F344029

General Info

Members Datasets Scaffolds Average Seq Length
231 165 231 149

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10020618|Ga0157370_100206187
Length 182
Sequence LSAPFGKGLLSCNRDARQRDERALFLINCSQENSPMATGTVRFHRVLRAPPDRVYRAFIDTDAMAKWLPPNGFTGKVHQIDAKVGGGYKMSFTNLNNGQSHSFGGRYLELVPGERLRYTGVFDDPNLRGEMTTTVILKKSLGGTDISITQEGIPEVIPTDMCYLGWQESLVLLAKLVEAEIP

Samples

Sample ID Description Type Environment
1 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
165 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 0.43
Rhizoplane 1.73
Rhizosphere 89.18
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1000016 3300003856 Bacteria 275897
2 Ga0065712_10145327 3300005290 Bacteria 1387
3 Ga0065707_10608253 3300005295 Bacteria 686
4 Ga0070658_10305477 3300005327 Bacteria 1357
5 Ga0070676_10057585 3300005328 Bacteria 2300
6 Ga0070676_10591310 3300005328 Bacteria 799
7 Ga0070676_10981627 3300005328 Bacteria 633
8 Ga0070670_100139975 3300005331 Bacteria 2093
9 Ga0068869_100019638 3300005334 Bacteria 4623
10 Ga0068869_100137939 3300005334 Bacteria 1881
11 Ga0070680_100879056 3300005336 Bacteria 773
12 Ga0070660_101433922 3300005339 Bacteria 587
13 Ga0070661_100192168 3300005344 Bacteria 1557
14 Ga0070692_10306174 3300005345 Bacteria 972
15 Ga0070668_100011203 3300005347 Bacteria 6676
16 Ga0070668_100473214 3300005347 Bacteria 1081
17 Ga0070669_100003924 3300005353 Bacteria 10768
18 Ga0070669_100119208 3300005353 Bacteria 2011
19 Ga0070669_101794735 3300005353 Bacteria 535
20 Ga0070675_100008517 3300005354 Bacteria 7963
21 Ga0070675_100766045 3300005354 Bacteria 881
22 Ga0070671_100186612 3300005355 Bacteria 1757
23 Ga0070673_100240849 3300005364 Bacteria 1573
24 Ga0070673_101049076 3300005364 Bacteria 760
25 Ga0070688_100888194 3300005365 Bacteria 702
26 Ga0070667_100133885 3300005367 Bacteria 2166
27 Ga0070709_10189988 3300005434 Bacteria 1448
28 Ga0070700_100348842 3300005441 Bacteria 1096
29 Ga0070694_100197353 3300005444 Bacteria 1498
30 Ga0070678_100069864 3300005456 Bacteria 2623
31 Ga0070662_100005223 3300005457 Bacteria 8284
32 Ga0070681_10106518 3300005458 Bacteria 2745
33 Ga0070672_100056459 3300005543 Bacteria 3079
34 Ga0070665_100097276 3300005548 Bacteria 2948
35 Ga0068855_100538920 3300005563 Bacteria 1265
36 Ga0068855_100662458 3300005563 Bacteria 1120
37 Ga0070664_100258672 3300005564 Bacteria 1566
38 Ga0068857_100022465 3300005577 Bacteria 5550
39 Ga0068857_100311238 3300005577 Bacteria 1453
40 Ga0068856_100561382 3300005614 Bacteria 1163
41 Ga0068864_101834556 3300005618 Bacteria 612
42 Ga0068861_100001549 3300005719 Bacteria 14600
43 Ga0068870_10017501 3300005840 Bacteria 3444
44 Ga0068870_10122848 3300005840 Bacteria 1498
45 Ga0068860_100258106 3300005843 Bacteria 1698
46 Ga0068862_100004887 3300005844 Bacteria 11286
47 Ga0068862_100239119 3300005844 Bacteria 1650
48 Ga0075369_10324279 3300006186 Bacteria 721
49 Ga0075366_10048275 3300006195 Bacteria 2524
50 Ga0075366_10053691 3300006195 Bacteria 2394
51 Ga0075370_10059137 3300006353 Bacteria 2181
52 Ga0075370_10070987 3300006353 Bacteria 1992
53 Ga0075428_100178579 3300006844 Bacteria 2299
54 Ga0075430_100007599 3300006846 Bacteria 9157
55 Ga0075430_100062593 3300006846 Bacteria 3125
56 Ga0075431_100038324 3300006847 Bacteria 4935
57 Ga0075431_100333508 3300006847 Bacteria 1527
58 Ga0075429_100450530 3300006880 Bacteria 1128
