F344756
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 232 | 128 | 232 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100226988|Ga0070675_1002269883 |
| Length | 137 |
| Sequence | MTMALLRYLANLTASKIALWCFLIWYLATVIHHFDPTPSIWLNALGISAIIGVALYLSVLEPGKPPPDRWTVVRLFLMPFCVSSFSQLIKGKGFVLVFPPNLHENAVALAACALFVAFVLLVKRVFLRRPRSASSRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 104 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 110 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 111 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 119 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 120 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.86 |
| Nodule | 0 |
| Rhizoplane | 1.72 |
| Rhizosphere | 94.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10181415 | 3300003320 | Unclassified | 1912 |
| 2 | rootL2_10066613 | 3300003322 | Bacteria | 5395 |
| 3 | Ga0070658_11058251 | 3300005327 | Bacteria | 706 |
| 4 | Ga0070676_10126890 | 3300005328 | Bacteria | 1609 |
| 5 | Ga0070690_100455041 | 3300005330 | Bacteria | 950 |
| 6 | Ga0070670_100108349 | 3300005331 | Bacteria | 2393 |
| 7 | Ga0070677_10014870 | 3300005333 | Bacteria | 2748 |
| 8 | Ga0070677_10456586 | 3300005333 | Unclassified | 684 |
| 9 | Ga0070677_10525774 | 3300005333 | Unclassified | 645 |
| 10 | Ga0068869_100079723 | 3300005334 | Bacteria | 2441 |
| 11 | Ga0068869_100096559 | 3300005334 | Bacteria | 2231 |
| 12 | Ga0068869_100533154 | 3300005334 | Bacteria | 984 |
| 13 | Ga0068869_101289844 | 3300005334 | Bacteria | 644 |
| 14 | Ga0070682_100012070 | 3300005337 | Bacteria | 4944 |
| 15 | Ga0070682_100058213 | 3300005337 | Bacteria | 2436 |
| 16 | Ga0070682_100101256 | 3300005337 | Bacteria | 1902 |
| 17 | Ga0070682_100279171 | 3300005337 | Bacteria | 1217 |
| 18 | Ga0070682_100578871 | 3300005337 | Bacteria | 883 |
| 19 | Ga0068868_100251100 | 3300005338 | Unclassified | 1489 |
| 20 | Ga0068868_102080119 | 3300005338 | Bacteria | 540 |
| 21 | Ga0070689_100007595 | 3300005340 | Bacteria | 7594 |
| 22 | Ga0070691_10621965 | 3300005341 | Unclassified | 640 |
| 23 | Ga0070687_100537918 | 3300005343 | Bacteria | 793 |
| 24 | Ga0070661_100950340 | 3300005344 | Unclassified | 711 |
| 25 | Ga0070661_101658589 | 3300005344 | Bacteria | 541 |
| 26 | Ga0070668_100127382 | 3300005347 | Bacteria | 2040 |
| 27 | Ga0070668_100702889 | 3300005347 | Bacteria | 892 |
| 28 | Ga0070675_100191658 | 3300005354 | Bacteria | 1771 |
| 29 | Ga0070675_100223405 | 3300005354 | Bacteria | 1641 |
| 30 | Ga0070675_100226988 | 3300005354 | Bacteria | 1628 |
| 31 | Ga0070671_100980918 | 3300005355 | Bacteria | 740 |
| 32 | Ga0070674_100132232 | 3300005356 | Bacteria | 1862 |
| 33 | Ga0070674_100343941 | 3300005356 | Bacteria | 1202 |
| 34 | Ga0070674_100399634 | 3300005356 | Bacteria | 1122 |
| 35 | Ga0070673_100102488 | 3300005364 | Bacteria | 2360 |
| 36 | Ga0070673_100104433 | 3300005364 | Bacteria | 2339 |
| 37 | Ga0070688_100211266 | 3300005365 | Bacteria | 1362 |
| 38 | Ga0070688_100224556 | 3300005365 | Bacteria | 1325 |
| 39 | Ga0070688_100593663 | 3300005365 | Bacteria | 847 |
| 40 | Ga0070688_101296283 | 3300005365 | Bacteria | 588 |
| 41 | Ga0070710_10103249 | 3300005437 | Bacteria | 1701 |
| 42 | Ga0070701_10009136 | 3300005438 | Bacteria | 4330 |
| 43 | Ga0070711_100524730 | 3300005439 | Unclassified | 979 |
| 44 | Ga0070705_100033435 | 3300005440 | Bacteria | 2866 |
| 45 | Ga0070700_100088596 | 3300005441 | Bacteria | 2014 |
| 46 | Ga0070700_100169034 | 3300005441 | Unclassified | 1512 |
| 47 | Ga0070700_100355993 | 3300005441 | Bacteria | 1087 |
| 48 | Ga0070663_100153214 | 3300005455 | Bacteria | 1769 |
| 49 | Ga0070678_100122658 | 3300005456 | Bacteria | 2051 |
| 50 | Ga0070678_100343905 | 3300005456 | Bacteria | 1280 |
| 51 | Ga0070662_100749944 | 3300005457 | Unclassified | 828 |
| 52 | Ga0068867_100057490 | 3300005459 | Bacteria | 2881 |
