria 7278581
229 8057877955 8057874678 Bacteria 7494653
230 Ga0466970_0000036
231 rootL2_10005700
232 Ga0055529_1001271
233 Ga0055524_1000117
234 Ga0070680_100407747
235 Ga0070711_100119130
236 Ga0070663_100081936
237 Ga0070706_100166721
238 Ga0070698_100003926
239 Ga0070679_100217454
240 Ga0070684_100395104
241 Ga0070696_100024326
242 Ga0070665_100002566
243 Ga0070717_10016174
244 Ga0075432_10000268
245 Ga0075366_10208346
246 Ga0075431_100024976
247 Ga0075429_100196277
248 Ga0105240_10299882
249 Ga0105245_10425337
250 Ga0105243_10000250
251 Ga0105237_10015974
252 Ga0157319_1000026
253 Ga0157370_10106092
254 Ga0157378_10193588
255 Ga0163162_10041295
256 Ga0157375_10177663
257 Ga0163163_10337769
258 Ga0157380_10017000
259 Ga0182005_1004059
260 Ga0213872_10027135
261 Ga0213876_10104252
262 Ga0209455_1000337
263 Ga0209256_1000075
264 Ga0209257_1000244
265 Ga0207699_10011283
266 Ga0207699_10012944
267 Ga0207695_10069530
268 Ga0207693_10022149
269 Ga0207693_10064713
270 Ga0207660_10063288
271 Ga0207652_10186222
272 Ga0207650_10033881
273 Ga0207700_10366998
274 Ga0207664_10024659
275 Ga0207664_10325087
276 Ga0207665_10016681
277 Ga0207702_10239184
278 Ga0207674_10134468
279 Ga0268266_10018457
280 Ga0265337_1000042
281 Ga0265337_1001602
282 Ga0265326_10004751
283 Ga0265319_1002822
284 Ga0265334_10000375
285 Ga0265318_10011550
286 Ga0265323_10011323
287 Ga0265336_10000003
288 Ga0265336_10007357
289 Ga0307515_10049556
290 Ga0265338_10004381
291 Ga0265338_10244988
292 Ga0265324_10001160
293 Ga0265324_10003293
294 Ga0265763_1000963
295 Ga0265332_10000083
296 Ga0265332_10000626
297 Ga0265320_10017209
298 Ga0265320_10031679
299 Ga0265340_10026517
300 Ga0265340_10038158
301 Ga0265316_10021381
302 Ga0307513_10000006
303 Ga0307408_100000205
304 Ga0265313_10015228
305 Ga0265314_10025002
306 Ga0265342_10081334
307 Ga0316576_10004360
308 Ga0316578_10011530
309 Ga0307516_10002101
310 Ga0307406_10015406
311 Ga0307412_10000876
312 Ga0307409_100126228
313 Ga0307411_10420277
314 Ga0307415_100176192
315 Ga0316583_10015037
316 Ga0316585_10010740
317 Ga0373938_0016815
318 Ga0373934_0001020
319 Ga0373934_0003290
320 Ga0373923_0002059
321 Ga0373932_0072176
322 Ga0373953_0000026
323 Ga0373953_0007096
324 Ga0373954_0010228
325 Ga0373956_0000442
326 Ga0373956_0028579
327 Ga0373957_0000038
328 Ga0373957_0016394
329 Ga0373955_0000231
330 Ga0373955_0006619
331 Ga0373924_0000552
332 Ga0373924_0003392
333 Ga0373935_0043610
334 Ga0373933_0000839
335 Ga0373947_0034944
336 Ga0373937_0000138
337 Ga0373937_0204960
338 Ga0316582_0000235
339 Ga0316584_0024658
340 Ga0316584_0064372
341 Ga0373925_0150958
342 Ga0373925_0231768
343 Ga0395899_0011489
344 Ga0395900_0072915
345 Ga0395900_0126698
346 Ga0395905_0056064
347 Ga0436364_0354346
348 Ga0395901_0043260
349 Ga0395901_0080987
350 Ga0400490_37707
351 Ga0400487_27772
352 Ga0436365_0433346
353 Ga0436360_0041017
354 Ga0436363_1718774
355 Ga0451802_0909224
356 Ga0439459_0001761
357 Ga0466966_0099480
358 Ga0466967_0185273
359 Ga0495592_0000041
360 Ga0495592_0000519
361 Ga0495651_0000018
362 Ga0495651_0021971
363 Ga0495653_0055207
364 Ga0495608_0000039
365 Ga0495608_0040305
366 Ga0495618_0013068