59 Ga0075429_101064443 3300006880 Bacteria 707
60 Ga0068865_100730275 3300006881 Bacteria 849
61 Ga0075436_100013752 3300006914 Bacteria 5543
62 Ga0099826_10000171 3300006948 Bacteria 27420
63 Ga0105240_10009033 3300009093 Bacteria 14153
64 Ga0105240_11007503 3300009093 Bacteria 890
65 Ga0111539_10007854 3300009094 Bacteria 13622
66 Ga0111539_10046776 3300009094 Bacteria 5174
67 Ga0111539_10338897 3300009094 Bacteria 1750
68 Ga0111539_11173903 3300009094 Bacteria 892
69 Ga0105245_10173176 3300009098 Bacteria 2057
70 Ga0114129_10004176 3300009147 Bacteria 20403
71 Ga0105243_10579582 3300009148 Bacteria 1077
72 Ga0105243_10727190 3300009148 Bacteria 971
73 Ga0105241_10489057 3300009174 Bacteria 1095
74 Ga0105248_12222005 3300009177 Bacteria 624
75 Ga0105237_10651111 3300009545 Bacteria 1060
76 Ga0105249_10002479 3300009553 Bacteria 15985
77 Ga0105239_10891461 3300010375 Bacteria 1021
78 Ga0105239_11012432 3300010375 Bacteria 955
79 Ga0157371_11413561 3300013102 Bacteria 541
80 Ga0157370_10020618 3300013104 Bacteria 6581
81 Ga0157370_10035813 3300013104 Bacteria 4821
82 Ga0157369_10258377 3300013105 Bacteria 1817
83 Ga0157378_10312742 3300013297 Bacteria 1524
84 Ga0163162_10129036 3300013306 Bacteria 2636
85 Ga0157372_11090079 3300013307 Bacteria 924
86 Ga0163163_11792205 3300014325 Bacteria 674
87 Ga0157380_11302994 3300014326 Bacteria 774
88 Ga0182007_10005760 3300015262 Bacteria 5389
89 Ga0163161_10000272 3300017792 Bacteria 45332
90 Ga0206349_1249909 3300020075 Bacteria 836
91 Ga0209129_1007329 3300025258 Bacteria 3314
92 Ga0209025_1000230 3300025294 Bacteria 131131
93 Ga0207680_10729548 3300025903 Bacteria 710
94 Ga0207645_10066426 3300025907 Bacteria 2305
95 Ga0207645_10135356 3300025907 Bacteria 1605
96 Ga0207643_10005514 3300025908 Bacteria 6765
97 Ga0207643_10055750 3300025908 Bacteria 2248
98 Ga0207643_10064772 3300025908 Bacteria 2092
99 Ga0207707_10067223 3300025912 Bacteria 3122
100 Ga0207695_10000153 3300025913 Bacteria 206288
101 Ga0207693_10160968 3300025915 Bacteria 1766
102 Ga0207649_10757579 3300025920 Bacteria 756
103 Ga0207681_10017501 3300025923 Bacteria 4500
104 Ga0207681_10035011 3300025923 Bacteria 3307
105 Ga0207687_10364445 3300025927 Bacteria 1180
106 Ga0207687_10673158 3300025927 Bacteria 877
107 Ga0207706_10008577 3300025933 Bacteria 9419
108 Ga0207706_10467562 3300025933 Bacteria 1090
109 Ga0207709_10377029 3300025935 Bacteria 1078
110 Ga0207709_10396423 3300025935 Bacteria 1054
111 Ga0207704_10368743 3300025938 Bacteria 1123
112 Ga0207691_10038712 3300025940 Bacteria 4412
113 Ga0207691_10952247 3300025940 Bacteria 717
114 Ga0207689_10033214 3300025942 Bacteria 4287
115 Ga0207689_10143158 3300025942 Bacteria 1970
116 Ga0207679_10061027 3300025945 Bacteria 2805
117 Ga0207667_10232918 3300025949 Bacteria 1885
118 Ga0207667_10374733 3300025949 Bacteria 1450
119 Ga0207667_10752024 3300025949 Bacteria 974
120 Ga0207651_10784384 3300025960 Bacteria 844
121 Ga0207712_10704208 3300025961 Bacteria 882
122 Ga0207668_10014073 3300025972 Bacteria 4946
123 Ga0207668_10027468 3300025972 Bacteria 3707
124 Ga0207677_10433649 3300026023 Bacteria 1122
125 Ga0207677_10807859 3300026023 Bacteria 840
126 Ga0207678_10486431 3300026067 Bacteria 1075
127 Ga0207676_10104518 3300026095 Bacteria 2356
128 Ga0207676_11232079 3300026095 Bacteria 742
129 Ga0207674_10089215 3300026116 Bacteria 3076