| 53 | Ga0068867_101041360 | 3300005459 | Bacteria | 744 |
| 54 | Ga0068867_101341243 | 3300005459 | Bacteria | 662 |
| 55 | Ga0070685_10185613 | 3300005466 | Bacteria | 1342 |
| 56 | Ga0070685_10335310 | 3300005466 | Bacteria | 1029 |
| 57 | Ga0070685_10673721 | 3300005466 | Bacteria | 752 |
| 58 | Ga0070685_10930210 | 3300005466 | Bacteria | 649 |
| 59 | Ga0068853_101874974 | 3300005539 | Bacteria | 581 |
| 60 | Ga0070672_100032618 | 3300005543 | Bacteria | 3933 |
| 61 | Ga0070672_100073927 | 3300005543 | Bacteria | 2718 |
| 62 | Ga0070672_100231796 | 3300005543 | Bacteria | 1551 |
| 63 | Ga0070686_100031667 | 3300005544 | Bacteria | 3236 |
| 64 | Ga0070686_100470466 | 3300005544 | Bacteria | 970 |
| 65 | Ga0070695_100318577 | 3300005545 | Unclassified | 1155 |
| 66 | Ga0070695_101420180 | 3300005545 | Bacteria | 576 |
| 67 | Ga0070696_100792102 | 3300005546 | Unclassified | 780 |
| 68 | Ga0070693_100034759 | 3300005547 | Bacteria | 2790 |
| 69 | Ga0070665_100005966 | 3300005548 | Bacteria | 12469 |
| 70 | Ga0070664_100146282 | 3300005564 | Bacteria | 2084 |
| 71 | Ga0070664_100616169 | 3300005564 | Bacteria | 1007 |
| 72 | Ga0070664_100631171 | 3300005564 | Bacteria | 995 |
| 73 | Ga0068857_101069653 | 3300005577 | Bacteria | 778 |
| 74 | Ga0070702_100078292 | 3300005615 | Bacteria | 1973 |
| 75 | Ga0068852_102079562 | 3300005616 | Unclassified | 590 |
| 76 | Ga0068859_100319745 | 3300005617 | Bacteria | 1646 |
| 77 | Ga0068859_100934705 | 3300005617 | Unclassified | 951 |
| 78 | Ga0068864_100110035 | 3300005618 | Bacteria | 2453 |
| 79 | Ga0068866_10494625 | 3300005718 | Bacteria | 808 |
| 80 | Ga0068861_100000972 | 3300005719 | Bacteria | 17468 |
| 81 | Ga0068861_100007500 | 3300005719 | Bacteria | 7477 |
| 82 | Ga0068861_100227471 | 3300005719 | Unclassified | 1580 |
| 83 | Ga0068861_100644581 | 3300005719 | Unclassified | 978 |
| 84 | Ga0068861_100675848 | 3300005719 | Bacteria | 957 |
| 85 | Ga0068861_100934052 | 3300005719 | Unclassified | 824 |
| 86 | Ga0068861_101358022 | 3300005719 | Unclassified | 693 |
| 87 | Ga0068851_10178211 | 3300005834 | Bacteria | 1176 |
| 88 | Ga0068870_10014624 | 3300005840 | Bacteria | 3710 |
| 89 | Ga0068870_10106485 | 3300005840 | Bacteria | 1594 |
| 90 | Ga0068863_100074230 | 3300005841 | Bacteria | 3217 |
| 91 | Ga0068863_100094412 | 3300005841 | Bacteria | 2839 |
| 92 | Ga0068863_100364621 | 3300005841 | Unclassified | 1409 |
| 93 | Ga0068858_100692902 | 3300005842 | Bacteria | 991 |
| 94 | Ga0068860_100027807 | 3300005843 | Bacteria | 5446 |
| 95 | Ga0068860_100514188 | 3300005843 | Unclassified | 1197 |
| 96 | Ga0068860_100920716 | 3300005843 | Unclassified | 891 |
| 97 | Ga0068862_100020040 | 3300005844 | Bacteria | 5583 |
| 98 | Ga0068862_100057421 | 3300005844 | Bacteria | 3338 |
| 99 | Ga0068862_100109619 | 3300005844 | Bacteria | 2422 |
| 100 | Ga0068862_101145144 | 3300005844 | Bacteria | 774 |
| 101 | Ga0068862_101178018 | 3300005844 | Bacteria | 764 |
| 102 | Ga0097621_100141150 | 3300006237 | Bacteria | 2058 |
| 103 | Ga0097621_100153376 | 3300006237 | Bacteria | 1976 |
| 104 | Ga0097621_100251896 | 3300006237 | Unclassified | 1546 |
| 105 | Ga0068871_100091195 | 3300006358 | Bacteria | 2539 |
| 106 | Ga0068871_100101959 | 3300006358 | Bacteria | 2405 |
| 107 | Ga0068871_100870617 | 3300006358 | Unclassified | 834 |
| 108 | Ga0068865_100048744 | 3300006881 | Bacteria | 2916 |
| 109 | Ga0068865_100157168 | 3300006881 | Bacteria | 1731 |
| 110 | Ga0068865_100176270 | 3300006881 | Unclassified | 1643 |
| 111 | Ga0068865_100290450 | 3300006881 | Bacteria | 1305 |
| 112 | Ga0097620_100319774 | 3300006931 | Bacteria | 1646 |
| 113 | Ga0097620_100934587 | 3300006931 | Unclassified | 951 |
| 114 | Ga0105245_12087960 | 3300009098 | Unclassified | 620 |
| 115 | Ga0105243_11375883 | 3300009148 | Bacteria | 725 |
| 116 | Ga0105242_12206642 | 3300009176 | Bacteria | 596 |
| 117 | Ga0105248_10212124 | 3300009177 | Bacteria | 2182 |
