F344484

General Info

Members Datasets Scaffolds Average Seq Length
231 132 227 276

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0337933|Ga0501080_0337933_57_1016
Length 309
Sequence VLGAPIKFRLAKENATDSPPAGSFDLHEFPFLLCSAFMNLAFTKYHALGNDYIVINPKDLSAPLTTEQVKTICHRNFGVGSDGILLGPLPAENAKCALKIYNPDGSIAEKSGNGLRIFSRYLWDTKFVGNDEFAIQTDGGLVRSTVFAGGKMVRVEMGKVSFDSEKIPVTGAKREVINEKISVGGREFTFCAATIGNPHCVLPLPEISAGLAHEFGPLLEVHPNFPRKTNVQFLKVRDRANIQIEIWERGAGYTLASAHKLGLVDKNVSVHCPGGIIKIEIRDGFDILMTGSVTKVSEGVISPEIFSAD

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
66 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
67 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
80 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
132 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10112967 3300003320 Bacteria 13975
2 Ga0068869_100000593 3300005334 Bacteria 20315
3 Ga0070689_100023870 3300005340 Bacteria 4584
4 Ga0070689_100066082 3300005340 Bacteria 2817
5 Ga0070709_10014236 3300005434 Bacteria 4496
6 Ga0070714_100013373 3300005435 Bacteria 6578
7 Ga0070711_100002009 3300005439 Bacteria 11454
8 Ga0070708_100578707 3300005445 Bacteria 1059
9 Ga0070681_10070041 3300005458 Bacteria 3473
10 Ga0070681_10204341 3300005458 Bacteria 1893
11 Ga0070707_100529637 3300005468 Bacteria 1140
12 Ga0070679_100067822 3300005530 Bacteria 3558
13 Ga0068855_100013070 3300005563 Bacteria 10013
14 Ga0068855_100059893 3300005563 Bacteria 4454
15 Ga0068855_100355196 3300005563 Bacteria 1614
16 Ga0068856_100000160 3300005614 Bacteria 69926
17 Ga0068856_100002151 3300005614 Bacteria 20406
18 Ga0068856_100011530 3300005614 Bacteria 8575
19 Ga0068856_100070898 3300005614 Bacteria 3448
20 Ga0068859_100106711 3300005617 Bacteria 2860
21 Ga0068862_100625262 3300005844 Bacteria 1036
22 Ga0075431_100548872 3300006847 Bacteria 1143
23 Ga0097620_100106706 3300006931 Bacteria 2860
24 Ga0097620_100606089 3300006931 Bacteria 1188
25 Ga0105240_10216342 3300009093 Bacteria 2235
26 Ga0105240_10402329 3300009093 Bacteria 1542
27 Ga0111539_10164742 3300009094 Bacteria 2592
28 Ga0105238_10008508 3300009551 Bacteria 10270
29 Ga0105238_10061991 3300009551 Bacteria 3741
30 Ga0105238_10177867 3300009551 Bacteria 2104
31 Ga0157372_10490383 3300013307 Unclassified 1433
32 Ga0157375_10393112 3300013308 Bacteria 1553
33 Ga0157380_10199696 3300014326 Bacteria 1773
34 Ga0213872_10014898 3300021361 Bacteria 3620
35 Ga0213872_10075339 3300021361 Bacteria 1519
36 Ga0213872_10078655 3300021361 Bacteria 1482
37 Ga0213872_10092390 3300021361 Bacteria 1354
38 Ga0213876_10005415 3300021384 Bacteria 7025
39 Ga0213871_10025018 3300021441 Bacteria 1517
40 Ga0207699_10077369 3300025906 Bacteria 2052
41 Ga0207707_10102189 3300025912 Bacteria 2506
42 Ga0207695_10035653 3300025913 Bacteria 5390
43 Ga0207663_10002022 3300025916 Bacteria 9639
44 Ga0207652_10044796 3300025921 Bacteria 3770
45 Ga0207694_10045527 3300025924 Bacteria 3389
46 Ga0207694_10183254 3300025924 Bacteria 1699
47 Ga0207670_10034900 3300025936 Bacteria 3256
48 Ga0207670_10112500 3300025936 Bacteria 1965
49 Ga0207665_10156739 3300025939 Bacteria 1635
50 Ga0207667_10107480 3300025949 Unclassified 2879
51 Ga0207667_10248385 3300025949 Unclassified 1820
52 Ga0207667_10335027 3300025949 Bacteria 1545
53 Ga0207708_10153637 3300026075 Bacteria 1814
54 Ga0207702_10000736 3300026078 Bacteria 34979
55 Ga0207702_10000885 3300026078 Bacteria 31187