130 Ga0207674_10098912 3300026116 Bacteria 2900
131 Ga0207674_10156210 3300026116 Bacteria 2237
132 Ga0207674_10583310 3300026116 Bacteria 1080
133 Ga0207675_100000354 3300026118 Bacteria 43858
134 Ga0207675_100840929 3300026118 Bacteria 932
135 Ga0207683_10017721 3300026121 Bacteria 6073
136 Ga0209371_1000051 3300027312 Bacteria 276935
137 Ga0209813_10103577 3300027866 Bacteria 971
138 Ga0207428_10022581 3300027907 Bacteria 5306
139 Ga0207428_10028882 3300027907 Bacteria 4603
140 Ga0268266_10974509 3300028379 Bacteria 820
141 Ga0268266_11044150 3300028379 Bacteria 791
142 Ga0268265_10008662 3300028380 Bacteria 6875
143 Ga0307515_10051514 3300028794 Bacteria 6135
144 Ga0268256_1000052 3300030500 Bacteria 276525
145 Ga0307408_100005843 3300031548 Bacteria 8185
146 Ga0307408_100532903 3300031548 Bacteria 1033
147 Ga0307405_11421339 3300031731 Bacteria 607
148 Ga0307406_10000605 3300031901 Bacteria 20510
149 Ga0307412_10168121 3300031911 Bacteria 1637
150 Ga0307412_10981790 3300031911 Bacteria 745
151 Ga0307412_11091658 3300031911 Bacteria 710
152 Ga0307414_11504689 3300032004 Bacteria 626
153 Ga0307414_11540031 3300032004 Bacteria 619
154 Ga0307411_10062477 3300032005 Bacteria 2484
155 Ga0307411_10473782 3300032005 Bacteria 1053
156 Ga0307411_10580090 3300032005 Bacteria 961
157 Ga0395899_0012585 3300037312 Bacteria 6486
158 Ga0395900_0029434 3300037418 Bacteria 5633
159 Ga0395900_0104716 3300037418 Bacteria 2907
160 Ga0395898_0156727 3300037466 Bacteria 2178
161 Ga0395905_0000953 3300037471 Bacteria 37129
162 Ga0395901_0092883 3300038443 Bacteria 3159
163 Ga0395901_0251725 3300038443 Bacteria 1840
164 Ga0451793_1553743 3300041452 Bacteria 1798
165 Ga0451800_0583250 3300041459 Bacteria 1049
166 Ga0451802_0983814 3300041460 Bacteria 1118
167 Ga0451847_0814566 3300041503 Bacteria 812
168 Ga0451853_0275691 3300041512 Bacteria 1249
169 Ga0439431_0029947 3300041997 Bacteria 1347
170 Ga0439445_0202504 3300042004 Bacteria 586
171 Ga0439446_0066132 3300042156 Bacteria 1100
172 Ga0439434_0065599 3300042435 Bacteria 1139
173 Ga0450893_0026560 3300042532 Bacteria 1018
174 Ga0451577_0246982 3300042876 Bacteria 1615
175 Ga0439440_0031393 3300042993 Bacteria 1256
176 Ga0453684_0012166 3300044712 Bacteria 14271
177 Ga0453684_0564683 3300044712 Bacteria 1252
178 Ga0466957_0245388 3300044842 Bacteria 1189
179 Ga0451576_0000656 3300045051 Bacteria 71486
180 Ga0451576_0005559 3300045051 Bacteria 15750
181 Ga0451576_0541010 3300045051 Bacteria 1224
182 Ga0495617_000739 3300046452 Bacteria 16079
183 Ga0495584_0000028 3300046491 Bacteria 111816
184 Ga0495585_0000002 3300046492 Bacteria 529316
185 Ga0495585_0000188 3300046492 Bacteria 66122
186 Ga0495616_0001036 3300046513 Bacteria 19887
187 Ga0495648_0000012 3300046524 Bacteria 294111
188 Ga0495609_0037385 3300046538 Bacteria 2190
189 Ga0495609_0242495 3300046538 Bacteria 743
190 Ga0495633_0002161 3300046558 Bacteria 14096
191 Ga0495668_0513222 3300046616 Bacteria 661
192 Ga0495611_0199650 3300046648 Bacteria 933
193 Ga0495625_0451628 3300046660 Bacteria 794
194 Ga0495658_0277010 3300046683 Bacteria 1058
195 Ga0495660_0016048 3300046810 Bacteria 4320
196 Ga0495636_0543098 3300047318 Bacteria 565
197 Ga0495683_0000133 3300047323 Bacteria 72553
198 Ga0495686_0069290 3300047472 Bacteria 2175
199 Ga0495614_0500680 3300048089 Bacteria 578
200 Ga0496110_0054817 3300048913 Bacteria 3507