| 118 | Ga0105237_10453561 | 3300009545 | Unclassified | 1288 |
| 119 | Ga0105249_11264575 | 3300009553 | Unclassified | 809 |
| 120 | Ga0157375_10014699 | 3300013308 | Bacteria | 6994 |
| 121 | Ga0157375_10274313 | 3300013308 | Unclassified | 1849 |
| 122 | Ga0157375_10485727 | 3300013308 | Unclassified | 1400 |
| 123 | Ga0157375_10757750 | 3300013308 | Unclassified | 1122 |
| 124 | Ga0157375_12241775 | 3300013308 | Unclassified | 651 |
| 125 | Ga0163163_10028372 | 3300014325 | Bacteria | 5373 |
| 126 | Ga0163163_10237505 | 3300014325 | Bacteria | 1872 |
| 127 | Ga0157380_10009330 | 3300014326 | Bacteria | 7027 |
| 128 | Ga0157380_10047536 | 3300014326 | Bacteria | 3376 |
| 129 | Ga0157380_10208802 | 3300014326 | Bacteria | 1738 |
| 130 | Ga0157380_10869073 | 3300014326 | Unclassified | 925 |
| 131 | Ga0157380_12378414 | 3300014326 | Unclassified | 595 |
| 132 | Ga0157376_10108418 | 3300014969 | Bacteria | 2440 |
| 133 | Ga0163161_10248632 | 3300017792 | Bacteria | 1385 |
| 134 | Ga0163161_10830753 | 3300017792 | Bacteria | 778 |
| 135 | Ga0163161_11043264 | 3300017792 | Unclassified | 700 |
| 136 | Ga0207656_10129517 | 3300025321 | Bacteria | 1181 |
| 137 | Ga0207682_10005809 | 3300025893 | Bacteria | 5000 |
| 138 | Ga0207682_10015999 | 3300025893 | Bacteria | 2924 |
| 139 | Ga0207682_10125630 | 3300025893 | Bacteria | 1142 |
| 140 | Ga0207692_10862499 | 3300025898 | Bacteria | 594 |
| 141 | Ga0207642_10668263 | 3300025899 | Bacteria | 652 |
| 142 | Ga0207645_10275823 | 3300025907 | Bacteria | 1116 |
| 143 | Ga0207645_10286763 | 3300025907 | Bacteria | 1094 |
| 144 | Ga0207643_10097268 | 3300025908 | Bacteria | 1722 |
| 145 | Ga0207662_10169764 | 3300025918 | Bacteria | 1398 |
| 146 | Ga0207649_10095850 | 3300025920 | Bacteria | 1953 |
| 147 | Ga0207649_11454141 | 3300025920 | Bacteria | 542 |
| 148 | Ga0207681_10061306 | 3300025923 | Bacteria | 2585 |
| 149 | Ga0207650_10096938 | 3300025925 | Bacteria | 2263 |
| 150 | Ga0207650_10267965 | 3300025925 | Bacteria | 1387 |
| 151 | Ga0207659_10183611 | 3300025926 | Bacteria | 1659 |
| 152 | Ga0207659_10317499 | 3300025926 | Bacteria | 1284 |
| 153 | Ga0207706_10138296 | 3300025933 | Bacteria | 2143 |
| 154 | Ga0207709_10169197 | 3300025935 | Unclassified | 1532 |
| 155 | Ga0207670_10057471 | 3300025936 | Bacteria | 2638 |
| 156 | Ga0207669_10147548 | 3300025937 | Bacteria | 1642 |
| 157 | Ga0207704_10070443 | 3300025938 | Bacteria | 2214 |
| 158 | Ga0207704_11132108 | 3300025938 | Unclassified | 666 |
| 159 | Ga0207691_10046527 | 3300025940 | Bacteria | 3986 |
| 160 | Ga0207691_10099012 | 3300025940 | Bacteria | 2604 |
| 161 | Ga0207691_10264305 | 3300025940 | Bacteria | 1483 |
| 162 | Ga0207689_10060270 | 3300025942 | Bacteria | 3121 |
| 163 | Ga0207689_10149034 | 3300025942 | Unclassified | 1928 |
| 164 | Ga0207689_10218583 | 3300025942 | Bacteria | 1574 |
| 165 | Ga0207679_10859089 | 3300025945 | Bacteria | 829 |
| 166 | Ga0207679_11436014 | 3300025945 | Bacteria | 633 |
| 167 | Ga0207651_10069440 | 3300025960 | Bacteria | 2488 |
| 168 | Ga0207651_10254176 | 3300025960 | Bacteria | 1439 |
| 169 | Ga0207640_11438734 | 3300025981 | Unclassified | 618 |
| 170 | Ga0207678_10092042 | 3300026067 | Bacteria | 2592 |
| 171 | Ga0207678_10528679 | 3300026067 | Bacteria | 1030 |
| 172 | Ga0207708_10029257 | 3300026075 | Bacteria | 4174 |
| 173 | Ga0207708_10031928 | 3300026075 | Bacteria | 3999 |
| 174 | Ga0207641_10077038 | 3300026088 | Bacteria | 2884 |
| 175 | Ga0207641_10125519 | 3300026088 | Bacteria | 2297 |
| 176 | Ga0207648_10053940 | 3300026089 | Bacteria | 3512 |
| 177 | Ga0207648_10120193 | 3300026089 | Bacteria | 2310 |
| 178 | Ga0207648_10598445 | 3300026089 | Unclassified | 1016 |
| 179 | Ga0207648_10788156 | 3300026089 | Bacteria | 884 |
| 180 | Ga0207676_10228373 | 3300026095 | Bacteria | 1662 |
| 181 | Ga0207676_10785041 | 3300026095 | Bacteria | 928 |
| 182 | Ga0207674_10605742 | 3300026116 | Bacteria | 1058 |