367 Ga0495628_0000219
368 Ga0495628_0025777
369 Ga0495630_0086282
370 Ga0495652_0000092
371 Ga0495652_0039030
372 Ga0495665_0008768
373 Ga0495665_0133297
374 Ga0495640_0041058
375 Ga0495586_0043992
376 Ga0495587_0000034
377 Ga0495587_0021836
378 Ga0495645_0025334
379 Ga0495667_0000150
380 Ga0495667_0002416
381 Ga0495667_0213754
382 Ga0495634_0039011
383 Ga0495635_0016799
384 Ga0495635_0191527
385 Ga0495657_0000247
386 Ga0495657_0013370
387 Ga0495657_0203025
388 Ga0495599_0000108
389 Ga0495599_0008955
390 Ga0495623_0000287
391 Ga0495646_0041255
392 Ga0495613_0210625
393 Ga0495600_0010134
394 Ga0495600_0244147
395 Ga0495604_0000039
396 Ga0495604_0015752
397 Ga0495636_0058854
398 Ga0495674_0059527
399 Ga0495680_0000028
400 Ga0495680_0223718
401 Ga0495675_0000355
402 Ga0495675_0234150
403 Ga0495673_0101034
404 Ga0495684_0060770
405 Ga0495684_0099264
406 Ga0495602_0000043
407 Ga0495602_0047037
408 Ga0496100_0006015
409 Ga0496102_0017412
410 Ga0496102_0231784
411 Ga0496103_0298556
412 Ga0496104_0058235
413 Ga0496104_0150355
414 Ga0496104_0225063
415 Ga0496105_0220364
416 Ga0496105_0440190
417 Ga0496109_0046275
418 Ga0496109_0049942
419 Ga0496110_0029300
420 Ga0496110_0091823
421 Ga0496112_0058928
422 Ga0496113_0129558
423 Ga0496114_0009211
424 Ga0496115_0332481
425 Ga0496117_0128166
426 Ga0496125_0000591
427 Ga0496126_0066033
428 Ga0496126_0256744
429 Ga0501034_0449864
430 Ga0501038_0023790
431 Ga0501038_0282206
432 Ga0501040_0436406
433 Ga0501046_0185890
434 Ga0501077_0054081
435 Ga0501044_0000515
436 Ga0501045_0160558
437 Ga0495601_0044217
438 Ga0495595_0007679
439 Ga0500583_0173368
440 Ga0500566_0076396
441 Ga0500658_0112303
442 2517041259
443 2616905920
444 2643994654
445 2644431501
446 2808876898
447 2821271523
448 2842221529
449 2852688479
450 2866557009
451 2870628731
452 2905929600
453 2919054993
454 2939602117
455 8004028495
456 8025535350
457 8055914166
458 8057877955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

35

307

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.9784 18 309
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.9753 18 309
4d8l-assembly1.cif.gz_A crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis 0.9707 18 308
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.9424 18 309
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.9385 18 309
ID Description Score Start End Superfamily
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9802 18 309 3.20.20.140
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9409 18 309 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8996 24 306 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8841 24 306 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8547 29 306 3.20.20.140
ID Description Score Start End GO Terms
AF-X1G355-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9993 41 180 GO:0016787
AF-X1G355-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9922 41 180 GO:0016787
AF-A0A3N5FAS2-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.9921 43 306 GO:0016787
AF-A0A2R7NPL9-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.9907 84 310 GO:0016787
AF-A0A4Q3Q288-F1-model_v4 deleted 0.9888 5 170

Map