F344585

General Info

Members Datasets Scaffolds Average Seq Length
231 194 462 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935390628|2935393867
Length 353
Sequence LAVTLSTGDHCGMTSYPTATAASDVTPHANPITAPSPAPITAAAAGTWVLGDLEVNRIGFGTMRLPQTGEALIPDAVPRDRDLAVAVLRRAVELGVNHFDTAAFYFSRLLSANELINRALAPYADEVVVTTKVGPGRDANGEWQEHARTPAQLRGQVEENLRQLGRDHLDVVNLRVVGEDSVAERFGALADLRAAGLIRHLGLSNVRPHHLAEARAIAPVVCVQNAYGLGSSPDQAEFLRACGEQGVAFVPFYAIAGAGRTAGAAGGGERGYAGDADADADGHAEDALRRVARAHGVSQAQVRLAWSLHQGPHVLAIPGTGDPDHLAQNVAAGAVRLSAHDLAALDAQARAAG

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
76 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
157 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
158 2643221548 Streptomyces sp. Root55 Isolate Unclassified
159 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
160 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
161 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
162 2643221714 Streptomyces sp. Root264 Isolate Unclassified
163 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
164 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
165 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
166 2867428634 Streptomyces sp. RP5T Isolate Unclassified
167 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
168 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
169 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
170 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
171 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
172 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
173 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
174 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
175 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
176 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
177 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
178 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
179 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
180 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
181 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
182 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
183 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
184 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
185 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
186 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
187 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
188 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
189 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
190 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
191 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
192 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
193 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
194 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.82
Metatranscriptomes 0
Isolates 18.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 0
Rhizoplane 6.93
Rhizosphere 71.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1006447 3300002737 Bacteria 2029
2 JGI25164J39214_1001626 3300002772 Bacteria 4705
3 JGI25165J46597_1000107 3300003214 Bacteria 150846
4 JGI25153J46596_10033905 3300003215 Bacteria 1677
5 rootH1_10017793 3300003316 Bacteria 6930
6 rootH2_10159379 3300003320 Bacteria 9415