| 183 | Ga0207675_100004813 | 3300026118 | Bacteria | 13002 |
| 184 | Ga0207675_100006984 | 3300026118 | Bacteria | 10679 |
| 185 | Ga0207675_100354608 | 3300026118 | Bacteria | 1438 |
| 186 | Ga0207675_100394327 | 3300026118 | Unclassified | 1363 |
| 187 | Ga0207683_10051891 | 3300026121 | Bacteria | 3593 |
| 188 | Ga0268266_10021112 | 3300028379 | Bacteria | 5548 |
| 189 | Ga0268265_10123021 | 3300028380 | Unclassified | 2141 |
| 190 | Ga0268265_10409474 | 3300028380 | Unclassified | 1256 |
| 191 | Ga0268265_10618641 | 3300028380 | Unclassified | 1037 |
| 192 | Ga0268265_10792674 | 3300028380 | Bacteria | 923 |
| 193 | Ga0268264_10360529 | 3300028381 | Bacteria | 1386 |
| 194 | Ga0268264_10565864 | 3300028381 | Bacteria | 1117 |
| 195 | Ga0268264_11252429 | 3300028381 | Unclassified | 752 |
| 196 | Ga0268264_12172061 | 3300028381 | Unclassified | 563 |
| 197 | Ga0307511_10123584 | 3300030521 | Bacteria | 1589 |
| 198 | Ga0307513_10034843 | 3300031456 | Bacteria | 5641 |
| 199 | Ga0307513_10065737 | 3300031456 | Bacteria | 3815 |
| 200 | Ga0307513_10200245 | 3300031456 | Bacteria | 1839 |
| 201 | Ga0307408_100422035 | 3300031548 | Bacteria | 1150 |
| 202 | Ga0307405_10063623 | 3300031731 | Bacteria | 2341 |
| 203 | Ga0307413_10233544 | 3300031824 | Bacteria | 1352 |
| 204 | Ga0307413_11556640 | 3300031824 | Bacteria | 586 |
| 205 | Ga0307410_10031978 | 3300031852 | Bacteria | 3381 |
| 206 | Ga0307406_10118408 | 3300031901 | Bacteria | 1836 |
| 207 | Ga0307406_10371339 | 3300031901 | Unclassified | 1125 |
| 208 | Ga0307409_100029921 | 3300031995 | Bacteria | 3905 |
| 209 | Ga0307416_101130481 | 3300032002 | Bacteria | 888 |
| 210 | Ga0307416_101776000 | 3300032002 | Bacteria | 721 |
| 211 | Ga0307411_11150989 | 3300032005 | Bacteria | 701 |
| 212 | Ga0451802_1413033 | 3300041460 | Bacteria | 636 |
| 213 | Ga0451807_0624715 | 3300041486 | Bacteria | 1313 |
| 214 | Ga0495639_0429023 | 3300046475 | Bacteria | 670 |
| 215 | Ga0495585_0397195 | 3300046492 | Bacteria | 664 |
| 216 | Ga0495656_0103170 | 3300046615 | Unclassified | 1322 |
| 217 | Ga0495668_0068564 | 3300046616 | Bacteria | 1951 |
| 218 | Ga0495668_0716598 | 3300046616 | Bacteria | 554 |
| 219 | Ga0495625_0064425 | 3300046660 | Bacteria | 2585 |
| 220 | Ga0495649_0005302 | 3300046694 | Bacteria | 8234 |
| 221 | Ga0495672_0531525 | 3300047320 | Unclassified | 518 |
| 222 | Ga0496104_0131242 | 3300048907 | Unclassified | 2407 |
| 223 | Ga0496114_0066830 | 3300048917 | Bacteria | 3015 |
| 224 | Ga0495678_136573 | 3300049459 | Bacteria | 807 |
| 225 | Ga0501040_0174024 | 3300049576 | Bacteria | 1525 |
| 226 | Ga0501042_0153943 | 3300049578 | Bacteria | 1658 |
| 227 | Ga0501043_0587514 | 3300049579 | Unclassified | 824 |
| 228 | Ga0501071_0935854 | 3300049587 | Bacteria | 669 |
| 229 | nmdc:mga08y16_76773_c1 | 3300050511 | Bacteria | 3482 |
| 230 | Ga0495655_0321798 | 3300053083 | Bacteria | 536 |
| 231 | Ga0500644_0029998 | 3300053088 | Unclassified | 1716 |
| 232 | Ga0500611_158907 | 3300053727 | Unclassified | 624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100132232 | Ga0070674_1001322322 | 120 |
| 2 | 3300005364 | Ga0070673_100102488 | Ga0070673_1001024883 | 120 |
| 3 | 3300005543 | Ga0070672_100073927 | Ga0070672_1000739273 | 120 |
| 4 | 3300005841 | Ga0068863_100074230 | Ga0068863_1000742303 | 120 |
| 5 | 3300013308 | Ga0157375_10014699 | Ga0157375_100146993 | 120 |
| 6 | 3300014326 | Ga0157380_10869073 | Ga0157380_108690732 | 120 |
| 7 | 3300025940 | Ga0207691_10099012 | Ga0207691_100990123 | 120 |
| 8 | 3300025960 | Ga0207651_10069440 | Ga0207651_100694403 | 120 |
| 9 | 3300005337 | Ga0070682_100101256 | Ga0070682_1001012563 | 121 |
| 10 | 3300005341 | Ga0070691_10621965 | Ga0070691_106219651 | 121 |
| 11 | 3300005355 | Ga0070671_100980918 | Ga0070671_1009809183 | 121 |
| 12 | 3300005539 | Ga0068853_101874974 | Ga0068853_1018749741 | 121 |