201 Ga0501037_1129168 3300049573 Bacteria 507
202 Ga0501040_0426025 3300049576 Bacteria 954
203 Ga0501041_0077590 3300049577 Bacteria 2044
204 Ga0501070_0073875 3300049586 Bacteria 2822
205 Ga0501072_0033475 3300049588 Bacteria 4027
206 Ga0501075_0827471 3300049591 Bacteria 704
207 Ga0501076_0655557 3300049592 Bacteria 866
208 Ga0501080_0263564 3300049742 Bacteria 1569
209 nmdc:mga00v17_150244_c1 3300050491 Bacteria 1497
210 nmdc:mga00v17_692815_c1 3300050491 Bacteria 653
211 nmdc:mga0k408_51697_c1 3300050493 Bacteria 2381
212 nmdc:mga06z11_32050_c1 3300050494 Bacteria 2559
213 nmdc:mga04h51_289524_c1 3300050495 Bacteria 665
214 nmdc:mga07m45_24680_c2 3300050496 Bacteria 1906
215 nmdc:mga07m45_784_c1 3300050496 Bacteria 13644
216 nmdc:mga05p37_3143_c1 3300050507 Bacteria 14872
217 nmdc:mga09592_12673_c1 3300050508 Bacteria 6873
218 nmdc:mga09592_982050_c1 3300050508 Bacteria 707
219 nmdc:mga0qj67_12615_c1 3300050509 Bacteria 6371
220 nmdc:mga0qj67_1422240_c1 3300050509 Bacteria 535
221 nmdc:mga06r32_116067_c1 3300050510 Bacteria 2637
222 nmdc:mga06r32_21004_c1 3300050510 Bacteria 6022
223 nmdc:mga06r32_462722_c1 3300050510 Bacteria 1247
224 nmdc:mga06r32_581_c1 3300050510 Bacteria 31827
225 nmdc:mga08y16_1802_c1 3300050511 Bacteria 21723
226 nmdc:mga08y16_267637_c1 3300050511 Bacteria 1765
227 nmdc:mga08y16_47835_c1 3300050511 Bacteria 4477
228 nmdc:mga08x19_10562_c1 3300050514 Bacteria 5549
229 nmdc:mga0sz30_273817_c1 3300050516 Bacteria 752
230 Ga0500610_0082465 3300053079 Bacteria 1675
231 Ga0587111_0012777 3300060346 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10189988 Ga0070709_101899882 146
2 3300005334 Ga0068869_100019638 Ga0068869_1000196383 147
3 3300005344 Ga0070661_100192168 Ga0070661_1001921682 147
4 3300005354 Ga0070675_100008517 Ga0070675_1000085172 147
5 3300005364 Ga0070673_101049076 Ga0070673_1010490761 147
6 3300005441 Ga0070700_100348842 Ga0070700_1003488421 147
7 3300005563 Ga0068855_100538920 Ga0068855_1005389201 147
8 3300005563 Ga0068855_100662458 Ga0068855_1006624582 147
9 3300005577 Ga0068857_100022465 Ga0068857_1000224652 147
10 3300005614 Ga0068856_100561382 Ga0068856_1005613822 147
11 3300005844 Ga0068862_100239119 Ga0068862_1002391192 147
12 3300006195 Ga0075366_10048275 Ga0075366_100482753 147
13 3300006353 Ga0075370_10059137 Ga0075370_100591372 147
14 3300009093 Ga0105240_10009033 Ga0105240_100090335 147
15 3300009093 Ga0105240_11007503 Ga0105240_110075032 147
16 3300009098 Ga0105245_10173176 Ga0105245_101731762 147
17 3300009545 Ga0105237_10651111 Ga0105237_106511111 147
18 3300013102 Ga0157371_11413561 Ga0157371_114135611 147
19 3300013104 Ga0157370_10020618 Ga0157370_100206187 147
20 3300013104 Ga0157370_10035813 Ga0157370_100358136 147
21 3300013105 Ga0157369_10258377 Ga0157369_102583775 147
22 3300013297 Ga0157378_10312742 Ga0157378_103127422 147
23 3300013307 Ga0157372_11090079 Ga0157372_110900791 147
24 3300014325 Ga0163163_11792205 Ga0163163_117922051 147
25 3300020075 Ga0206349_1249909 Ga0206349_12499092 147
26 3300025908 Ga0207643_10055750 Ga0207643_100557503 147
27 3300025913 Ga0207695_10000153 Ga0207695_1000015338 147
28 3300025915 Ga0207693_10160968 Ga0207693_101609682 147
29 3300025920 Ga0207649_10757579 Ga0207649_107575791 147
30 3300025927 Ga0207687_10673158 Ga0207687_106731582 147
31 3300025942 Ga0207689_10033214 Ga0207689_100332142 147
