F344680

General Info

Members Datasets Scaffolds Average Seq Length
232 167 464 245

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10116243|Ga0065704_101162431
Length 292
Sequence MNRKDFIKKGLMGTGMFITSAAVGDALKNDIDEITPLEPIGFNHLPNPGSLVLENTVLHKAGTRGHANHGWLDSHHTFSFANYNNPDRMHFGVLRVLNDDRVDPGMGFGTHPHDNMEIISIPLEGDLEHKDSMNNTAVIRKGDIQVMSAGTGIYHSEYNKNKDKLTKFLQIWVYPNKRNVMPRYGQITLDETARRNNLQQILSPNPDDEGVWIHQDAWFHLGTFDTDKKANYSLKKKGNGIYAFVIKGDFTIGTIELNQRDGLGIWDTDEISITANSQDAEILLMEVPMALR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
137 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
144 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
145 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
157 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
158 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
159 2818991444 Filimonas endophytica 3197 Isolate Unclassified
160 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
161 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
162 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
163 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
164 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
165 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
166 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
167 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0.86
Isolates 5.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.69
Nodule 0
Rhizoplane 0.86
Rhizosphere 61.64
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10116243 3300005289 Bacteria 1857
2 JGI24737J22298_10005818 3300001990 Bacteria 4247
3 rootH1_10004248 3300003316 Bacteria 8793
4 rootH1_10133126 3300003316 Bacteria 1733
5 rootH2_10001435 3300003320 Bacteria 37408
6 rootH2_10008247 3300003320 Bacteria 78702
7 rootH2_10224914 3300003320 Unclassified 1343
8 rootL2_10018380 3300003322 Bacteria 5385
9 rootL2_10028258 3300003322 Bacteria 3575
10 rootL2_10041893 3300003322 Bacteria 10734
11 rootL2_10131298 3300003322 Bacteria 7512
12 rootL2_10210924 3300003322 Bacteria 2734
13 rootH1_10022040 3300003323 Bacteria 12049
14 rootH1_10097521 3300003323 Bacteria 6753
15 rootH1_10104502 3300003323 Bacteria 1498
16 JGI25160J50197_1008651 3300003354 Bacteria 3859
17 Ga0055542_1004127 3300003762 Bacteria 3652
18 Ga0055526_1045723 3300003771 Bacteria 1044
19 Ga0055528_1000552 3300003790 Bacteria 28584
20 Ga0055530_10011765 3300003791 Bacteria 3110
21 Ga0055531_10000036 3300003794 Bacteria 147042
22 Ga0055543_1006512 3300004625 Bacteria 2811
23 Ga0065165_1000010 3300005262 Bacteria 323737
24 Ga0065165_1003270 3300005262 Bacteria 11693
25 Ga0065714_10004751 3300005288 Bacteria 5784
26 Ga0065714_10074717 3300005288 Bacteria 2975
27 Ga0065704_10212192 3300005289 Bacteria 1104
28 Ga0070690_100331075 3300005330 Bacteria 1100
29 Ga0068869_100006045 3300005334 Bacteria 7657
30 Ga0070666_10000185 3300005335 Bacteria 42683
31 Ga0070689_100492917 3300005340 Bacteria 1048
32 Ga0070669_100301232 3300005353 Bacteria 1289
33 Ga0070671_100156412 3300005355 Bacteria 1926
34 Ga0070667_100042562 3300005367 Unclassified 3811
35 Ga0068855_100108278 3300005563 Bacteria 3192
36 Ga0068855_100148013 3300005563 Bacteria 2672
37 Ga0068854_100075894 3300005578 Bacteria 2469
38 Ga0068856_100422080 3300005614 Bacteria 1354
39 Ga0068852_100008187 3300005616 Bacteria 7681
40 Ga0068859_100000013 3300005617 Bacteria 291126
41 Ga0068864_100062003 3300005618 Bacteria 3239
42 Ga0068863_100015573 3300005841 Bacteria 7306
43 Ga0068858_100014471 3300005842 Bacteria 7434
44 Ga0068860_100052013 3300005843 Bacteria 3896
45 Ga0081455_10388473 3300005937 Bacteria 972
46 Ga0075366_10000038 3300006195 Bacteria 46485
47 Ga0075366_10033246 3300006195 Bacteria 3037
48 Ga0097621_100004954 3300006237 Bacteria 9336
49 Ga0097621_100046435 3300006237 Bacteria 3514
50 Ga0075370_10245332 3300006353 Bacteria 1061
51 Ga0068871_100012714 3300006358 Bacteria 6222
52 Ga0068871_100075852 3300006358 Unclassified 2776
53 Ga0068865_100047931 3300006881 Unclassified 2939
54 Ga0097620_100000013 3300006931 Bacteria 291126
55 Ga0105240_10000011 3300009093 Bacteria 523646
56 Ga0105240_10427902 3300009093 Bacteria 1486
57 Ga0105247_10046132 3300009101 Unclassified 2674
58 Ga0105241_10000686 3300009174 Bacteria 25490
59 Ga0105237_10004476 3300009545 Bacteria 16155
60 Ga0105237_10332888 3300009545 Bacteria 1522
61 Ga0105237_10720467 3300009545 Bacteria 1004
62 Ga0105238_10271392 3300009551 Unclassified 1677
63 Ga0105249_10006427 3300009553 Bacteria 10217
64 Ga0105239_10000089 3300010375 Bacteria 129415
65 Ga0105239_10000161 3300010375 Bacteria 97242
66 Ga0105239_10000425 3300010375 Bacteria 61548
67 Ga0105239_10010893 3300010375 Bacteria 10159
68 Ga0105239_10052683 3300010375 Bacteria 4463
69 Ga0105246_10058774 3300011119 Bacteria 2665
70 Ga0157371_10162517 3300013102 Bacteria 1595
71 Ga0157370_10055105 3300013104 Bacteria 3789
72 Ga0157374_10000004 3300013296 Bacteria 759774
73 Ga0157374_10528444 3300013296 Bacteria 1186
74 Ga0157378_10026220 3300013297 Bacteria 5138
75 Ga0163162_10001214 3300013306 Bacteria 24073
76 Ga0163162_10017317 3300013306 Bacteria 7050
77 Ga0163162_10032006 3300013306 Bacteria 5220
78 Ga0163162_10503438 3300013306 Bacteria 1341
79 Ga0157372_10005758 3300013307 Bacteria 13205
80 Ga0157375_10060549 3300013308 Bacteria 3755
81 Ga0182008_10001371 3300014497 Bacteria 16489
82 Ga0157379_10011365 3300014968 Bacteria 7764
83 Ga0157379_10030543 3300014968 Bacteria 4797
84 Ga0157376_10058583 3300014969 Bacteria 3227
85 Ga0157376_10177687 3300014969 Unclassified 1943
86 Ga0157376_10455907 3300014969 Bacteria 1248
87 Ga0182006_1002835 3300015261 Bacteria 9245
88 Ga0182005_1000458 3300015265 Bacteria 21410
89 Ga0163161_10005095 3300017792 Bacteria 9147
90 Ga0163161_10025024 3300017792 Bacteria 4221
91 Ga0209436_101541 3300025208 Bacteria 7834
92 Ga0209258_100036 3300025242 Bacteria 428859
93 Ga0209026_1002848 3300025250 Bacteria 6110
94 Ga0209148_1000139 3300025254 Bacteria 167011
95 Ga0209129_1007980 3300025258 Bacteria 3025
96 Ga0209233_1007383 3300025261 Bacteria 3486
97 Ga0209673_1000082 3300025273 Bacteria 219716
98 Ga0209676_1000370 3300025292 Bacteria 83303
99 Ga0209564_1019192 3300025295 Bacteria 2568
100 Ga0209564_1037797 3300025295 Bacteria 1354
101 Ga0209758_1002720 3300025297 Bacteria 17416
102 Ga0209758_1044261 3300025297 Bacteria 1629
103 Ga0209050_1000389 3300025298 Bacteria 82517
104 Ga0207426_1002748 3300025302 Bacteria 10650
105 Ga0207426_1012340 3300025302 Unclassified 3213
106 Ga0209257_1000008 3300025304 Bacteria 1294570
107 Ga0209257_1006346 3300025304 Bacteria 7683
108 Ga0207710_10026702 3300025900 Bacteria 2496
109 Ga0207680_10000083 3300025903 Bacteria 42904
110 Ga0207647_10031279 3300025904 Bacteria 3426
111 Ga0207695_10000010 3300025913 Bacteria 981919
112 Ga0207671_10001991 3300025914 Bacteria 22515
113 Ga0207671_10027499 3300025914 Bacteria 4252
114 Ga0207671_10035610 3300025914 Bacteria 3692
115 Ga0207671_10081732 3300025914 Bacteria 2424
116 Ga0207644_10100330 3300025931 Bacteria 2174
117 Ga0207670_10772711 3300025936 Bacteria 799
118 Ga0207704_10061163 3300025938 Unclassified 2334
119 Ga0207689_10009576 3300025942 Bacteria 8356
120 Ga0207667_10020056 3300025949 Bacteria 7443
121 Ga0207667_10033580 3300025949 Bacteria 5515
122 Ga0207712_10126099 3300025961 Bacteria 1944
123 Ga0207640_10022037 3300025981 Bacteria 3807
124 Ga0207677_10464923 3300026023 Bacteria 1087
125 Ga0207703_10002119 3300026035 Bacteria 17466
126 Ga0207641_10000159 3300026088 Bacteria 96072
127 Ga0207648_10076704 3300026089 Bacteria 2913
128 Ga0207698_10013839 3300026142 Bacteria 5341
129 Ga0268264_10086983 3300028381 Bacteria 2686
130 Ga0307515_10000001 3300028794 Bacteria 4259510
131 Ga0307515_10000411 3300028794 Bacteria 103597
132 Ga0307515_10000528 3300028794 Bacteria 90438
133 Ga0307515_10003943 3300028794 Bacteria 30968
134 Ga0307515_10012211 3300028794 Bacteria 16189
135 Ga0307515_10026411 3300028794 Bacteria 9996
136 Ga0307515_10037236 3300028794 Bacteria 7832
137 Ga0307515_10263058 3300028794 Unclassified 1458
138 Ga0307515_10310942 3300028794 Bacteria 1251
139 Ga0307513_10125286 3300031456 Bacteria 2526
140 Ga0307407_10001062 3300031903 Bacteria 9518
141 Ga0307411_10003574 3300032005 Bacteria 7246
142 Ga0316580_10035175 3300032139 Unclassified 1550
143 Ga0307507_10001000 3300033179 Bacteria 62890
144 Ga0307510_10066922 3300033180 Bacteria 3623
145 Ga0395899_0000001 3300037312 Bacteria 1750322
146 Ga0451577_0170939 3300042876 Bacteria 1958
147 Ga0453683_0248967 3300044673 Unclassified 1132
148 Ga0466961_0100041 3300044693 Bacteria 1827
149 Ga0453684_0000084 3300044712 Bacteria 398306
150 Ga0453684_0000604 3300044712 Bacteria 132335
151 Ga0453684_0046463 3300044712 Bacteria 5774
152 Ga0453684_0254337 3300044712 Bacteria 2016
153 Ga0453684_0358030 3300044712 Bacteria 1643
154 Ga0453684_0468169 3300044712 Bacteria 1400
155 Ga0466957_0036419 3300044842 Bacteria 2958
156 Ga0466959_0002393 3300045049 Bacteria 11965
157 Ga0451576_0000003 3300045051 Bacteria 1550573
158 Ga0451576_0000176 3300045051 Bacteria 161951
159 Ga0466958_0050492 3300045836 Bacteria 2518
160 Ga0495629_0167811 3300046459 Bacteria 1524
161 Ga0495585_0000313 3300046492 Bacteria 48193
162 Ga0495616_0019585 3300046513 Bacteria 3691
163 Ga0495643_0000542 3300046522 Bacteria 46816
164 Ga0495648_0021946 3300046524 Bacteria 4409
165 Ga0495648_0026534 3300046524 Bacteria 3897
166 Ga0495609_0001198 3300046538 Bacteria 17856
167 Ga0495622_0024017 3300046557 Bacteria 2845
168 Ga0495633_0000074 3300046558 Bacteria 130197
169 Ga0495668_0000017 3300046616 Bacteria 434025
170 Ga0495625_0000679 3300046660 Bacteria 48394
171 Ga0495625_0002491 3300046660 Bacteria 19851
172 Ga0495625_0007789 3300046660 Bacteria 9245
173 Ga0495625_0009279 3300046660 Bacteria 8251
174 Ga0495625_0061125 3300046660 Bacteria 2666
175 Ga0495625_0195597 3300046660 Bacteria 1337
176 Ga0495661_0001074 3300046665 Bacteria 24060
177 Ga0495658_0031730 3300046683 Bacteria 2879
178 Ga0495649_0027731 3300046694 Bacteria 3141
179 Ga0495600_0074079 3300046809 Bacteria 2223
180 Ga0495636_0000024 3300047318 Bacteria 69826
181 Ga0495677_0074758 3300047445 Bacteria 1265
182 Ga0495681_0116557 3300047470 Bacteria 1151
183 Ga0495686_0000152 3300047472 Bacteria 133713
184 Ga0495686_0077003 3300047472 Unclassified 2043
185 Ga0495686_0080340 3300047472 Bacteria 1993
186 Ga0495614_0004647 3300048089 Bacteria 6187
187 Ga0496105_0324324 3300048908 Bacteria 1234
188 Ga0496110_0383214 3300048913 Bacteria 1281
189 Ga0496121_0000007 3300048924 Bacteria 942516
190 Ga0496122_0001671 3300048925 Bacteria 34407
191 Ga0496123_0003686 3300048926 Bacteria 16885
192 Ga0496125_0045913 3300048928 Bacteria 3671
193 Ga0501305_009517 3300049161 Bacteria 1279
194 Ga0501319_001278 3300049535 Bacteria 1424
195 Ga0501033_0279868 3300049570 Bacteria 1178
196 Ga0501047_0108976 3300049581 Unclassified 2652
197 Ga0501241_000127 3300049758 Bacteria 16544
198 Ga0501280_017311 3300049776 Bacteria 1047
199 Ga0501035_0212025 3300049822 Unclassified 1657
200 nmdc:mga0k408_12929_c1 3300050493 Bacteria 4571
201 nmdc:mga0k408_50_c1 3300050493 Bacteria 59317
202 nmdc:mga0k408_64829_c1 3300050493 Bacteria 2126
203 Ga0500646_0002588 3300053090 Bacteria 4692
204 Ga0500641_0000139 3300053096 Bacteria 26945
205 Ga0500562_000087 3300053108 Bacteria 38418
206 Ga0500569_000883 3300053109 Bacteria 5351
207 Ga0500607_068670 3300053121 Bacteria 1834
208 Ga0500608_004471 3300053122 Bacteria 5423
209 Ga0500618_000011 3300053125 Bacteria 198091
210 Ga0500655_004074 3300053133 Bacteria 2631
211 Ga0500658_0097491 3300053134 Bacteria 1279
212 Ga0500616_0016035 3300053153 Bacteria 4275
213 Ga0500616_0128306 3300053153 Bacteria 1201
214 Ga0500622_0000305 3300053156 Bacteria 50294
215 Ga0500622_0000572 3300053156 Bacteria 33594
216 Ga0500624_000349 3300053157 Bacteria 15065
217 Ga0500627_0131307 3300053158 Bacteria 1131
218 Ga0500633_0009096 3300053160 Bacteria 2595
219 Ga0500645_037005 3300053730 Bacteria 1450
220 Ga0466962_0013935 3300061719 Bacteria 3872
221 2740001568 2739367857 Bacteria 5433684
222 2740006384 2739367858 Bacteria 5432813
223 2819578129 2818991442 Bacteria 8318214
224 2819590876 2818991444 Bacteria 6968812
225 2821139242 2821136567 Bacteria 8080116
226 2881250780 2881247448 Bacteria 3717788
227 2896317668 2896317667 Bacteria 4606601
228 2904473193 2904467357 Bacteria 8057758
229 2919511635 2919509842 Bacteria 4104664
230 2919687527 2919683626 Bacteria 5534354
231 2929244165 2929239360 Bacteria 7745570
232 2965322936 2965320100 Bacteria 3975600
233 Ga0065704_10116243
234 JGI24737J22298_10005818
235 rootH1_10004248
236 rootH1_10133126
237 rootH2_10001435
238 rootH2_10008247
239 rootH2_10224914
240 rootL2_10018380
241 rootL2_10028258
242 rootL2_10041893
243 rootL2_10131298
244 rootL2_10210924
245 rootH1_10022040
246 rootH1_10097521
247 rootH1_10104502
248 JGI25160J50197_1008651
249 Ga0055542_1004127
250 Ga0055526_1045723
251 Ga0055528_1000552
252 Ga0055530_10011765
253 Ga0055531_10000036
254 Ga0055543_1006512
255 Ga0065165_1000010
256 Ga0065165_1003270
257 Ga0065714_10004751
258 Ga0065714_10074717
259 Ga0065704_10212192
260 Ga0070690_100331075
261 Ga0068869_100006045
262 Ga0070666_10000185
263 Ga0070689_100492917
264 Ga0070669_100301232
265 Ga0070671_100156412
266 Ga0070667_100042562
267 Ga0068855_100108278
268 Ga0068855_100148013
269 Ga0068854_100075894
270 Ga0068856_100422080
271 Ga0068852_100008187
272 Ga0068859_100000013
273 Ga0068864_100062003
274 Ga0068863_100015573
275 Ga0068858_100014471
276 Ga0068860_100052013
277 Ga0081455_10388473
278 Ga0075366_10000038
279 Ga0075366_10033246
280 Ga0097621_100004954
281 Ga0097621_100046435
282 Ga0075370_10245332
283 Ga0068871_100012714
284 Ga0068871_100075852
285 Ga0068865_100047931
286 Ga0097620_100000013
287 Ga0105240_10000011
288 Ga0105240_10427902
289 Ga0105247_10046132
290 Ga0105241_10000686
291 Ga0105237_10004476
292 Ga0105237_10332888
293 Ga0105237_10720467
294 Ga0105238_10271392
295 Ga0105249_10006427
296 Ga0105239_10000089
297 Ga0105239_10000161
298 Ga0105239_10000425
299 Ga0105239_10010893
300 Ga0105239_10052683
301 Ga0105246_10058774
302 Ga0157371_10162517
303 Ga0157370_10055105
304 Ga0157374_10000004
305 Ga0157374_10528444
306 Ga0157378_10026220
307 Ga0163162_10001214
308 Ga0163162_10017317
309 Ga0163162_10032006
310 Ga0163162_10503438
311 Ga0157372_10005758
312 Ga0157375_10060549
313 Ga0182008_10001371
314 Ga0157379_10011365
315 Ga0157379_10030543
316 Ga0157376_10058583
317 Ga0157376_10177687
318 Ga0157376_10455907
319 Ga0182006_1002835
320 Ga0182005_1000458
321 Ga0163161_10005095
322 Ga0163161_10025024
323 Ga0209436_101541
324 Ga0209258_100036
325 Ga0209026_1002848
326 Ga0209148_1000139
327 Ga0209129_1007980
328 Ga0209233_1007383
329 Ga0209673_1000082
330 Ga0209676_1000370
331 Ga0209564_1019192
332 Ga0209564_1037797
333 Ga0209758_1002720
334 Ga0209758_1044261
335 Ga0209050_1000389
336 Ga0207426_1002748
337 Ga0207426_1012340
338 Ga0209257_1000008
339 Ga0209257_1006346
340 Ga0207710_10026702
341 Ga0207680_10000083
342 Ga0207647_10031279
343 Ga0207695_10000010
344 Ga0207671_10001991
345 Ga0207671_10027499
346 Ga0207671_10035610
347 Ga0207671_10081732
348 Ga0207644_10100330
349 Ga0207670_10772711
350 Ga0207704_10061163
351 Ga0207689_10009576
352 Ga0207667_10020056
353 Ga0207667_10033580
354 Ga0207712_10126099
355 Ga0207640_10022037
356 Ga0207677_10464923
357 Ga0207703_10002119
358 Ga0207641_10000159
359 Ga0207648_10076704
360 Ga0207698_10013839
361 Ga0268264_10086983
362 Ga0307515_10000001
363 Ga0307515_10000411
364 Ga0307515_10000528
365 Ga0307515_10003943
366 Ga0307515_10012211
367 Ga0307515_10026411
368 Ga0307515_10037236
369 Ga0307515_10263058
370 Ga0307515_10310942
371 Ga0307513_10125286
372 Ga0307407_10001062
373 Ga0307411_10003574
374 Ga0316580_10035175
375 Ga0307507_10001000
376 Ga0307510_10066922
377 Ga0395899_0000001
378 Ga0451577_0170939
379 Ga0453683_0248967
380 Ga0466961_0100041
381 Ga0453684_0000084
382 Ga0453684_0000604
383 Ga0453684_0046463
384 Ga0453684_0254337
385 Ga0453684_0358030
386 Ga0453684_0468169
387 Ga0466957_0036419
388 Ga0466959_0002393
389 Ga0451576_0000003
390 Ga0451576_0000176
391 Ga0466958_0050492
392 Ga0495629_0167811
393 Ga0495585_0000313
394 Ga0495616_0019585
395 Ga0495643_0000542
396 Ga0495648_0021946
397 Ga0495648_0026534
398 Ga0495609_0001198
399 Ga0495622_0024017
400 Ga0495633_0000074
401 Ga0495668_0000017
402 Ga0495625_0000679
403 Ga0495625_0002491
404 Ga0495625_0007789
405 Ga0495625_0009279
406 Ga0495625_0061125
407 Ga0495625_0195597
408 Ga0495661_0001074
409 Ga0495658_0031730
410 Ga0495649_0027731
411 Ga0495600_0074079
412 Ga0495636_0000024
413 Ga0495677_0074758
414 Ga0495681_0116557
415 Ga0495686_0000152
416 Ga0495686_0077003
417 Ga0495686_0080340
418 Ga0495614_0004647
419 Ga0496105_0324324
420 Ga0496110_0383214
421 Ga0496121_0000007
422 Ga0496122_0001671
423 Ga0496123_0003686
424 Ga0496125_0045913
425 Ga0501305_009517
426 Ga0501319_001278
427 Ga0501033_0279868
428 Ga0501047_0108976
429 Ga0501241_000127
430 Ga0501280_017311
431 Ga0501035_0212025
432 nmdc:mga0k408_12929_c1
433 nmdc:mga0k408_50_c1
434 nmdc:mga0k408_64829_c1
435 Ga0500646_0002588
436 Ga0500641_0000139
437 Ga0500562_000087
438 Ga0500569_000883
439 Ga0500607_068670
440 Ga0500608_004471
441 Ga0500618_000011
442 Ga0500655_004074
443 Ga0500658_0097491
444 Ga0500616_0016035
445 Ga0500616_0128306
446 Ga0500622_0000305
447 Ga0500622_0000572
448 Ga0500624_000349
449 Ga0500627_0131307
450 Ga0500633_0009096
451 Ga0500645_037005
452 Ga0466962_0013935
453 2740001568
454 2740006384
455 2819578129
456 2819590876
457 2821139242
458 2881250780
459 2896317668
460 2904473193
461 2919511635
462 2919687527
463 2929244165
464 2965322936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

200

287

0.97

PF02678

Pirin

Pirin

57

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9677 14 249
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.967 14 248
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9629 14 248
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9556 14 249
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8513 52 132
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.991 26 144 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9881 24 148 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.98 24 148 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9748 26 144 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.958 53 135 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A519N3J2-F1-model_v4 Pirin family protein 0.9988 18 125
AF-A0A354XYT3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9978 14 147
AF-A0A2D0J2C0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9955 18 133 GO:0051213
AF-F4HAY5-F1-model_v4 Pirin N-terminal domain-containing protein 0.9955 18 131
AF-A0A534X9Y4-F1-model_v4 Pirin family protein 0.9953 18 132

Map