| 13 | 3300005843 | Ga0068860_100920716 | Ga0068860_1009207162 | 121 |
| 14 | 3300006237 | Ga0097621_100251896 | Ga0097621_1002518962 | 121 |
| 15 | 3300006358 | Ga0068871_100870617 | Ga0068871_1008706172 | 121 |
| 16 | 3300014326 | Ga0157380_10047536 | Ga0157380_100475363 | 121 |
| 17 | 3300025925 | Ga0207650_10267965 | Ga0207650_102679652 | 121 |
| 18 | 3300031456 | Ga0307513_10034843 | Ga0307513_100348436 | 121 |
| 19 | 3300047320 | Ga0495672_0531525 | Ga0495672_0531525_139_507 | 121 |
| 20 | 3300050511 | nmdc:mga08y16_76773_c1 | nmdc:mga08y16_76773_c1_1959_2339 | 121 |
| 21 | 3300053088 | Ga0500644_0029998 | Ga0500644_0029998_318_689 | 121 |
| 22 | 3300053727 | Ga0500611_158907 | Ga0500611_158907_216_587 | 121 |
| 23 | 3300005328 | Ga0070676_10126890 | Ga0070676_101268901 | 122 |
| 24 | 3300005331 | Ga0070670_100108349 | Ga0070670_1001083493 | 122 |
| 25 | 3300005333 | Ga0070677_10014870 | Ga0070677_100148701 | 122 |
| 26 | 3300005333 | Ga0070677_10525774 | Ga0070677_105257742 | 122 |
| 27 | 3300005334 | Ga0068869_100079723 | Ga0068869_1000797234 | 122 |
| 28 | 3300005340 | Ga0070689_100007595 | Ga0070689_1000075958 | 122 |
| 29 | 3300005347 | Ga0070668_100127382 | Ga0070668_1001273821 | 122 |
| 30 | 3300005347 | Ga0070668_100702889 | Ga0070668_1007028892 | 122 |
| 31 | 3300005356 | Ga0070674_100399634 | Ga0070674_1003996342 | 122 |
| 32 | 3300005365 | Ga0070688_100211266 | Ga0070688_1002112662 | 122 |
| 33 | 3300005365 | Ga0070688_100224556 | Ga0070688_1002245563 | 122 |
| 34 | 3300005438 | Ga0070701_10009136 | Ga0070701_100091364 | 122 |
| 35 | 3300005440 | Ga0070705_100033435 | Ga0070705_1000334352 | 122 |
| 36 | 3300005441 | Ga0070700_100355993 | Ga0070700_1003559932 | 122 |
| 37 | 3300005456 | Ga0070678_100343905 | Ga0070678_1003439053 | 122 |
| 38 | 3300005459 | Ga0068867_100057490 | Ga0068867_1000574903 | 122 |
| 39 | 3300005459 | Ga0068867_101341243 | Ga0068867_1013412431 | 122 |
| 40 | 3300005466 | Ga0070685_10185613 | Ga0070685_101856132 | 122 |
| 41 | 3300005466 | Ga0070685_10335310 | Ga0070685_103353102 | 122 |
| 42 | 3300005543 | Ga0070672_100231796 | Ga0070672_1002317963 | 122 |
| 43 | 3300005544 | Ga0070686_100031667 | Ga0070686_1000316672 | 122 |
| 44 | 3300005545 | Ga0070695_100318577 | Ga0070695_1003185772 | 122 |
| 45 | 3300005546 | Ga0070696_100792102 | Ga0070696_1007921022 | 122 |
| 46 | 3300005547 | Ga0070693_100034759 | Ga0070693_1000347592 | 122 |
| 47 | 3300005577 | Ga0068857_101069653 | Ga0068857_1010696532 | 122 |
| 48 | 3300005615 | Ga0070702_100078292 | Ga0070702_1000782923 | 122 |
| 49 | 3300005617 | Ga0068859_100319745 | Ga0068859_1003197453 | 122 |
| 50 | 3300005617 | Ga0068859_100934705 | Ga0068859_1009347052 | 122 |
| 51 | 3300005618 | Ga0068864_100110035 | Ga0068864_1001100353 | 122 |
| 52 | 3300005719 | Ga0068861_100007500 | Ga0068861_1000075007 | 122 |
| 53 | 3300005719 | Ga0068861_100644581 | Ga0068861_1006445812 | 122 |
| 54 | 3300005840 | Ga0068870_10014624 | Ga0068870_100146242 | 122 |
| 55 | 3300005841 | Ga0068863_100094412 | Ga0068863_1000944123 | 122 |
| 56 | 3300005844 | Ga0068862_100057421 | Ga0068862_1000574212 | 122 |
| 57 | 3300006881 | Ga0068865_100157168 | Ga0068865_1001571683 | 122 |
| 58 | 3300006881 | Ga0068865_100290450 | Ga0068865_1002904502 | 122 |
| 59 | 3300006931 | Ga0097620_100319774 | Ga0097620_1003197743 | 122 |
| 60 | 3300006931 | Ga0097620_100934587 | Ga0097620_1009345872 | 122 |
| 61 | 3300009148 | Ga0105243_11375883 | Ga0105243_113758831 | 122 |
| 62 | 3300009176 | Ga0105242_12206642 | Ga0105242_122066422 | 122 |
| 63 | 3300009553 | Ga0105249_11264575 | Ga0105249_112645752 | 122 |
| 64 | 3300013308 | Ga0157375_10485727 | Ga0157375_104857272 | 122 |
| 65 | 3300013308 | Ga0157375_10757750 | Ga0157375_107577501 | 122 |
| 66 | 3300014325 | Ga0163163_10237505 | Ga0163163_102375053 | 122 |
| 67 | 3300014326 | Ga0157380_10009330 | Ga0157380_100093305 | 122 |