32 3300025949 Ga0207667_10232918 Ga0207667_102329181 147
33 3300025949 Ga0207667_10374733 Ga0207667_103747333 147
34 3300025949 Ga0207667_10752024 Ga0207667_107520241 147
35 3300026023 Ga0207677_10807859 Ga0207677_108078591 147
36 3300026116 Ga0207674_10089215 Ga0207674_100892152 147
37 3300026116 Ga0207674_10156210 Ga0207674_101562102 147
38 3300026116 Ga0207674_10583310 Ga0207674_105833101 147
39 3300027866 Ga0209813_10103577 Ga0209813_101035771 147
40 3300041512 Ga0451853_0275691 Ga0451853_0275691_534_977 147
41 3300046660 Ga0495625_0451628 Ga0495625_0451628_79_522 147
42 3300049573 Ga0501037_1129168 Ga0501037_1129168_31_474 147
43 3300049576 Ga0501040_0426025 Ga0501040_0426025_270_713 147
44 3300049577 Ga0501041_0077590 Ga0501041_0077590_1249_1692 147
45 3300049588 Ga0501072_0033475 Ga0501072_0033475_1475_1918 147
46 3300049591 Ga0501075_0827471 Ga0501075_0827471_168_611 147
47 3300050495 nmdc:mga04h51_289524_c1 nmdc:mga04h51_289524_c1_167_610 147
48 3300050496 nmdc:mga07m45_24680_c2 nmdc:mga07m45_24680_c2_61_504 147
49 3300005290 Ga0065712_10145327 Ga0065712_101453272 148
50 3300005295 Ga0065707_10608253 Ga0065707_106082531 148
51 3300005327 Ga0070658_10305477 Ga0070658_103054771 148
52 3300005328 Ga0070676_10591310 Ga0070676_105913101 148
53 3300005328 Ga0070676_10981627 Ga0070676_109816271 148
54 3300005331 Ga0070670_100139975 Ga0070670_1001399752 148
55 3300005334 Ga0068869_100137939 Ga0068869_1001379395 148
56 3300005347 Ga0070668_100473214 Ga0070668_1004732141 148
57 3300005353 Ga0070669_100119208 Ga0070669_1001192084 148
58 3300005353 Ga0070669_101794735 Ga0070669_1017947351 148
59 3300005354 Ga0070675_100766045 Ga0070675_1007660451 148
60 3300005355 Ga0070671_100186612 Ga0070671_1001866122 148
61 3300005364 Ga0070673_100240849 Ga0070673_1002408492 148
62 3300005365 Ga0070688_100888194 Ga0070688_1008881942 148
63 3300005367 Ga0070667_100133885 Ga0070667_1001338855 148
64 3300005456 Ga0070678_100069864 Ga0070678_1000698646 148
65 3300005543 Ga0070672_100056459 Ga0070672_1000564596 148
66 3300005548 Ga0070665_100097276 Ga0070665_1000972766 148
67 3300005840 Ga0068870_10122848 Ga0068870_101228481 148
68 3300005843 Ga0068860_100258106 Ga0068860_1002581062 148
69 3300006186 Ga0075369_10324279 Ga0075369_103242791 148
70 3300006195 Ga0075366_10053691 Ga0075366_100536912 148
71 3300006353 Ga0075370_10070987 Ga0075370_100709873 148
72 3300006914 Ga0075436_100013752 Ga0075436_10001375211 148
73 3300006948 Ga0099826_10000171 Ga0099826_1000017111 148
74 3300009094 Ga0111539_10007854 Ga0111539_100078544 148
75 3300009094 Ga0111539_11173903 Ga0111539_111739032 148
76 3300009147 Ga0114129_10004176 Ga0114129_100041763 148
77 3300009148 Ga0105243_10727190 Ga0105243_107271902 148
78 3300009177 Ga0105248_12222005 Ga0105248_122220051 148
79 3300010375 Ga0105239_10891461 Ga0105239_108914612 148
80 3300015262 Ga0182007_10005760 Ga0182007_100057605 148
81 3300017792 Ga0163161_10000272 Ga0163161_1000027232 148
82 3300025258 Ga0209129_1007329 Ga0209129_10073294 148
83 3300025294 Ga0209025_1000230 Ga0209025_100023024 148
84 3300025903 Ga0207680_10729548 Ga0207680_107295482 148
85 3300025907 Ga0207645_10135356 Ga0207645_101353564 148
86 3300025908 Ga0207643_10064772 Ga0207643_100647723 148
87 3300025923 Ga0207681_10035011 Ga0207681_100350111 148
88 3300025927 Ga0207687_10364445 Ga0207687_103644452 148