56 Ga0207702_10009506 3300026078 Bacteria 8164
57 Ga0207641_10032685 3300026088 Bacteria 4321
58 Ga0207674_10199369 3300026116 Unclassified 1951
59 Ga0265337_1000255 3300028556 Bacteria 28809
60 Ga0265337_1010857 3300028556 Bacteria 3167
61 Ga0265337_1057162 3300028556 Bacteria 1086
62 Ga0265326_10029918 3300028558 Bacteria 1551
63 Ga0265319_1000016 3300028563 Bacteria 176245
64 Ga0265319_1000053 3300028563 Bacteria 94221
65 Ga0265319_1063284 3300028563 Bacteria 1197
66 Ga0265334_10023463 3300028573 Bacteria 2508
67 Ga0265318_10000963 3300028577 Bacteria 18482
68 Ga0265323_10021065 3300028653 Unclassified 2502
69 Ga0265336_10010998 3300028666 Bacteria 3084
70 Ga0265336_10051040 3300028666 Bacteria 1249
71 Ga0265338_10000220 3300028800 Bacteria 106037
72 Ga0265338_10001944 3300028800 Bacteria 32265
73 Ga0265338_10002229 3300028800 Bacteria 29539
74 Ga0265338_10012018 3300028800 Bacteria 9909
75 Ga0265338_10045174 3300028800 Bacteria 4054
76 Ga0265338_10073023 3300028800 Bacteria 2926
77 Ga0265338_10100384 3300028800 Bacteria 2361
78 Ga0265338_10125603 3300028800 Bacteria 2036
79 Ga0265338_10225761 3300028800 Bacteria 1396
80 Ga0265338_10251844 3300028800 Bacteria 1302
81 Ga0265324_10000316 3300029957 Bacteria 35472
82 Ga0265324_10002438 3300029957 Bacteria 9523
83 Ga0265324_10016791 3300029957 Bacteria 2665
84 Ga0265324_10031355 3300029957 Bacteria 1862
85 Ga0265324_10037117 3300029957 Bacteria 1694
86 Ga0265320_10005101 3300031240 Bacteria 8483
87 Ga0265320_10018123 3300031240 Bacteria 3887
88 Ga0265325_10015330 3300031241 Bacteria 4311
89 Ga0265339_10102709 3300031249 Bacteria 1486
90 Ga0265327_10001342 3300031251 Bacteria 31932
91 Ga0265327_10008420 3300031251 Bacteria 7682
92 Ga0265316_10129556 3300031344 Bacteria 1901
93 Ga0265316_10192266 3300031344 Bacteria 1515
94 Ga0265316_10298365 3300031344 Bacteria 1174
95 Ga0307408_100000033 3300031548 Bacteria 212574
96 Ga0265313_10001669 3300031595 Bacteria 20533
97 Ga0265313_10003086 3300031595 Bacteria 13812
98 Ga0265314_10028935 3300031711 Bacteria 4123
99 Ga0265314_10067647 3300031711 Bacteria 2404
100 Ga0265342_10049375 3300031712 Bacteria 2518
101 Ga0265342_10187348 3300031712 Bacteria 1131
102 Ga0316578_10039965 3300031728 Bacteria 2710
103 Ga0307410_10000008 3300031852 Bacteria 93917
104 Ga0307407_10086455 3300031903 Bacteria 1910
105 Ga0307407_10154806 3300031903 Bacteria 1493
106 Ga0307407_10161270 3300031903 Bacteria 1467
107 Ga0307409_100000274 3300031995 Bacteria 20897
108 Ga0373930_0016945 3300034816 Bacteria 1383
109 Ga0373928_0000022 3300035084 Bacteria 27033
110 Ga0373929_0000066 3300035085 Bacteria 17808
111 Ga0373944_0000026 3300035089 Bacteria 25249
112 Ga0373949_0010054 3300035090 Bacteria 2070
113 Ga0373932_0000005 3300035112 Bacteria 259528
114 Ga0373954_0056279 3300035118 Bacteria 1851
115 Ga0373956_0040357 3300035119 Bacteria 2070
116 Ga0373962_0000721 3300035242 Bacteria 7476
117 Ga0373931_0000016 3300035691 Bacteria 217932
118 Ga0373927_0136718 3300035695 Bacteria 1602
119 Ga0373947_0010966 3300035725 Bacteria 5201
120 Ga0373925_0000371 3300037068 Bacteria 46792
121 Ga0373925_0008185 3300037068 Bacteria 7611
122 Ga0436364_1534455 3300037853 Bacteria 1261
123 Ga0400490_46714 3300038726 Bacteria 5955
124 Ga0400483_003009 3300039062 Bacteria 1934
125 Ga0400483_186374 3300039062 Bacteria 1709
126 Ga0400489_11059 3300039093 Unclassified 1621
127 Ga0400489_55143 3300039093 Bacteria 1116
128 Ga0400487_64172 3300039110 Bacteria 1932
129 Ga0436365_1147197 3300039437 Bacteria 51071
130 Ga0436360_0120256 3300039438 Bacteria 6051
131 Ga0436360_0628619 3300039438 Unclassified 1300
132 Ga0436361_0178817 3300039447 Bacteria 2730
133 Ga0436361_0255556 3300039447 Bacteria 2676
134 Ga0436361_0348672 3300039447 Bacteria 3999
135 Ga0436361_0564859 3300039447 Bacteria 1319
136 Ga0436361_0652977 3300039447 Bacteria 1372
137 Ga0436361_0690171 3300039447 Bacteria 5576
138 Ga0436363_1562846 3300039450 Bacteria 8622
139 Ga0436362_0457527 3300039453 Bacteria 1689
140 Ga0436362_0933503 3300039453 Bacteria 2938
141 Ga0451577_0000012 3300042876 Bacteria 575467
142 Ga0451577_0124214 3300042876 Bacteria 2313
143 Ga0466969_0066855 3300044656 Bacteria 1735
144 Ga0453683_0006766 3300044673 Bacteria 7832
145 Ga0466966_0073079 3300044684 Bacteria 2146
146 Ga0453684_0000266 3300044712 Bacteria 225447
147 Ga0453684_0021954 3300044712 Bacteria 9500
148 Ga0453684_0144017 3300044712 Bacteria 2841
149 Ga0453684_0153692 3300044712 Bacteria 2731
150 Ga0453684_0335483 3300044712 Bacteria 1709
151 Ga0451576_0000183 3300045051 Bacteria 157422
152 Ga0451576_0002006 3300045051 Bacteria 32254
153 Ga0451576_0009167 3300045051 Bacteria 11499
154 Ga0451576_0015961 3300045051 Bacteria 8302
155 Ga0451576_0166745 3300045051 Bacteria 2299
156 Ga0451576_0207918 3300045051 Bacteria 2044
157 Ga0451576_0667280 3300045051 Bacteria 1092
158 Ga0495629_0025595 3300046459 Bacteria 4193
159 Ga0495618_0202165 3300046514 Bacteria 1257
160 Ga0495630_0091933 3300046517 Bacteria 2293
161 Ga0495630_0314263 3300046517 Bacteria 1198
162 Ga0495586_0034219 3300046535 Bacteria 2728
163 Ga0495622_0009966 3300046557 Unclassified 4395
164 Ga0495667_0043263 3300046559 Bacteria 2985
165 Ga0495634_0021383 3300046642 Bacteria 4574
166 Ga0495635_0236614 3300046663 Bacteria 1233
167 Ga0495613_0011941 3300046689 Bacteria 6456
168 Ga0495684_0269243 3300047471 Bacteria 1233
169 Ga0501031_0001479 3300049568 Bacteria 14597
170 Ga0501032_0000630 3300049569 Bacteria 28576
171 Ga0501032_0002579 3300049569 Bacteria 14179
172 Ga0501032_0020762 3300049569 Bacteria 4572
173 Ga0501032_0149400 3300049569 Unclassified 1537
174 Ga0501033_0001657 3300049570 Bacteria 19493
175 Ga0501033_0002094 3300049570 Bacteria 17297
176 Ga0501033_0024941 3300049570 Bacteria 4506
177 Ga0501034_0046109 3300049571 Bacteria 4404
178 Ga0501036_0193138 3300049572 Bacteria 1713
179 Ga0501036_0205710 3300049572 Bacteria 1655
180 Ga0501036_0258629 3300049572 Bacteria 1458
181 Ga0501037_0023158 3300049573 Bacteria 4593
182 Ga0501038_0006296 3300049574 Bacteria 10977
183 Ga0501039_0028118 3300049575 Bacteria 4326
184 Ga0501039_0079120 3300049575 Bacteria 2558
185 Ga0501040_0057345 3300049576 Bacteria 2674
186 Ga0501042_0212373 3300049578 Bacteria 1396
187 Ga0501043_0194646 3300049579 Bacteria 1575
188 Ga0501046_0001375 3300049580 Bacteria 23420
189 Ga0501046_0007594 3300049580 Bacteria 9510
190 Ga0501046_0070236 3300049580 Bacteria 2723
191 Ga0501047_0008005 3300049581 Bacteria 9967
192 Ga0501047_0092610 3300049581 Bacteria 2901
193 Ga0501047_0101836 3300049581 Bacteria 2751
194 Ga0501047_0148934 3300049581 Bacteria 2216
195 Ga0501047_0196741 3300049581 Bacteria 1878
196 Ga0501068_0025282 3300049584 Bacteria 3493
197 Ga0501070_0438117 3300049586 Bacteria 1054
198 Ga0501072_0142247 3300049588 Bacteria 1913
199 Ga0501075_0115504 3300049591 Bacteria 2041
200 Ga0501075_0274319 3300049591 Bacteria 1285
201 Ga0501075_0348617 3300049591 Bacteria 1128
202 Ga0501077_0019688 3300049593 Bacteria 4269
203 Ga0501077_0072722 3300049593 Bacteria 2179
204 Ga0501079_0046478 3300049741 Bacteria 3350
205 Ga0501080_0290337 3300049742 Bacteria 1485
206 Ga0501080_0337933 3300049742 Bacteria 1361
207 Ga0501083_0006172 3300049744 Bacteria 8500
208 Ga0501083_0152405 3300049744 Bacteria 1513
209 Ga0501035_0002668 3300049822 Bacteria 17364
210 Ga0501035_0034342 3300049822 Bacteria 4608
211 Ga0501035_0041617 3300049822 Bacteria 4148
212 Ga0501035_0085258 3300049822 Bacteria 2785
213 Ga0501044_0001754 3300049823 Bacteria 25321
214 Ga0501044_0002137 3300049823 Bacteria 22644
215 Ga0501044_0002836 3300049823 Bacteria 19727
216 Ga0501044_0011989 3300049823 Bacteria 9391
217 Ga0501044_0021336 3300049823 Bacteria 6913
218 Ga0501044_0108003 3300049823 Bacteria 2793
219 Ga0501044_0393723 3300049823 Bacteria 1299
220 Ga0501045_0245837 3300049824 Bacteria 1332
221 Ga0501045_0276160 3300049824 Bacteria 1251
222 Ga0501045_0371238 3300049824 Bacteria 1065
223 nmdc:mga06r32_526767_c1 3300050510 Bacteria 1157
224 nmdc:mga08y16_135816_c1 3300050511 Bacteria 2556
225 Ga0500568_0037847 3300053139 Bacteria 1955
226 Ga0501082_0073017 3300060353 Bacteria 2955
227 Ga0530510_0015229 3300061734 Bacteria 5430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0193138 Ga0501036_0193138_898_1686 249
2 iso_pu_bacteria 8007371054 8007372601 251
3 3300049575 Ga0501039_0079120 Ga0501039_0079120_337_1143 255
4 3300049576 Ga0501040_0057345 Ga0501040_0057345_548_1354 255
5 3300049578 Ga0501042_0212373 Ga0501042_0212373_571_1377 255
6 3300049588 Ga0501072_0142247 Ga0501072_0142247_11_817 255
7 3300049591 Ga0501075_0115504 Ga0501075_0115504_465_1271 255
8 3300049591 Ga0501075_0274319 Ga0501075_0274319_318_1124 255
9 3300049591 Ga0501075_0348617 Ga0501075_0348617_43_849 255
10 3300049593 Ga0501077_0072722 Ga0501077_0072722_556_1362 255
11 3300049741 Ga0501079_0046478 Ga0501079_0046478_122_928 255
12 3300049824 Ga0501045_0276160 Ga0501045_0276160_96_902 255
13 3300049824 Ga0501045_0371238 Ga0501045_0371238_160_966 255
14 3300061734 Ga0530510_0015229 Ga0530510_0015229_2978_3784 255
15 3300049581 Ga0501047_0092610 Ga0501047_0092610_1718_2539 257
16 3300005434 Ga0070709_10014236 Ga0070709_100142363 258
17 3300005435 Ga0070714_100013373 Ga0070714_1000133732 258
18 3300025906 Ga0207699_10077369 Ga0207699_100773692 258
19 3300025939 Ga0207665_10156739 Ga0207665_101567392 258
20 3300028563 Ga0265319_1063284 Ga0265319_10632842 259
21 3300028800 Ga0265338_10125603 Ga0265338_101256032 259
22 3300039093 Ga0400489_55143 Ga0400489_55143_147_1001 260
23 3300005468 Ga0070707_100529637 Ga0070707_1005296371 262
24 3300039438 Ga0436360_0628619 Ga0436360_0628619_28_855 262
25 3300039447 Ga0436361_0652977 Ga0436361_0652977_498_1325 262
26 3300039453 Ga0436362_0933503 Ga0436362_0933503_1732_2568 262
27 3300005563 Ga0068855_100355196 Ga0068855_1003551961 263
28 3300025949 Ga0207667_10335027 Ga0207667_103350271 263
29 3300021361 Ga0213872_10092390 Ga0213872_100923901 264
30 3300028653 Ga0265323_10021065 Ga0265323_100210652 264
31 3300037853 Ga0436364_1534455 Ga0436364_1534455_253_1116 264
32 3300039447 Ga0436361_0348672 Ga0436361_0348672_1160_2029 264
33 3300039450 Ga0436363_1562846 Ga0436363_1562846_196_1026 264
34 3300021361 Ga0213872_10014898 Ga0213872_100148982 265
35 3300021384 Ga0213876_10005415 Ga0213876_100054153 265
36 3300021441 Ga0213871_10025018 Ga0213871_100250182 265
37 3300028556 Ga0265337_1000255 Ga0265337_100025516 265
38 3300028666 Ga0265336_10051040 Ga0265336_100510402 265
39 3300028800 Ga0265338_10012018 Ga0265338_1001201810 265
40 3300039093 Ga0400489_11059 Ga0400489_11059_605_1441 265
41 3300039437 Ga0436365_1147197 Ga0436365_1147197_5934_6800 265
42 3300039438 Ga0436360_0120256 Ga0436360_0120256_526_1362 265
43 3300039447 Ga0436361_0255556 Ga0436361_0255556_1737_2573 265
44 3300039447 Ga0436361_0690171 Ga0436361_0690171_2193_3026 265
45 3300049570 Ga0501033_0024941 Ga0501033_0024941_2683_3537 265
46 3300049580 Ga0501046_0001375 Ga0501046_0001375_4832_5686 265
47 3300049581 Ga0501047_0196741 Ga0501047_0196741_28_882 265
48 3300049823 Ga0501044_0011989 Ga0501044_0011989_315_1169 265
49 3300005439 Ga0070711_100002009 Ga0070711_1000020098 266
50 3300021361 Ga0213872_10078655 Ga0213872_100786552 266
51 3300025916 Ga0207663_10002022 Ga0207663_100020224 266
52 3300028573 Ga0265334_10023463 Ga0265334_100234633 266
53 3300028800 Ga0265338_10002229 Ga0265338_1000222910 266
54 3300039447 Ga0436361_0178817 Ga0436361_0178817_797_1642 266
55 3300039453 Ga0436362_0457527 Ga0436362_0457527_810_1649 266
56 iso_pu_bacteria 8002745576 8002747023 266
57 3300021361 Ga0213872_10075339 Ga0213872_100753391 267
58 3300039447 Ga0436361_0564859 Ga0436361_0564859_40_888 267
59 3300028800 Ga0265338_10000220 Ga0265338_1000022050 268
60 3300028800 Ga0265338_10045174 Ga0265338_100451745 268
61 3300028800 Ga0265338_10073023 Ga0265338_100730232 268
62 3300031240 Ga0265320_10018123 Ga0265320_100181233 268
63 3300031344 Ga0265316_10192266 Ga0265316_101922662 268
64 3300031712 Ga0265342_10049375 Ga0265342_100493752 268
65 3300038726 Ga0400490_46714 Ga0400490_46714_4680_5516 268
66 3300039062 Ga0400483_003009 Ga0400483_003009_324_1232 268
67 3300005614 Ga0068856_100011530 Ga0068856_1000115303 269
68 3300005844 Ga0068862_100625262 Ga0068862_1006252621 269
69 3300009551 Ga0105238_10061991 Ga0105238_100619914 269
70 3300025924 Ga0207694_10045527 Ga0207694_100455274 269
71 3300026078 Ga0207702_10009506 Ga0207702_100095067 269
72 3300028558 Ga0265326_10029918 Ga0265326_100299182 269
73 3300028800 Ga0265338_10001944 Ga0265338_1000194426 269
74 3300029957 Ga0265324_10002438 Ga0265324_100024382 269
75 3300031249 Ga0265339_10102709 Ga0265339_101027092 269
76 3300031712 Ga0265342_10187348 Ga0265342_101873482 269
77 3300046557 Ga0495622_0009966 Ga0495622_0009966_3075_3917 269
78 3300006847 Ga0075431_100548872 Ga0075431_1005488721 270
79 3300009551 Ga0105238_10177867 Ga0105238_101778672 270
80 3300025924 Ga0207694_10183254 Ga0207694_101832542 270
81 3300028563 Ga0265319_1000016 Ga0265319_100001629 270
82 3300028800 Ga0265338_10100384 Ga0265338_101003842 270
83 3300029957 Ga0265324_10000316 Ga0265324_1000031625 270
84 3300029957 Ga0265324_10016791 Ga0265324_100167912 270
85 3300031240 Ga0265320_10005101 Ga0265320_100051015 270
86 3300031241 Ga0265325_10015330 Ga0265325_100153302 270
87 3300031251 Ga0265327_10001342 Ga0265327_1000134219 270
88 3300031251 Ga0265327_10008420 Ga0265327_100084203 270
89 3300031344 Ga0265316_10129556 Ga0265316_101295562 270
90 3300031344 Ga0265316_10298365 Ga0265316_102983651 270
91 3300031595 Ga0265313_10003086 Ga0265313_1000308610 270
92 3300031728 Ga0316578_10039965 Ga0316578_100399652 270
93 3300044712 Ga0453684_0335483 Ga0453684_0335483_392_1252 270
94 3300045051 Ga0451576_0166745 Ga0451576_0166745_249_1085 270
95 3300045051 Ga0451576_0667280 Ga0451576_0667280_141_998 270
96 3300046517 Ga0495630_0091933 Ga0495630_0091933_500_1336 270
97 3300046559 Ga0495667_0043263 Ga0495667_0043263_78_920 270
98 3300049742 Ga0501080_0337933 Ga0501080_0337933_57_1016 270
99 3300049822 Ga0501035_0085258 Ga0501035_0085258_1628_2476 270
100 3300050510 nmdc:mga06r32_526767_c1 nmdc:mga06r32_526767_c1_56_904 270
101 3300005445 Ga0070708_100578707 Ga0070708_1005787071 271
102 3300005614 Ga0068856_100070898 Ga0068856_1000708985 271
103 3300009093 Ga0105240_10402329 Ga0105240_104023291 271
104 3300014326 Ga0157380_10199696 Ga0157380_101996961 271
105 3300031903 Ga0307407_10086455 Ga0307407_100864552 271
106 3300034816 Ga0373930_0016945 Ga0373930_0016945_144_1019 271
107 3300035084 Ga0373928_0000022 Ga0373928_0000022_4523_5398 271
108 3300035085 Ga0373929_0000066 Ga0373929_0000066_15166_16041 271
109 3300035089 Ga0373944_0000026 Ga0373944_0000026_24297_25172 271
110 3300035090 Ga0373949_0010054 Ga0373949_0010054_783_1658 271
111 3300035112 Ga0373932_0000005 Ga0373932_0000005_122466_123341 271
112 3300035242 Ga0373962_0000721 Ga0373962_0000721_5890_6765 271
113 3300035691 Ga0373931_0000016 Ga0373931_0000016_136188_137063 271
114 3300035725 Ga0373947_0010966 Ga0373947_0010966_389_1264 271
115 3300037068 Ga0373925_0000371 Ga0373925_0000371_23733_24608 271
116 3300039062 Ga0400483_186374 Ga0400483_186374_300_1172 271
117 3300039110 Ga0400487_64172 Ga0400487_64172_310_1212 271
118 3300044712 Ga0453684_0144017 Ga0453684_0144017_385_1269 271
119 3300049823 Ga0501044_0393723 Ga0501044_0393723_273_1121 271
120 iso_pu_bacteria 2913912277 2913920087 271
121 3300005340 Ga0070689_100023870 Ga0070689_1000238702 272
122 3300005340 Ga0070689_100066082 Ga0070689_1000660822 272
123 3300005563 Ga0068855_100013070 Ga0068855_10001307012 272
124 3300005617 Ga0068859_100106711 Ga0068859_1001067112 272
125 3300006931 Ga0097620_100106706 Ga0097620_1001067062 272
126 3300006931 Ga0097620_100606089 Ga0097620_1006060892 272
127 3300009094 Ga0111539_10164742 Ga0111539_101647422 272
128 3300013307 Ga0157372_10490383 Ga0157372_104903831 272
129 3300025936 Ga0207670_10034900 Ga0207670_100349002 272
130 3300025936 Ga0207670_10112500 Ga0207670_101125002 272
131 3300025949 Ga0207667_10107480 Ga0207667_101074802 272
132 3300026075 Ga0207708_10153637 Ga0207708_101536371 272
133 3300026088 Ga0207641_10032685 Ga0207641_100326855 272
134 3300028556 Ga0265337_1010857 Ga0265337_10108572 272
135 3300028800 Ga0265338_10251844 Ga0265338_102518442 272
136 3300035118 Ga0373954_0056279 Ga0373954_0056279_345_1202 272
137 3300035119 Ga0373956_0040357 Ga0373956_0040357_150_1007 272
138 3300035695 Ga0373927_0136718 Ga0373927_0136718_15_860 272
139 3300037068 Ga0373925_0008185 Ga0373925_0008185_2276_3208 272
140 3300046459 Ga0495629_0025595 Ga0495629_0025595_3014_3871 272
141 3300046514 Ga0495618_0202165 Ga0495618_0202165_62_919 272
142 3300046517 Ga0495630_0314263 Ga0495630_0314263_277_1134 272
143 3300046535 Ga0495586_0034219 Ga0495586_0034219_1847_2704 272
144 3300046642 Ga0495634_0021383 Ga0495634_0021383_1808_2665 272
145 3300046663 Ga0495635_0236614 Ga0495635_0236614_336_1193 272
146 3300046689 Ga0495613_0011941 Ga0495613_0011941_1308_2165 272
147 3300047471 Ga0495684_0269243 Ga0495684_0269243_96_953 272
148 3300049568 Ga0501031_0001479 Ga0501031_0001479_10082_10933 272
149 3300049569 Ga0501032_0020762 Ga0501032_0020762_1709_2560 272
150 3300049569 Ga0501032_0149400 Ga0501032_0149400_131_985 272
151 3300049570 Ga0501033_0002094 Ga0501033_0002094_1575_2426 272
152 3300049572 Ga0501036_0205710 Ga0501036_0205710_407_1261 272
153 3300049593 Ga0501077_0019688 Ga0501077_0019688_397_1263 272
154 3300049822 Ga0501035_0034342 Ga0501035_0034342_2723_3574 272
155 3300049823 Ga0501044_0002137 Ga0501044_0002137_12679_13530 272
156 3300049823 Ga0501044_0021336 Ga0501044_0021336_639_1493 272
157 3300050511 nmdc:mga08y16_135816_c1 nmdc:mga08y16_135816_c1_680_1531 272
158 iso_pu_bacteria 2786546940 2788436539 272
159 3300005458 Ga0070681_10070041 Ga0070681_100700412 273
160 3300005563 Ga0068855_100059893 Ga0068855_1000598933 273
161 3300005614 Ga0068856_100000160 Ga0068856_10000016062 273
162 3300009093 Ga0105240_10216342 Ga0105240_102163422 273
163 3300009551 Ga0105238_10008508 Ga0105238_100085085 273
164 3300025912 Ga0207707_10102189 Ga0207707_101021891 273
165 3300025913 Ga0207695_10035653 Ga0207695_100356531 273
166 3300025949 Ga0207667_10248385 Ga0207667_102483852 273
167 3300026078 Ga0207702_10000885 Ga0207702_100008859 273
168 3300028556 Ga0265337_1057162 Ga0265337_10571621 273
169 3300028800 Ga0265338_10225761 Ga0265338_102257611 273
170 3300029957 Ga0265324_10031355 Ga0265324_100313552 273
171 3300029957 Ga0265324_10037117 Ga0265324_100371171 273
172 3300044712 Ga0453684_0000266 Ga0453684_0000266_203914_204759 273
173 3300028563 Ga0265319_1000053 Ga0265319_100005356 274
174 3300028577 Ga0265318_10000963 Ga0265318_100009638 274
175 3300031711 Ga0265314_10067647 Ga0265314_100676472 274
176 3300042876 Ga0451577_0000012 Ga0451577_0000012_63163_64065 274
177 3300049744 Ga0501083_0006172 Ga0501083_0006172_5465_6328 274
178 3300049744 Ga0501083_0152405 Ga0501083_0152405_596_1456 274
179 3300005458 Ga0070681_10204341 Ga0070681_102043412 275
180 3300005530 Ga0070679_100067822 Ga0070679_1000678223 275
181 3300013308 Ga0157375_10393112 Ga0157375_103931122 275
182 3300025921 Ga0207652_10044796 Ga0207652_100447964 275
183 3300042876 Ga0451577_0124214 Ga0451577_0124214_10_864 275
184 3300045051 Ga0451576_0000183 Ga0451576_0000183_136071_136931 275
185 3300045051 Ga0451576_0002006 Ga0451576_0002006_21162_22097 275
186 3300045051 Ga0451576_0009167 Ga0451576_0009167_3448_4302 275
187 3300049569 Ga0501032_0000630 Ga0501032_0000630_2123_2977 275
188 3300049569 Ga0501032_0002579 Ga0501032_0002579_6676_7527 275
189 3300049570 Ga0501033_0001657 Ga0501033_0001657_6461_7315 275
190 3300049571 Ga0501034_0046109 Ga0501034_0046109_2978_3832 275
191 3300049572 Ga0501036_0258629 Ga0501036_0258629_436_1290 275
192 3300049573 Ga0501037_0023158 Ga0501037_0023158_436_1290 275
193 3300049574 Ga0501038_0006296 Ga0501038_0006296_6019_6873 275
194 3300049575 Ga0501039_0028118 Ga0501039_0028118_108_962 275
195 3300049579 Ga0501043_0194646 Ga0501043_0194646_659_1513 275
196 3300049580 Ga0501046_0007594 Ga0501046_0007594_8514_9365 275
197 3300049580 Ga0501046_0070236 Ga0501046_0070236_146_997 275
198 3300049581 Ga0501047_0008005 Ga0501047_0008005_689_1540 275
199 3300049581 Ga0501047_0101836 Ga0501047_0101836_1755_2606 275
200 3300049581 Ga0501047_0148934 Ga0501047_0148934_665_1519 275
201 3300049584 Ga0501068_0025282 Ga0501068_0025282_1939_2793 275
202 3300049586 Ga0501070_0438117 Ga0501070_0438117_43_897 275
203 3300049742 Ga0501080_0290337 Ga0501080_0290337_425_1276 275
204 3300049822 Ga0501035_0002668 Ga0501035_0002668_8429_9280 275
205 3300049822 Ga0501035_0041617 Ga0501035_0041617_13_867 275
206 3300049823 Ga0501044_0001754 Ga0501044_0001754_22848_23702 275
207 3300049823 Ga0501044_0002836 Ga0501044_0002836_10796_11647 275
208 3300049823 Ga0501044_0108003 Ga0501044_0108003_1905_2759 275
209 3300049824 Ga0501045_0245837 Ga0501045_0245837_127_981 275
210 3300053139 Ga0500568_0037847 Ga0500568_0037847_410_1261 275
211 3300060353 Ga0501082_0073017 Ga0501082_0073017_440_1294 275
212 3300003320 rootH2_10112967 rootH2_101129673 276
213 3300005334 Ga0068869_100000593 Ga0068869_1000005938 276
214 3300005614 Ga0068856_100002151 Ga0068856_1000021515 276
215 3300026078 Ga0207702_10000736 Ga0207702_1000073621 276
216 3300026116 Ga0207674_10199369 Ga0207674_101993693 276
217 3300028666 Ga0265336_10010998 Ga0265336_100109982 276
218 3300031548 Ga0307408_100000033 Ga0307408_100000033139 276
219 3300031595 Ga0265313_10001669 Ga0265313_1000166918 276
220 3300031711 Ga0265314_10028935 Ga0265314_100289353 276
221 3300031852 Ga0307410_10000008 Ga0307410_1000000836 276
222 3300031903 Ga0307407_10154806 Ga0307407_101548061 276
223 3300031903 Ga0307407_10161270 Ga0307407_101612701 276
224 3300031995 Ga0307409_100000274 Ga0307409_1000002743 276
225 3300044656 Ga0466969_0066855 Ga0466969_0066855_32_892 276
226 3300044673 Ga0453683_0006766 Ga0453683_0006766_74_928 276
227 3300044684 Ga0466966_0073079 Ga0466966_0073079_742_1602 276
228 3300044712 Ga0453684_0021954 Ga0453684_0021954_1684_2538 276
229 3300044712 Ga0453684_0153692 Ga0453684_0153692_86_946 276
230 3300045051 Ga0451576_0015961 Ga0451576_0015961_6976_7830 276
231 3300045051 Ga0451576_0207918 Ga0451576_0207918_793_1653 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

42

162

0.98

PF01678

DAP_epimerase

Diaminopimelate epimerase

191

296

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d13-assembly1.cif.gz_A crystal structure of e.coli rpph-dapf complex 0.9011 1 268
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8984 1 265
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8978 1 273
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8855 1 273
4ik0-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase y268a mutant from escherichia coli 0.8815 1 268
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9183 152 255 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9056 1 112 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9051 140 249 3.10.310.10
2otnB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8991 122 255 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8826 1 112 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A7C5LLB0-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9781 1 143 GO:0005829
GO:0008837
GO:0009089
AF-A0A7C5LLB0-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9713 1 143 GO:0005829
GO:0008837
GO:0009089
AF-A0A3B9S173-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9682 60 276 GO:0005829
GO:0008837
GO:0009089
AF-A0A2V5WNS9-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9613 1 203 GO:0005829
GO:0008837
GO:0009089
AF-A0A7C4T402-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.961 82 273 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
93.1 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map