| 68 | 3300014326 | Ga0157380_10208802 | Ga0157380_102088022 | 122 |
| 69 | 3300014326 | Ga0157380_12378414 | Ga0157380_123784141 | 122 |
| 70 | 3300017792 | Ga0163161_10248632 | Ga0163161_102486322 | 122 |
| 71 | 3300025893 | Ga0207682_10015999 | Ga0207682_100159991 | 122 |
| 72 | 3300025893 | Ga0207682_10125630 | Ga0207682_101256302 | 122 |
| 73 | 3300025899 | Ga0207642_10668263 | Ga0207642_106682631 | 122 |
| 74 | 3300025907 | Ga0207645_10275823 | Ga0207645_102758232 | 122 |
| 75 | 3300025923 | Ga0207681_10061306 | Ga0207681_100613063 | 122 |
| 76 | 3300025925 | Ga0207650_10096938 | Ga0207650_100969383 | 122 |
| 77 | 3300025936 | Ga0207670_10057471 | Ga0207670_100574713 | 122 |
| 78 | 3300025937 | Ga0207669_10147548 | Ga0207669_101475483 | 122 |
| 79 | 3300025938 | Ga0207704_11132108 | Ga0207704_111321082 | 122 |
| 80 | 3300025940 | Ga0207691_10046527 | Ga0207691_100465274 | 122 |
| 81 | 3300025942 | Ga0207689_10218583 | Ga0207689_102185833 | 122 |
| 82 | 3300026075 | Ga0207708_10031928 | Ga0207708_100319285 | 122 |
| 83 | 3300026088 | Ga0207641_10125519 | Ga0207641_101255193 | 122 |
| 84 | 3300026089 | Ga0207648_10053940 | Ga0207648_100539403 | 122 |
| 85 | 3300026089 | Ga0207648_10120193 | Ga0207648_101201933 | 122 |
| 86 | 3300026095 | Ga0207676_10228373 | Ga0207676_102283733 | 122 |
| 87 | 3300026095 | Ga0207676_10785041 | Ga0207676_107850412 | 122 |
| 88 | 3300026118 | Ga0207675_100006984 | Ga0207675_1000069845 | 122 |
| 89 | 3300026118 | Ga0207675_100354608 | Ga0207675_1003546083 | 122 |
| 90 | 3300026121 | Ga0207683_10051891 | Ga0207683_100518914 | 122 |
| 91 | 3300028380 | Ga0268265_10123021 | Ga0268265_101230212 | 122 |
| 92 | 3300028380 | Ga0268265_10618641 | Ga0268265_106186412 | 122 |
| 93 | 3300028381 | Ga0268264_11252429 | Ga0268264_112524292 | 122 |
| 94 | 3300028381 | Ga0268264_12172061 | Ga0268264_121720611 | 122 |
| 95 | 3300053083 | Ga0495655_0321798 | Ga0495655_0321798_17_391 | 122 |
| 96 | 3300003322 | rootL2_10066613 | rootL2_100666133 | 123 |
| 97 | 3300005327 | Ga0070658_11058251 | Ga0070658_110582512 | 123 |
| 98 | 3300005334 | Ga0068869_101289844 | Ga0068869_1012898441 | 123 |
| 99 | 3300005337 | Ga0070682_100012070 | Ga0070682_1000120706 | 123 |
| 100 | 3300005337 | Ga0070682_100058213 | Ga0070682_1000582133 | 123 |
| 101 | 3300005337 | Ga0070682_100279171 | Ga0070682_1002791712 | 123 |
| 102 | 3300005337 | Ga0070682_100578871 | Ga0070682_1005788712 | 123 |
| 103 | 3300005343 | Ga0070687_100537918 | Ga0070687_1005379182 | 123 |
| 104 | 3300005344 | Ga0070661_100950340 | Ga0070661_1009503401 | 123 |
| 105 | 3300005354 | Ga0070675_100223405 | Ga0070675_1002234053 | 123 |
| 106 | 3300005365 | Ga0070688_100593663 | Ga0070688_1005936631 | 123 |
| 107 | 3300005437 | Ga0070710_10103249 | Ga0070710_101032493 | 123 |
| 108 | 3300005439 | Ga0070711_100524730 | Ga0070711_1005247301 | 123 |
| 109 | 3300005441 | Ga0070700_100169034 | Ga0070700_1001690343 | 123 |
| 110 | 3300005455 | Ga0070663_100153214 | Ga0070663_1001532143 | 123 |
| 111 | 3300005457 | Ga0070662_100749944 | Ga0070662_1007499441 | 123 |
| 112 | 3300005466 | Ga0070685_10673721 | Ga0070685_106737211 | 123 |
| 113 | 3300005466 | Ga0070685_10930210 | Ga0070685_109302101 | 123 |
| 114 | 3300005544 | Ga0070686_100470466 | Ga0070686_1004704662 | 123 |
| 115 | 3300005545 | Ga0070695_101420180 | Ga0070695_1014201801 | 123 |
| 116 | 3300005548 | Ga0070665_100005966 | Ga0070665_10000596612 | 123 |
| 117 | 3300005564 | Ga0070664_100146282 | Ga0070664_1001462823 | 123 |
| 118 | 3300005616 | Ga0068852_102079562 | Ga0068852_1020795622 | 123 |
| 119 | 3300005718 | Ga0068866_10494625 | Ga0068866_104946252 | 123 |
| 120 | 3300005719 | Ga0068861_100000972 | Ga0068861_10000097211 | 123 |
| 121 | 3300005719 | Ga0068861_100934052 | Ga0068861_1009340522 | 123 |
| 122 | 3300005719 | Ga0068861_101358022 | Ga0068861_1013580222 | 123 |
| 123 | 3300005840 | Ga0068870_10106485 | Ga0068870_101064853 | 123 |