89 3300025933 Ga0207706_10467562 Ga0207706_104675621 148
90 3300025935 Ga0207709_10396423 Ga0207709_103964231 148
91 3300025940 Ga0207691_10038712 Ga0207691_100387128 148
92 3300025940 Ga0207691_10952247 Ga0207691_109522471 148
93 3300025942 Ga0207689_10143158 Ga0207689_101431585 148
94 3300025960 Ga0207651_10784384 Ga0207651_107843841 148
95 3300025972 Ga0207668_10027468 Ga0207668_100274681 148
96 3300026023 Ga0207677_10433649 Ga0207677_104336492 148
97 3300026067 Ga0207678_10486431 Ga0207678_104864311 148
98 3300026095 Ga0207676_11232079 Ga0207676_112320792 148
99 3300026118 Ga0207675_100840929 Ga0207675_1008409291 148
100 3300026121 Ga0207683_10017721 Ga0207683_1001772111 148
101 3300027907 Ga0207428_10028882 Ga0207428_100288824 148
102 3300028379 Ga0268266_10974509 Ga0268266_109745091 148
103 3300028794 Ga0307515_10051514 Ga0307515_100515146 148
104 3300031548 Ga0307408_100005843 Ga0307408_1000058434 148
105 3300031548 Ga0307408_100532903 Ga0307408_1005329032 148
106 3300031731 Ga0307405_11421339 Ga0307405_114213391 148
107 3300031901 Ga0307406_10000605 Ga0307406_1000060516 148
108 3300031911 Ga0307412_10168121 Ga0307412_101681212 148
109 3300031911 Ga0307412_10981790 Ga0307412_109817901 148
110 3300031911 Ga0307412_11091658 Ga0307412_110916582 148
111 3300032004 Ga0307414_11504689 Ga0307414_115046892 148
112 3300032004 Ga0307414_11540031 Ga0307414_115400311 148
113 3300032005 Ga0307411_10062477 Ga0307411_100624772 148
114 3300032005 Ga0307411_10473782 Ga0307411_104737822 148
115 3300032005 Ga0307411_10580090 Ga0307411_105800902 148
116 3300037312 Ga0395899_0012585 Ga0395899_0012585_3267_3713 148
117 3300037418 Ga0395900_0029434 Ga0395900_0029434_5050_5496 148
118 3300037418 Ga0395900_0104716 Ga0395900_0104716_138_593 148
119 3300037466 Ga0395898_0156727 Ga0395898_0156727_84_530 148
120 3300037471 Ga0395905_0000953 Ga0395905_0000953_1857_2303 148
121 3300038443 Ga0395901_0092883 Ga0395901_0092883_1400_1855 148
122 3300038443 Ga0395901_0251725 Ga0395901_0251725_721_1167 148
123 3300042876 Ga0451577_0246982 Ga0451577_0246982_826_1272 148
124 3300042993 Ga0439440_0031393 Ga0439440_0031393_340_786 148
125 3300044712 Ga0453684_0564683 Ga0453684_0564683_53_499 148
126 3300044842 Ga0466957_0245388 Ga0466957_0245388_56_502 148
127 3300045051 Ga0451576_0005559 Ga0451576_0005559_1339_1785 148
128 3300045051 Ga0451576_0541010 Ga0451576_0541010_153_605 148
129 3300046452 Ga0495617_000739 Ga0495617_000739_2644_3093 148
130 3300046491 Ga0495584_0000028 Ga0495584_0000028_105242_105688 148
131 3300046492 Ga0495585_0000002 Ga0495585_0000002_294175_294624 148
132 3300046492 Ga0495585_0000188 Ga0495585_0000188_57918_58364 148
133 3300046513 Ga0495616_0001036 Ga0495616_0001036_18184_18633 148
134 3300046524 Ga0495648_0000012 Ga0495648_0000012_234693_235142 148
135 3300046538 Ga0495609_0037385 Ga0495609_0037385_322_768 148
136 3300046538 Ga0495609_0242495 Ga0495609_0242495_32_478 148
137 3300046558 Ga0495633_0002161 Ga0495633_0002161_1635_2081 148
138 3300046616 Ga0495668_0513222 Ga0495668_0513222_152_598 148
139 3300046648 Ga0495611_0199650 Ga0495611_0199650_183_632 148
140 3300046683 Ga0495658_0277010 Ga0495658_0277010_593_1039 148
141 3300046810 Ga0495660_0016048 Ga0495660_0016048_2076_2522 148
142 3300047318 Ga0495636_0543098 Ga0495636_0543098_58_504 148
143 3300047323 Ga0495683_0000133 Ga0495683_0000133_49586_50032 148
144 3300048089 Ga0495614_0500680 Ga0495614_0500680_36_482 148
145 3300048913 Ga0496110_0054817 Ga0496110_0054817_1197_1646 148
146 3300050491 nmdc:mga00v17_150244_c1 nmdc:mga00v17_150244_c1_126_599 148
147 3300050491 nmdc:mga00v17_692815_c1 nmdc:mga00v17_692815_c1_33_479 148
148 3300050493 nmdc:mga0k408_51697_c1 nmdc:mga0k408_51697_c1_813_1259 148
149 3300050494 nmdc:mga06z11_32050_c1 nmdc:mga06z11_32050_c1_620_1066 148
150 3300050496 nmdc:mga07m45_784_c1 nmdc:mga07m45_784_c1_3468_3914 148
151 3300050507 nmdc:mga05p37_3143_c1 nmdc:mga05p37_3143_c1_6951_7442 148
152 3300050508 nmdc:mga09592_12673_c1 nmdc:mga09592_12673_c1_4433_4924 148
153 3300050510 nmdc:mga06r32_581_c1 nmdc:mga06r32_581_c1_6750_7241 148
154 3300050511 nmdc:mga08y16_1802_c1 nmdc:mga08y16_1802_c1_3029_3520 148
155 3300050511 nmdc:mga08y16_47835_c1 nmdc:mga08y16_47835_c1_2107_2586 148
156 3300050514 nmdc:mga08x19_10562_c1 nmdc:mga08x19_10562_c1_5002_5448 148
157 3300050516 nmdc:mga0sz30_273817_c1 nmdc:mga0sz30_273817_c1_99_545 148
158 3300053079 Ga0500610_0082465 Ga0500610_0082465_796_1242 148
159 3300060346 Ga0587111_0012777 Ga0587111_0012777_317_763 148
160 3300003856 Ga0058692_1000016 Ga0058692_1000016155 149
161 3300005328 Ga0070676_10057585 Ga0070676_100575853 149
162 3300005336 Ga0070680_100879056 Ga0070680_1008790562 149
163 3300005339 Ga0070660_101433922 Ga0070660_1014339221 149
164 3300005345 Ga0070692_10306174 Ga0070692_103061742 149
165 3300005347 Ga0070668_100011203 Ga0070668_1000112032 149
166 3300005353 Ga0070669_100003924 Ga0070669_1000039246 149
167 3300005444 Ga0070694_100197353 Ga0070694_1001973532 149
168 3300005457 Ga0070662_100005223 Ga0070662_1000052233 149
169 3300005458 Ga0070681_10106518 Ga0070681_101065184 149
170 3300005564 Ga0070664_100258672 Ga0070664_1002586722 149
171 3300005577 Ga0068857_100311238 Ga0068857_1003112383 149
172 3300005618 Ga0068864_101834556 Ga0068864_1018345561 149
173 3300005719 Ga0068861_100001549 Ga0068861_1000015494 149
174 3300005840 Ga0068870_10017501 Ga0068870_100175015 149
175 3300005844 Ga0068862_100004887 Ga0068862_1000048877 149
176 3300006844 Ga0075428_100178579 Ga0075428_1001785793 149
177 3300006846 Ga0075430_100007599 Ga0075430_1000075998 149
178 3300006846 Ga0075430_100062593 Ga0075430_1000625935 149
179 3300006847 Ga0075431_100038324 Ga0075431_1000383244 149
180 3300006847 Ga0075431_100333508 Ga0075431_1003335082 149
181 3300006880 Ga0075429_100450530 Ga0075429_1004505302 149
182 3300006880 Ga0075429_101064443 Ga0075429_1010644431 149
183 3300006881 Ga0068865_100730275 Ga0068865_1007302752 149
184 3300009094 Ga0111539_10046776 Ga0111539_100467765 149
185 3300009094 Ga0111539_10338897 Ga0111539_103388972 149
186 3300009148 Ga0105243_10579582 Ga0105243_105795821 149
187 3300009174 Ga0105241_10489057 Ga0105241_104890571 149
188 3300009553 Ga0105249_10002479 Ga0105249_1000247923 149
189 3300010375 Ga0105239_11012432 Ga0105239_110124322 149
190 3300013306 Ga0163162_10129036 Ga0163162_101290363 149
191 3300014326 Ga0157380_11302994 Ga0157380_113029942 149
192 3300025907 Ga0207645_10066426 Ga0207645_100664261 149
193 3300025908 Ga0207643_10005514 Ga0207643_100055144 149
194 3300025912 Ga0207707_10067223 Ga0207707_100672233 149
195 3300025923 Ga0207681_10017501 Ga0207681_100175014 149
196 3300025933 Ga0207706_10008577 Ga0207706_100085779 149
197 3300025935 Ga0207709_10377029 Ga0207709_103770292 149
198 3300025938 Ga0207704_10368743 Ga0207704_103687432 149
199 3300025945 Ga0207679_10061027 Ga0207679_100610273 149
200 3300025961 Ga0207712_10704208 Ga0207712_107042082 149
201 3300025972 Ga0207668_10014073 Ga0207668_100140733 149
202 3300026095 Ga0207676_10104518 Ga0207676_101045183 149
203 3300026116 Ga0207674_10098912 Ga0207674_100989124 149
204 3300026118 Ga0207675_100000354 Ga0207675_10000035434 149
205 3300027312 Ga0209371_1000051 Ga0209371_1000051112 149
206 3300027907 Ga0207428_10022581 Ga0207428_100225814 149
207 3300028379 Ga0268266_11044150 Ga0268266_110441502 149
208 3300028380 Ga0268265_10008662 Ga0268265_100086626 149
209 3300030500 Ga0268256_1000052 Ga0268256_1000052154 149
210 3300041452 Ga0451793_1553743 Ga0451793_1553743_352_801 149
211 3300041459 Ga0451800_0583250 Ga0451800_0583250_587_1036 149
212 3300041460 Ga0451802_0983814 Ga0451802_0983814_240_689 149
213 3300041503 Ga0451847_0814566 Ga0451847_0814566_295_750 149
214 3300041997 Ga0439431_0029947 Ga0439431_0029947_536_991 149
215 3300042004 Ga0439445_0202504 Ga0439445_0202504_75_530 149
216 3300042156 Ga0439446_0066132 Ga0439446_0066132_246_701 149
217 3300042435 Ga0439434_0065599 Ga0439434_0065599_549_1004 149
218 3300042532 Ga0450893_0026560 Ga0450893_0026560_184_639 149
219 3300044712 Ga0453684_0012166 Ga0453684_0012166_11820_12275 149
220 3300045051 Ga0451576_0000656 Ga0451576_0000656_7599_8054 149
221 3300047472 Ga0495686_0069290 Ga0495686_0069290_1421_1873 149
222 3300049586 Ga0501070_0073875 Ga0501070_0073875_43_528 149
223 3300049592 Ga0501076_0655557 Ga0501076_0655557_177_626 149
224 3300049742 Ga0501080_0263564 Ga0501080_0263564_327_812 149
225 3300050508 nmdc:mga09592_982050_c1 nmdc:mga09592_982050_c1_173_622 149
226 3300050509 nmdc:mga0qj67_12615_c1 nmdc:mga0qj67_12615_c1_5811_6260 149
227 3300050509 nmdc:mga0qj67_1422240_c1 nmdc:mga0qj67_1422240_c1_42_491 149
228 3300050510 nmdc:mga06r32_116067_c1 nmdc:mga06r32_116067_c1_1794_2243 149
229 3300050510 nmdc:mga06r32_21004_c1 nmdc:mga06r32_21004_c1_2078_2527 149
230 3300050510 nmdc:mga06r32_462722_c1 nmdc:mga06r32_462722_c1_254_703 149
231 3300050511 nmdc:mga08y16_267637_c1 nmdc:mga08y16_267637_c1_661_1110 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

48

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.994 5 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9936 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9921 5 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9794 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9711 5 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9934 4 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9789 4 145 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8482 2 143 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8389 5 143 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8386 1 143 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1P8JZT5-F1-model_v4 Polyketide cyclase 0.9983 2 147
AF-A0A3C0B758-F1-model_v4 Polyketide cyclase 0.9971 50 131
AF-A0A7V9MUU5-F1-model_v4 SRPBCC family protein 0.9969 2 148
AF-A0A7Y4WXE4-F1-model_v4 SRPBCC family protein 0.9964 4 149
AF-A0A1C6NIL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9963 1 145

Feature Viewer

pLDDT pTM Quality
95.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map