7 rootL2_10154778 3300003322 Bacteria 1642
8 rootH1_10057906 3300003323 Bacteria 4053
9 Ga0055532_1003706 3300003758 Bacteria 2510
10 Ga0055527_1000001 3300003760 Bacteria 850044
11 Ga0055529_1000065 3300003763 Bacteria 173112
12 Ga0070658_10026549 3300005327 Bacteria 4645
13 Ga0070660_100013739 3300005339 Bacteria 5822
14 Ga0070661_100065282 3300005344 Bacteria 2674
15 Ga0070659_100268495 3300005366 Bacteria 1417
16 Ga0070714_100096253 3300005435 Bacteria 2601
17 Ga0070714_100218113 3300005435 Bacteria 1752
18 Ga0070713_100052183 3300005436 Bacteria 3385
19 Ga0070713_100066759 3300005436 Bacteria 3026
20 Ga0070679_100053800 3300005530 Bacteria 4007
21 Ga0070665_100042664 3300005548 Bacteria 4560
22 Ga0068857_100056907 3300005577 Bacteria 3471
23 Ga0081455_10095431 3300005937 Bacteria 2400
24 Ga0070717_10183143 3300006028 Bacteria 1827
25 Ga0075363_100026431 3300006048 Bacteria 2969
26 Ga0105239_10310292 3300010375 Bacteria 1778
27 Ga0157369_10019678 3300013105 Bacteria 7555
28 Ga0157372_10108554 3300013307 Bacteria 3176
29 Ga0183367_1003 3300015688 Bacteria 814276
30 Ga0213875_10000363 3300021388 Bacteria 42235
31 Ga0209672_100006 3300025228 Bacteria 1004497
32 Ga0209147_102140 3300025229 Bacteria 5453
33 Ga0207427_100028 3300025231 Bacteria 388949
34 Ga0209437_100533 3300025233 Bacteria 26415
35 Ga0209258_105785 3300025242 Bacteria 2034
36 Ga0209148_1000015 3300025254 Bacteria 850103
37 Ga0209233_1000001 3300025261 Bacteria 2992747
38 Ga0209455_1000013 3300025272 Bacteria 850103
39 Ga0209758_1004515 3300025297 Bacteria 11533
40 Ga0207426_1017079 3300025302 Bacteria 2589
41 Ga0207705_10163175 3300025909 Bacteria 1675
42 Ga0207700_10083441 3300025928 Bacteria 2501
43 Ga0207664_10108004 3300025929 Bacteria 2310
44 Ga0207661_10017922 3300025944 Bacteria 5251
45 Ga0207679_10196240 3300025945 Bacteria 1683
46 Ga0207702_10084212 3300026078 Bacteria 2768
47 Ga0207674_10017930 3300026116 Bacteria 7715
48 Ga0268266_10031235 3300028379 Bacteria 4522
49 Ga0265337_1000343 3300028556 Bacteria 24866
50 Ga0265326_10008132 3300028558 Bacteria 3176
51 Ga0265319_1000384 3300028563 Bacteria 31990
52 Ga0265334_10000247 3300028573 Bacteria 31180
53 Ga0265318_10024058 3300028577 Bacteria 2421
54 Ga0265323_10007161 3300028653 Bacteria 4652
55 Ga0265322_10005753 3300028654 Bacteria 3660
56 Ga0265336_10004260 3300028666 Bacteria 5441
57 Ga0307515_10238593 3300028794 Bacteria 1594
58 Ga0265338_10008090 3300028800 Bacteria 12851
59 Ga0265324_10000995 3300029957 Bacteria 17419
60 Ga0307511_10028403 3300030521 Bacteria 5079
61 Ga0307511_10047816 3300030521 Bacteria 3493
62 Ga0265332_10024820 3300031238 Bacteria 2635
63 Ga0265320_10017192 3300031240 Bacteria 4025
64 Ga0265325_10025530 3300031241 Bacteria 3207
65 Ga0265340_10026747 3300031247 Bacteria 2913
66 Ga0265316_10010734 3300031344 Bacteria 8322
67 Ga0307513_10000002 3300031456 Bacteria 842612
68 Ga0307513_10045521 3300031456 Bacteria 4795
69 Ga0265313_10013932 3300031595 Bacteria 4786
70 Ga0307508_10184431 3300031616 Bacteria 1689
71 Ga0265314_10005959 3300031711 Bacteria 10883
72 Ga0265342_10007361 3300031712 Bacteria 8073
73 Ga0395900_0596955 3300037418 Bacteria 1045
74 Ga0395898_0003326 3300037466 Bacteria 18055
75 Ga0395898_0191543 3300037466 Bacteria 1954
76 Ga0436364_1018157 3300037853 Bacteria 78603
77 Ga0395901_0046593 3300038443 Bacteria 4504
78 Ga0395901_0118793 3300038443 Bacteria 2778
79 Ga0439439_0000318 3300041406 Bacteria 7768
80 Ga0451793_0031782 3300041452 Bacteria 1893
81 Ga0451802_1532034 3300041460 Bacteria 2461
82 Ga0439449_0009152 3300042007 Bacteria 3755
83 Ga0439457_008975 3300042014 Bacteria 2340
84 Ga0466969_0073416 3300044656 Bacteria 1642
85 Ga0466972_0006377 3300044658 Bacteria 5926
86 Ga0466972_0006826 3300044658 Bacteria 5731
87 Ga0466972_0034335 3300044658 Bacteria 2486
88 Ga0466965_0007140 3300044683 Bacteria 5115
89 Ga0466965_0058991 3300044683 Bacteria 1914
90 Ga0466965_0186851 3300044683 Bacteria 1095
91 Ga0466966_0001620 3300044684 Bacteria 14498
92 Ga0466961_0000576 3300044693 Bacteria 23314
93 Ga0466961_0022565 3300044693 Bacteria 4049
94 Ga0466963_0000279 3300044694 Bacteria 22827
95 Ga0466964_0003280 3300044706 Bacteria 5887
96 Ga0466971_0008676 3300044719 Bacteria 4434
97 Ga0466970_0000264 3300044765 Bacteria 25682
98 Ga0466957_0001635 3300044842 Bacteria 11755
99 Ga0466959_0000297 3300045049 Bacteria 29628
100 Ga0466958_0000301 3300045836 Bacteria 19375
101 Ga0466967_0005722 3300045976 Bacteria 8672
102 Ga0466967_0041677 3300045976 Bacteria 3961
103 Ga0466967_0054188 3300045976 Bacteria 3528
104 Ga0495592_0007728 3300046454 Bacteria 8053
105 Ga0495603_0002129 3300046455 Bacteria 11645
106 Ga0495603_0020573 3300046455 Bacteria 3997
107 Ga0495629_0022789 3300046459 Bacteria 4462
108 Ga0495629_0070343 3300046459 Bacteria 2441
109 Ga0495629_0078040 3300046459 Bacteria 2312
110 Ga0495651_0014508 3300046462 Bacteria 6092
111 Ga0495605_0019694 3300046474 Bacteria 3599
112 Ga0495594_0022487 3300046499 Bacteria 3373
113 Ga0495583_0064835 3300046506 Bacteria 1619
114 Ga0495606_0001661 3300046507 Bacteria 28901
115 Ga0495620_0038223 3300046515 Bacteria 2131
116 Ga0495628_0062438 3300046516 Bacteria 2920
117 Ga0495628_0065894 3300046516 Bacteria 2832
118 Ga0495643_0006220 3300046522 Bacteria 7919
119 Ga0495648_0106074 3300046524 Bacteria 1539
120 Ga0495652_0171008 3300046529 Bacteria 1677
121 Ga0495652_0251480 3300046529 Bacteria 1309
122 Ga0495640_0028093 3300046533 Bacteria 4052
123 Ga0495640_0100955 3300046533 Bacteria 1894
124 Ga0495645_0041003 3300046543 Bacteria 3376
125 Ga0495668_0000247 3300046616 Bacteria 77012
126 Ga0495634_0157556 3300046642 Bacteria 1433
127 Ga0495625_0001829 3300046660 Bacteria 24341
128 Ga0495625_0110274 3300046660 Bacteria 1881
129 Ga0495635_0099353 3300046663 Bacteria 1989
130 Ga0495613_0015013 3300046689 Bacteria 5749
131 Ga0495613_0026779 3300046689 Bacteria 4294
132 Ga0495589_0002710 3300046794 Bacteria 9792
133 Ga0495581_0108251 3300047315 Bacteria 1615
134 Ga0495604_0066788 3300047317 Bacteria 2734
135 Ga0495636_0006835 3300047318 Bacteria 4486
136 Ga0495674_0340044 3300047319 Bacteria 1220
137 Ga0495672_0067499 3300047320 Bacteria 2037
138 Ga0495676_0003054 3300047321 Bacteria 15139
139 Ga0495676_0007347 3300047321 Bacteria 10111
140 Ga0495676_0130754 3300047321 Bacteria 1812
141 Ga0495683_0039059 3300047323 Bacteria 2400
142 Ga0495687_000773 3300047443 Bacteria 34590
143 Ga0495687_042374 3300047443 Bacteria 1989
144 Ga0495687_068841 3300047443 Bacteria 1427
145 Ga0495675_0003141 3300047444 Bacteria 9915
146 Ga0495675_0209014 3300047444 Bacteria 1186
147 Ga0495685_031294 3300047447 Bacteria 1829
148 Ga0495593_0016435 3300047673 Bacteria 4174
149 Ga0495614_0026843 3300048089 Bacteria 2482
150 Ga0495626_0000273 3300048091 Bacteria 56906
151 Ga0496100_0167303 3300048903 Bacteria 1580
152 Ga0496101_0012165 3300048904 Bacteria 5736
153 Ga0496102_0107358 3300048905 Bacteria 2599
154 Ga0496103_0035511 3300048906 Bacteria 3052
155 Ga0496105_0137922 3300048908 Bacteria 2008
156 Ga0496106_0332313 3300048909 Bacteria 1220
157 Ga0496107_0382157 3300048910 Bacteria 1047
158 Ga0496108_0080224 3300048911 Bacteria 2764
159 Ga0496109_0061611 3300048912 Bacteria 3430
160 Ga0496111_0020757 3300048914 Bacteria 4578
161 Ga0496112_0326657 3300048915 Bacteria 1478
162 Ga0496113_0013615 3300048916 Bacteria 5518
163 Ga0496114_0028009 3300048917 Bacteria 4619
164 Ga0496115_0026384 3300048918 Bacteria 4534
165 Ga0496120_0041930 3300048923 Bacteria 2676
166 Ga0501033_0011649 3300049570 Bacteria 6724
167 Ga0501036_0282550 3300049572 Bacteria 1389
168 Ga0501038_0001431 3300049574 Bacteria 21881
169 Ga0501043_0130749 3300049579 Bacteria 1967
170 Ga0501047_0041574 3300049581 Bacteria 4442
171 Ga0501047_0115022 3300049581 Bacteria 2572
172 Ga0501047_0228036 3300049581 Bacteria 1717
173 Ga0501080_0160751 3300049742 Bacteria 2074
174 Ga0501035_0014651 3300049822 Bacteria 7238
175 Ga0501035_0043039 3300049822 Bacteria 4071
176 Ga0501035_0089029 3300049822 Bacteria 2719
177 Ga0501035_0117826 3300049822 Bacteria 2323
178 Ga0501044_0073447 3300049823 Bacteria 3476
179 Ga0501044_0075543 3300049823 Bacteria 3421
180 Ga0501044_0134488 3300049823 Bacteria 2464
181 Ga0501044_0160827 3300049823 Bacteria 2222
182 Ga0501044_0384054 3300049823 Bacteria 1319
183 Ga0501045_0392682 3300049824 Bacteria 1033
184 Ga0495601_0011101 3300053077 Bacteria 5384
185 Ga0495612_0015085 3300053078 Bacteria 3097
186 Ga0495619_0107069 3300053085 Bacteria 1907
187 Ga0500573_0081919 3300053140 Bacteria 1833
188 Ga0466962_0004101 3300061719 Bacteria 6977
189 Ga0466962_0059396 3300061719 Bacteria 1825
190 2935393867 2935390628 Bacteria 7043367
191 2547408876 2547132111 Bacteria 8013147
192 2585297386 2582581312 Bacteria 7308206
193 2585320388 2582581314 Bacteria 11452267
194 2643765190 2643221548 Bacteria 8053412
195 2644015639 2643221601 Bacteria 7493239
196 2644177368 2643221631 Bacteria 8168043
197 2644460972 2643221682 Bacteria 6743283
198 2644630793 2643221714 Bacteria 9015452
199 2804846918 2802429296 Bacteria 7227771
200 2819744367 2818991472 Bacteria 10089953
201 2819744407 2818991472 Bacteria 10089953
202 2862184850 2862178590 Bacteria 8583590
203 2867437256 2867428634 Bacteria 9590268
204 2875394983 2875391855 Bacteria 7600475
205 2884702119 2884693830 Bacteria 11273186
206 2887486146 2887478801 Bacteria 8972725
207 2891397231 2891395885 Bacteria 9251614
208 2895445339 2895442618 Bacteria 11027144
209 2906800645 2906799679 Bacteria 4031749
210 2912726798 2912723979 Bacteria 8557534
211 2946048267 2946045630 Bacteria 8527308
212 2946073024 2946072368 Bacteria 8999607
213 2947224557 2947224130 Bacteria 9938529
214 2954008178 2954002825 Bacteria 9173742
215 2954719122 2954711539 Bacteria 10867210
216 2954729092 2954721474 Bacteria 10456478
217 2954732719 2954731030 Bacteria 10243860
218 2954747992 2954740390 Bacteria 10229294
219 2954751597 2954749733 Bacteria 10366972
220 2954767117 2954759201 Bacteria 9358192
221 2990066049 2990059506 Bacteria 9321252
222 2995469940 2995463766 Bacteria 8577691
223 2996223606 2996221748 Bacteria 6799777
224 3006396701 3006393351 Bacteria 6615579
225 8008581410 8008574985 Bacteria 7815457
226 8023624574 8023623736 Bacteria 8593882
227 8025417814 8025413630 Bacteria 7014048
228 8025532021 8025530807 Bacteria 8495698
229 8055066169 8055066027 Bacteria 9479577
230 8056671083 8056667051 Bacteria 6953971
231 8056831002 8056829672 Bacteria 9045328
232 JGI25162J39368_1006447
233 JGI25164J39214_1001626
234 JGI25165J46597_1000107
235 JGI25153J46596_10033905
236 rootH1_10017793
237 rootH2_10159379
238 rootL2_10154778
239 rootH1_10057906
240 Ga0055532_1003706
241 Ga0055527_1000001
242 Ga0055529_1000065
243 Ga0070658_10026549
244 Ga0070660_100013739
245 Ga0070661_100065282
246 Ga0070659_100268495
247 Ga0070714_100096253
248 Ga0070714_100218113
249 Ga0070713_100052183
250 Ga0070713_100066759
251 Ga0070679_100053800
252 Ga0070665_100042664
253 Ga0068857_100056907
254 Ga0081455_10095431
255 Ga0070717_10183143
256 Ga0075363_100026431
257 Ga0105239_10310292
258 Ga0157369_10019678
259 Ga0157372_10108554
260 Ga0183367_1003
261 Ga0213875_10000363
262 Ga0209672_100006
263 Ga0209147_102140
264 Ga0207427_100028
265 Ga0209437_100533
266 Ga0209258_105785
267 Ga0209148_1000015
268 Ga0209233_1000001
269 Ga0209455_1000013
270 Ga0209758_1004515
271 Ga0207426_1017079
272 Ga0207705_10163175
273 Ga0207700_10083441
274 Ga0207664_10108004
275 Ga0207661_10017922
276 Ga0207679_10196240
277 Ga0207702_10084212
278 Ga0207674_10017930
279 Ga0268266_10031235
280 Ga0265337_1000343
281 Ga0265326_10008132
282 Ga0265319_1000384
283 Ga0265334_10000247
284 Ga0265318_10024058
285 Ga0265323_10007161
286 Ga0265322_10005753
287 Ga0265336_10004260
288 Ga0307515_10238593
289 Ga0265338_10008090
290 Ga0265324_10000995
291 Ga0307511_10028403
292 Ga0307511_10047816
293 Ga0265332_10024820
294 Ga0265320_10017192
295 Ga0265325_10025530
296 Ga0265340_10026747
297 Ga0265316_10010734
298 Ga0307513_10000002
299 Ga0307513_10045521
300 Ga0265313_10013932
301 Ga0307508_10184431
302 Ga0265314_10005959
303 Ga0265342_10007361
304 Ga0395900_0596955
305 Ga0395898_0003326
306 Ga0395898_0191543
307 Ga0436364_1018157
308 Ga0395901_0046593
309 Ga0395901_0118793
310 Ga0439439_0000318
311 Ga0451793_0031782
312 Ga0451802_1532034
313 Ga0439449_0009152
314 Ga0439457_008975
315 Ga0466969_0073416
316 Ga0466972_0006377
317 Ga0466972_0006826
318 Ga0466972_0034335
319 Ga0466965_0007140
320 Ga0466965_0058991
321 Ga0466965_0186851
322 Ga0466966_0001620
323 Ga0466961_0000576
324 Ga0466961_0022565
325 Ga0466963_0000279
326 Ga0466964_0003280
327 Ga0466971_0008676
328 Ga0466970_0000264
329 Ga0466957_0001635
330 Ga0466959_0000297
331 Ga0466958_0000301
332 Ga0466967_0005722
333 Ga0466967_0041677
334 Ga0466967_0054188
335 Ga0495592_0007728
336 Ga0495603_0002129
337 Ga0495603_0020573
338 Ga0495629_0022789
339 Ga0495629_0070343
340 Ga0495629_0078040
341 Ga0495651_0014508
342 Ga0495605_0019694
343 Ga0495594_0022487
344 Ga0495583_0064835
345 Ga0495606_0001661
346 Ga0495620_0038223
347 Ga0495628_0062438
348 Ga0495628_0065894
349 Ga0495643_0006220
350 Ga0495648_0106074
351 Ga0495652_0171008
352 Ga0495652_0251480
353 Ga0495640_0028093
354 Ga0495640_0100955
355 Ga0495645_0041003
356 Ga0495668_0000247
357 Ga0495634_0157556
358 Ga0495625_0001829
359 Ga0495625_0110274
360 Ga0495635_0099353
361 Ga0495613_0015013
362 Ga0495613_0026779
363 Ga0495589_0002710
364 Ga0495581_0108251
365 Ga0495604_0066788
366 Ga0495636_0006835
367 Ga0495674_0340044
368 Ga0495672_0067499
369 Ga0495676_0003054
370 Ga0495676_0007347
371 Ga0495676_0130754
372 Ga0495683_0039059
373 Ga0495687_000773
374 Ga0495687_042374
375 Ga0495687_068841
376 Ga0495675_0003141
377 Ga0495675_0209014
378 Ga0495685_031294
379 Ga0495593_0016435
380 Ga0495614_0026843
381 Ga0495626_0000273
382 Ga0496100_0167303
383 Ga0496101_0012165
384 Ga0496102_0107358
385 Ga0496103_0035511
386 Ga0496105_0137922
387 Ga0496106_0332313
388 Ga0496107_0382157
389 Ga0496108_0080224
390 Ga0496109_0061611
391 Ga0496111_0020757
392 Ga0496112_0326657
393 Ga0496113_0013615
394 Ga0496114_0028009
395 Ga0496115_0026384
396 Ga0496120_0041930
397 Ga0501033_0011649
398 Ga0501036_0282550
399 Ga0501038_0001431
400 Ga0501043_0130749
401 Ga0501047_0041574
402 Ga0501047_0115022
403 Ga0501047_0228036
404 Ga0501080_0160751
405 Ga0501035_0014651
406 Ga0501035_0043039
407 Ga0501035_0089029
408 Ga0501035_0117826
409 Ga0501044_0073447
410 Ga0501044_0075543
411 Ga0501044_0134488
412 Ga0501044_0160827
413 Ga0501044_0384054
414 Ga0501045_0392682
415 Ga0495601_0011101
416 Ga0495612_0015085
417 Ga0495619_0107069
418 Ga0500573_0081919
419 Ga0466962_0004101
420 Ga0466962_0059396
421 2935393867
422 2547408876
423 2585297386
424 2585320388
425 2643765190
426 2644015639
427 2644177368
428 2644460972
429 2644630793
430 2804846918
431 2819744367
432 2819744407
433 2862184850
434 2867437256
435 2875394983
436 2884702119
437 2887486146
438 2891397231
439 2895445339
440 2906800645
441 2912726798
442 2946048267
443 2946073024
444 2947224557
445 2954008178
446 2954719122
447 2954729092
448 2954732719
449 2954747992
450 2954751597
451 2954767117
452 2990066049
453 2995469940
454 2996223606
455 3006396701
456 8008581410
457 8023624574
458 8025417814
459 8025532021
460 8055066169
461 8056671083
462 8056831002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

57

350

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9177 21 299
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8864 26 302
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8802 24 304
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8721 21 302
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8655 21 299
ID Description Score Start End Superfamily
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.926 23 300 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9125 23 302 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9067 23 300 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8802 24 304 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8721 21 302 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A0F2TLX7-F1-model_v4 Aldo/keto reductase 0.9759 21 299 GO:0004033
GO:0005737
AF-A0A4D4LGX4-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9744 148 302 GO:0016491
AF-A0A4R2QBM3-F1-model_v4 deleted 0.9721 21 301
AF-A0A7W7RYD1-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase/predicted acetyltransferase 0.9691 21 299 GO:0004033
GO:0005737
GO:0016747
AF-A0A6B2RS58-F1-model_v4 Aldo/keto reductase 0.9687 21 299 GO:0004033
GO:0005737

Map