| 124 | 3300005841 | Ga0068863_100364621 | Ga0068863_1003646212 | 123 |
| 125 | 3300005842 | Ga0068858_100692902 | Ga0068858_1006929022 | 123 |
| 126 | 3300005843 | Ga0068860_100027807 | Ga0068860_1000278075 | 123 |
| 127 | 3300005844 | Ga0068862_100109619 | Ga0068862_1001096191 | 123 |
| 128 | 3300006881 | Ga0068865_100176270 | Ga0068865_1001762703 | 123 |
| 129 | 3300009545 | Ga0105237_10453561 | Ga0105237_104535612 | 123 |
| 130 | 3300013308 | Ga0157375_12241775 | Ga0157375_122417752 | 123 |
| 131 | 3300014325 | Ga0163163_10028372 | Ga0163163_100283722 | 123 |
| 132 | 3300025898 | Ga0207692_10862499 | Ga0207692_108624991 | 123 |
| 133 | 3300025907 | Ga0207645_10286763 | Ga0207645_102867633 | 123 |
| 134 | 3300025908 | Ga0207643_10097268 | Ga0207643_100972683 | 123 |
| 135 | 3300025918 | Ga0207662_10169764 | Ga0207662_101697643 | 123 |
| 136 | 3300025920 | Ga0207649_10095850 | Ga0207649_100958501 | 123 |
| 137 | 3300025926 | Ga0207659_10317499 | Ga0207659_103174992 | 123 |
| 138 | 3300025933 | Ga0207706_10138296 | Ga0207706_101382963 | 123 |
| 139 | 3300025940 | Ga0207691_10264305 | Ga0207691_102643053 | 123 |
| 140 | 3300025945 | Ga0207679_10859089 | Ga0207679_108590892 | 123 |
| 141 | 3300025981 | Ga0207640_11438734 | Ga0207640_114387342 | 123 |
| 142 | 3300026067 | Ga0207678_10092042 | Ga0207678_100920424 | 123 |
| 143 | 3300026067 | Ga0207678_10528679 | Ga0207678_105286793 | 123 |
| 144 | 3300026075 | Ga0207708_10029257 | Ga0207708_100292575 | 123 |
| 145 | 3300026089 | Ga0207648_10788156 | Ga0207648_107881562 | 123 |
| 146 | 3300026118 | Ga0207675_100004813 | Ga0207675_10000481311 | 123 |
| 147 | 3300028379 | Ga0268266_10021112 | Ga0268266_100211125 | 123 |
| 148 | 3300028380 | Ga0268265_10792674 | Ga0268265_107926741 | 123 |
| 149 | 3300028381 | Ga0268264_10360529 | Ga0268264_103605292 | 123 |
| 150 | 3300031548 | Ga0307408_100422035 | Ga0307408_1004220353 | 123 |
| 151 | 3300031731 | Ga0307405_10063623 | Ga0307405_100636231 | 123 |
| 152 | 3300031824 | Ga0307413_10233544 | Ga0307413_102335442 | 123 |
| 153 | 3300031824 | Ga0307413_11556640 | Ga0307413_115566402 | 123 |
| 154 | 3300031852 | Ga0307410_10031978 | Ga0307410_100319784 | 123 |
| 155 | 3300031901 | Ga0307406_10118408 | Ga0307406_101184082 | 123 |
| 156 | 3300031901 | Ga0307406_10371339 | Ga0307406_103713392 | 123 |
| 157 | 3300031995 | Ga0307409_100029921 | Ga0307409_1000299212 | 123 |
| 158 | 3300032002 | Ga0307416_101130481 | Ga0307416_1011304812 | 123 |
| 159 | 3300032002 | Ga0307416_101776000 | Ga0307416_1017760002 | 123 |
| 160 | 3300032005 | Ga0307411_11150989 | Ga0307411_111509892 | 123 |
| 161 | 3300041460 | Ga0451802_1413033 | Ga0451802_1413033_20_424 | 123 |
| 162 | 3300041486 | Ga0451807_0624715 | Ga0451807_0624715_663_1040 | 123 |
| 163 | 3300046616 | Ga0495668_0716598 | Ga0495668_0716598_14_403 | 123 |
| 164 | 3300046694 | Ga0495649_0005302 | Ga0495649_0005302_7646_8038 | 123 |
| 165 | 3300048907 | Ga0496104_0131242 | Ga0496104_0131242_655_1038 | 123 |
| 166 | 3300048917 | Ga0496114_0066830 | Ga0496114_0066830_1656_2039 | 123 |
| 167 | 3300003320 | rootH2_10181415 | rootH2_101814153 | 124 |
| 168 | 3300005330 | Ga0070690_100455041 | Ga0070690_1004550412 | 124 |
| 169 | 3300005333 | Ga0070677_10456586 | Ga0070677_104565861 | 124 |
| 170 | 3300005334 | Ga0068869_100096559 | Ga0068869_1000965592 | 124 |
| 171 | 3300005334 | Ga0068869_100533154 | Ga0068869_1005331542 | 124 |
| 172 | 3300005338 | Ga0068868_100251100 | Ga0068868_1002511002 | 124 |
| 173 | 3300005338 | Ga0068868_102080119 | Ga0068868_1020801191 | 124 |
| 174 | 3300005344 | Ga0070661_101658589 | Ga0070661_1016585891 | 124 |
| 175 | 3300005354 | Ga0070675_100191658 | Ga0070675_1001916583 | 124 |
| 176 | 3300005354 | Ga0070675_100226988 | Ga0070675_1002269883 | 124 |
| 177 | 3300005356 | Ga0070674_100343941 | Ga0070674_1003439412 | 124 |
| 178 | 3300005364 | Ga0070673_100104433 | Ga0070673_1001044333 | 124 |
| 179 | 3300005365 | Ga0070688_101296283 | Ga0070688_1012962831 | 124 |
| 180 | 3300005441 | Ga0070700_100088596 | Ga0070700_1000885963 | 124 |
| 181 | 3300005456 | Ga0070678_100122658 | Ga0070678_1001226583 | 124 |
| 182 | 3300005459 | Ga0068867_101041360 | Ga0068867_1010413602 | 124 |
| 183 | 3300005543 | Ga0070672_100032618 | Ga0070672_1000326184 | 124 |
| 184 | 3300005564 | Ga0070664_100616169 | Ga0070664_1006161691 | 124 |
| 185 | 3300005564 | Ga0070664_100631171 | Ga0070664_1006311712 | 124 |
| 186 | 3300005719 | Ga0068861_100227471 | Ga0068861_1002274712 | 124 |
| 187 | 3300005719 | Ga0068861_100675848 | Ga0068861_1006758482 | 124 |
| 188 | 3300005834 | Ga0068851_10178211 | Ga0068851_101782112 | 124 |
| 189 | 3300005843 | Ga0068860_100514188 | Ga0068860_1005141882 | 124 |
| 190 | 3300005844 | Ga0068862_100020040 | Ga0068862_1000200404 | 124 |
| 191 | 3300005844 | Ga0068862_101145144 | Ga0068862_1011451442 | 124 |
| 192 | 3300005844 | Ga0068862_101178018 | Ga0068862_1011780181 | 124 |
| 193 | 3300006237 | Ga0097621_100141150 | Ga0097621_1001411503 | 124 |
| 194 | 3300006237 | Ga0097621_100153376 | Ga0097621_1001533763 | 124 |
| 195 | 3300006358 | Ga0068871_100091195 | Ga0068871_1000911953 | 124 |
| 196 | 3300006358 | Ga0068871_100101959 | Ga0068871_1001019593 | 124 |
| 197 | 3300006881 | Ga0068865_100048744 | Ga0068865_1000487444 | 124 |
| 198 | 3300009098 | Ga0105245_12087960 | Ga0105245_120879601 | 124 |
| 199 | 3300009177 | Ga0105248_10212124 | Ga0105248_102121244 | 124 |
| 200 | 3300013308 | Ga0157375_10274313 | Ga0157375_102743133 | 124 |
| 201 | 3300014969 | Ga0157376_10108418 | Ga0157376_101084183 | 124 |
| 202 | 3300017792 | Ga0163161_10830753 | Ga0163161_108307532 | 124 |
| 203 | 3300017792 | Ga0163161_11043264 | Ga0163161_110432641 | 124 |
| 204 | 3300025321 | Ga0207656_10129517 | Ga0207656_101295172 | 124 |
| 205 | 3300025893 | Ga0207682_10005809 | Ga0207682_100058093 | 124 |
| 206 | 3300025920 | Ga0207649_11454141 | Ga0207649_114541411 | 124 |
| 207 | 3300025926 | Ga0207659_10183611 | Ga0207659_101836113 | 124 |
| 208 | 3300025935 | Ga0207709_10169197 | Ga0207709_101691972 | 124 |
| 209 | 3300025938 | Ga0207704_10070443 | Ga0207704_100704433 | 124 |
| 210 | 3300025942 | Ga0207689_10060270 | Ga0207689_100602704 | 124 |
| 211 | 3300025942 | Ga0207689_10149034 | Ga0207689_101490343 | 124 |
| 212 | 3300025945 | Ga0207679_11436014 | Ga0207679_114360141 | 124 |
| 213 | 3300025960 | Ga0207651_10254176 | Ga0207651_102541763 | 124 |
| 214 | 3300026088 | Ga0207641_10077038 | Ga0207641_100770383 | 124 |
| 215 | 3300026089 | Ga0207648_10598445 | Ga0207648_105984452 | 124 |
| 216 | 3300026116 | Ga0207674_10605742 | Ga0207674_106057422 | 124 |
| 217 | 3300026118 | Ga0207675_100394327 | Ga0207675_1003943272 | 124 |
| 218 | 3300028380 | Ga0268265_10409474 | Ga0268265_104094742 | 124 |
| 219 | 3300028381 | Ga0268264_10565864 | Ga0268264_105658642 | 124 |
| 220 | 3300030521 | Ga0307511_10123584 | Ga0307511_101235842 | 124 |
| 221 | 3300031456 | Ga0307513_10065737 | Ga0307513_100657374 | 124 |
| 222 | 3300031456 | Ga0307513_10200245 | Ga0307513_102002453 | 124 |
| 223 | 3300046475 | Ga0495639_0429023 | Ga0495639_0429023_143_529 | 124 |
| 224 | 3300046492 | Ga0495585_0397195 | Ga0495585_0397195_270_650 | 124 |
| 225 | 3300046615 | Ga0495656_0103170 | Ga0495656_0103170_590_970 | 124 |
| 226 | 3300046616 | Ga0495668_0068564 | Ga0495668_0068564_1373_1753 | 124 |
| 227 | 3300046660 | Ga0495625_0064425 | Ga0495625_0064425_310_684 | 124 |
| 228 | 3300049459 | Ga0495678_136573 | Ga0495678_136573_357_737 | 124 |
| 229 | 3300049576 | Ga0501040_0174024 | Ga0501040_0174024_781_1161 | 124 |
| 230 | 3300049578 | Ga0501042_0153943 | Ga0501042_0153943_157_552 | 124 |
| 231 | 3300049579 | Ga0501043_0587514 | Ga0501043_0587514_408_803 | 124 |
| 232 | 3300049587 | Ga0501071_0935854 | Ga0501071_0935854_272_652 | 124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar