F344873

General Info

Members Datasets Scaffolds Average Seq Length
232 127 464 285

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100173408|Ga0068864_1001734082
Length 311
Sequence LTEAVVRTEVHGPRWQALAVLVFGACVIGLSPILVRLAEAGPAAAGFWRLAFAMPILAIMTRRTDGPLRKPSKIALIAGLMFTLDLGFWHYGIKFTSVTNATVLSNLTPVVVTVFAWIFLKQRPRALFLLAVAVAVGGAWMMAIGKGGGDHLVNPPLGNLLSATTALWYALYFLAIAEGRKRESASRLMFWSTVVGMPLLLIAAMASGEQVIPTGLGGWGACLGLGLMHVAGQGSIAWAMGRLPTATASVVVLVQPVVAAWLGWVLFAESIGPLQAAGAGVALFGVVLAQWASRPPKDSRSTFGGAVSEAD

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
119 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
124 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
125 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
126 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
127 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0.43
Rhizoplane 6.03
Rhizosphere 83.62
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100173408 3300005618 Bacteria 1968
2 Ga0055531_10035676 3300003794 Bacteria 1551
3 Ga0065165_1000331 3300005262 Bacteria 77276
4 Ga0065165_1020870 3300005262 Bacteria 2291
5 Ga0070658_10032108 3300005327 Bacteria 4221
6 Ga0070670_100000035 3300005331 Bacteria 157570
7 Ga0070670_100100068 3300005331 Bacteria 2495
8 Ga0070680_100267751 3300005336 Bacteria 1446
9 Ga0070680_100294561 3300005336 Unclassified 1375
10 Ga0070660_100012196 3300005339 Bacteria 6136
11 Ga0070660_100024813 3300005339 Bacteria 4452
12 Ga0070668_100001477 3300005347 Bacteria 16977
13 Ga0070668_100002182 3300005347 Bacteria 14344
14 Ga0070668_100003111 3300005347 Bacteria 12253
15 Ga0070668_100004551 3300005347 Bacteria 10281
16 Ga0070668_100111038 3300005347 Bacteria 2182
17 Ga0070671_100054644 3300005355 Bacteria 3320
18 Ga0070671_100066073 3300005355 Bacteria 3014
19 Ga0070673_100079164 3300005364 Bacteria 2660
20 Ga0070659_100000553 3300005366 Bacteria 27361
21 Ga0070659_100029633 3300005366 Bacteria 4230
22 Ga0070659_100032264 3300005366 Bacteria 4061
23 Ga0070667_100000711 3300005367 Bacteria 32094
24 Ga0070667_100006239 3300005367 Bacteria 9916
25 Ga0070667_100012708 3300005367 Bacteria 6961
26 Ga0070681_10001467 3300005458 Bacteria 20801
27 Ga0070681_10344453 3300005458 Bacteria 1400
28 Ga0070681_10506440 3300005458 Bacteria 1120
29 Ga0070698_100406468 3300005471 Bacteria 1295
30 Ga0070679_100083333 3300005530 Bacteria 3186
31 Ga0068853_100020174 3300005539 Bacteria 5540
32 Ga0070665_100000433 3300005548 Bacteria 60988
33 Ga0070665_100001010 3300005548 Bacteria 35486
34 Ga0070665_100006544 3300005548 Bacteria 11837
35 Ga0068855_100060548 3300005563 Bacteria 4427
36 Ga0068855_100061653 3300005563 Bacteria 4381
37 Ga0068855_100064732 3300005563 Bacteria 4264
38 Ga0068855_100066076 3300005563 Bacteria 4216
39 Ga0068855_100353851 3300005563 Bacteria 1617
40 Ga0068854_100105982 3300005578 Bacteria 2114
41 Ga0068854_100259502 3300005578 Bacteria 1391
42 Ga0068856_100196707 3300005614 Bacteria 2030
43 Ga0068856_100228124 3300005614 Bacteria 1878
44 Ga0068859_100003513 3300005617 Bacteria 15963
45 Ga0068859_100023142 3300005617 Bacteria 6233
46 Ga0068864_100000102 3300005618 Bacteria 82743
47 Ga0068864_100000165 3300005618 Bacteria 60874
48 Ga0068864_100003190 3300005618 Bacteria 13563
49 Ga0068864_100111701 3300005618 Bacteria 2435
50 Ga0068861_100137951 3300005719 Bacteria 1987
51 Ga0068863_100000128 3300005841 Bacteria 79841
52 Ga0068863_100002006 3300005841 Bacteria 20201
53 Ga0068858_100004655 3300005842 Bacteria 13446
54 Ga0068860_100000100 3300005843 Bacteria 144580
55 Ga0068860_100000157 3300005843 Bacteria 110717
56 Ga0068860_100054514 3300005843 Bacteria 3800
57 Ga0068860_100300622 3300005843 Bacteria 1572
58 Ga0068862_100000368 3300005844 Bacteria 48907
59 Ga0068862_100002848 3300005844 Bacteria 15165
60 Ga0068862_100033565 3300005844 Bacteria 4339
61 Ga0068862_100106884 3300005844 Bacteria 2454
62 Ga0068862_100224766 3300005844 Bacteria 1701
63 Ga0075362_10043428 3300006177 Bacteria 1990
64 Ga0097621_100046200 3300006237 Bacteria 3522
65 Ga0068865_100003733 3300006881 Bacteria 9146
66 Ga0068865_100088614 3300006881 Bacteria 2239
67 Ga0097620_100003513 3300006931 Bacteria 15963
68 Ga0097620_100023142 3300006931 Bacteria 6233
69 Ga0079104_1028134 3300006946 Bacteria 1432
70 Ga0105250_10009810 3300009092 Bacteria 4021
71 Ga0105240_10002462 3300009093 Bacteria 29759
72 Ga0105240_10033911 3300009093 Bacteria 6591
73 Ga0105240_10037044 3300009093 Bacteria 6270
74 Ga0105241_10080878 3300009174 Bacteria 2544
75 Ga0105248_10000106 3300009177 Bacteria 93898
76 Ga0105248_10028850 3300009177 Bacteria 6185
77 Ga0105248_10037520 3300009177 Bacteria 5422
78 Ga0105248_10102694 3300009177 Bacteria 3222
79 Ga0105238_10036921 3300009551 Bacteria 4969
80 Ga0105238_10215398 3300009551 Bacteria 1897
81 Ga0105238_10226019 3300009551 Bacteria 1848
82 Ga0105238_10357192 3300009551 Bacteria 1450
83 Ga0105249_10000525 3300009553 Bacteria 35250
84 Ga0105249_10374177 3300009553 Bacteria 1449
85 Ga0105239_10138980 3300010375 Bacteria 2706
86 Ga0157373_10014255 3300013100 Bacteria 5830
87 Ga0157373_10014307 3300013100 Bacteria 5817
88 Ga0157370_10233108 3300013104 Bacteria 1703
89 Ga0163162_10280979 3300013306 Bacteria 1797
90 Ga0163163_10008143 3300014325 Bacteria 9295
91 Ga0163163_10164307 3300014325 Bacteria 2266
92 Ga0163163_10182609 3300014325 Bacteria 2145
93 Ga0163163_10759796 3300014325 Bacteria 1033
94 Ga0157379_10277254 3300014968 Bacteria 1525
95 Ga0213872_10090268 3300021361 Bacteria 1372
96 Ga0209026_1001873 3300025250 Bacteria 8574
97 Ga0209758_1000334 3300025297 Bacteria 88149
98 Ga0209050_1000130 3300025298 Bacteria 186070
99 Ga0209257_1000059 3300025304 Bacteria 378097
100 Ga0207680_10252019 3300025903 Bacteria 1220
101 Ga0207707_10227714 3300025912 Bacteria 1622
102 Ga0207707_10370479 3300025912 Bacteria 1232
103 Ga0207695_10000237 3300025913 Bacteria 145476
104 Ga0207695_10001222 3300025913 Bacteria 44042
105 Ga0207695_10026883 3300025913 Bacteria 6416
106 Ga0207695_10051583 3300025913 Bacteria 4317
107 Ga0207695_10140156 3300025913 Bacteria 2367
108 Ga0207660_10043685 3300025917 Bacteria 3149
109 Ga0207660_10076016 3300025917 Bacteria 2455
110 Ga0207657_10000314 3300025919 Bacteria 51222
111 Ga0207657_10013900 3300025919 Bacteria 7877
112 Ga0207657_10054813 3300025919 Bacteria 3446
113 Ga0207694_10095760 3300025924 Bacteria 2347
114 Ga0207694_10238875 3300025924 Bacteria 1485
115 Ga0207650_10000350 3300025925 Bacteria 44409
116 Ga0207650_10030183 3300025925 Bacteria 3903
117 Ga0207650_10134220 3300025925 Bacteria 1940
118 Ga0207687_10061108 3300025927 Bacteria 2660
119 Ga0207644_10015356 3300025931 Bacteria 5138
120 Ga0207644_10127070 3300025931 Bacteria 1947
121 Ga0207690_10000159 3300025932 Bacteria 52852
122 Ga0207690_10005002 3300025932 Bacteria 7829
123 Ga0207704_10011758 3300025938 Bacteria 4323
124 Ga0207711_10000098 3300025941 Bacteria 92296
125 Ga0207711_10004912 3300025941 Bacteria 11352
126 Ga0207711_10228802 3300025941 Bacteria 1702
127 Ga0207711_10320814 3300025941 Bacteria 1431
128 Ga0207689_10079457 3300025942 Bacteria 2696
129 Ga0207667_10010250 3300025949 Bacteria 10971
130 Ga0207667_10112400 3300025949 Bacteria 2809
131 Ga0207712_10368636 3300025961 Bacteria 1198
132 Ga0207668_10000025 3300025972 Bacteria 131733
133 Ga0207668_10000035 3300025972 Bacteria 119182
134 Ga0207668_10003496 3300025972 Bacteria 9226
135 Ga0207668_10016710 3300025972 Bacteria 4585
136 Ga0207640_10155916 3300025981 Bacteria 1683
137 Ga0207640_10223627 3300025981 Bacteria 1443
138 Ga0207658_10000300 3300025986 Bacteria 51413
139 Ga0207658_10001621 3300025986 Bacteria 17264
140 Ga0207658_10436200 3300025986 Bacteria 1157
141 Ga0207703_10000726 3300026035 Bacteria 32431
142 Ga0207639_10272055 3300026041 Bacteria 1486
143 Ga0207702_10124596 3300026078 Bacteria 2311
144 Ga0207641_10000005 3300026088 Bacteria 470841
145 Ga0207641_10016442 3300026088 Bacteria 6058
146 Ga0207676_10000066 3300026095 Bacteria 105425
147 Ga0207676_10001155 3300026095 Bacteria 19868
148 Ga0207676_10007091 3300026095 Bacteria 7944
149 Ga0207675_100240513 3300026118 Bacteria 1749
150 Ga0207698_10106964 3300026142 Bacteria 2334
151 Ga0268266_10000003 3300028379 Bacteria 1701703
152 Ga0268266_10002311 3300028379 Bacteria 20672
153 Ga0268266_10004865 3300028379 Bacteria 12740
154 Ga0268266_10012482 3300028379 Bacteria 7342
155 Ga0268265_10002131 3300028380 Bacteria 15346
156 Ga0268265_10007958 3300028380 Bacteria 7156
157 Ga0268265_10014709 3300028380 Bacteria 5338
158 Ga0268265_10055047 3300028380 Bacteria 3021
159 Ga0268265_10093039 3300028380 Bacteria 2414
160 Ga0268264_10000002 3300028381 Bacteria 1153045
161 Ga0268264_10000211 3300028381 Bacteria 117108
162 Ga0268264_10020569 3300028381 Bacteria 5392
163 Ga0265326_10018995 3300028558 Bacteria 1977
164 Ga0307517_10003359 3300028786 Bacteria 24912
165 Ga0265338_10036862 3300028800 Bacteria 4669
166 Ga0265327_10114553 3300031251 Bacteria 1284
167 Ga0307513_10005351 3300031456 Bacteria 16974
168 Ga0307513_10010060 3300031456 Bacteria 11913
169 Ga0265314_10029775 3300031711 Bacteria 4053
170 Ga0307516_10000019 3300031730 Bacteria 196679
171 Ga0307413_10089034 3300031824 Bacteria 2004
172 Ga0307411_10385336 3300032005 Bacteria 1154
173 Ga0307510_10053330 3300033180 Bacteria 4252
174 Ga0373936_0046992 3300035113 Bacteria 1740
175 Ga0373927_0001359 3300035695 Bacteria 18441
176 Ga0373925_0000032 3300037068 Bacteria 145357
177 Ga0395899_0000018 3300037312 Bacteria 423194
178 Ga0395899_0000680 3300037312 Bacteria 34408
179 Ga0395899_0281899 3300037312 Bacteria 1130
180 Ga0395900_0000111 3300037418 Bacteria 145390
181 Ga0395900_0235213 3300037418 Bacteria 1840
182 Ga0395900_0303086 3300037418 Bacteria 1583
183 Ga0395898_0155802 3300037466 Bacteria 2185
184 Ga0395898_0235871 3300037466 Bacteria 1744
185 Ga0395905_0018478 3300037471 Bacteria 6616
186 Ga0395905_0039591 3300037471 Bacteria 4422
187 Ga0395901_0000032 3300038443 Bacteria 235172
188 Ga0395901_0246523 3300038443 Bacteria 1862
189 Ga0436361_0992833 3300039447 Bacteria 3516
190 Ga0453684_0274985 3300044712 Bacteria 1923
191 Ga0495642_0005332 3300046528 Bacteria 4931
192 Ga0495642_0127080 3300046528 Bacteria 1096
193 Ga0495645_0130086 3300046543 Bacteria 1765
194 Ga0495668_0023247 3300046616 Bacteria 3538
195 Ga0495668_0036907 3300046616 Bacteria 2737
196 Ga0495669_0000012 3300046684 Bacteria 157373
197 Ga0495669_0000250 3300046684 Bacteria 31432
198 Ga0495669_0021117 3300046684 Bacteria 2823
199 Ga0495672_0060679 3300047320 Bacteria 2183
200 Ga0495677_0041365 3300047445 Bacteria 1686
201 Ga0495677_0070610 3300047445 Bacteria 1301
202 Ga0495686_0007283 3300047472 Bacteria 8318
203 Ga0496101_0043111 3300048904 Bacteria 3223
204 Ga0496102_0018777 3300048905 Bacteria 6081
205 Ga0496102_0147187 3300048905 Bacteria 2211
206 Ga0496103_0078448 3300048906 Bacteria 2074
207 Ga0496106_0085205 3300048909 Bacteria 2433
208 Ga0496106_0243708 3300048909 Bacteria 1436
209 Ga0496108_0053899 3300048911 Bacteria 3374
210 Ga0496109_0006327 3300048912 Bacteria 9973
211 Ga0496110_0117697 3300048913 Bacteria 2393
212 Ga0496112_0082470 3300048915 Bacteria 3180
213 Ga0496112_0373517 3300048915 Bacteria 1367
214 Ga0496113_0079183 3300048916 Bacteria 2515
215 Ga0496115_0000465 3300048918 Bacteria 32318
216 Ga0496115_0231780 3300048918 Bacteria 1522
217 Ga0501037_0189882 3300049573 Bacteria 1455
218 Ga0501047_0000771 3300049581 Bacteria 33529
219 Ga0501047_0214411 3300049581 Bacteria 1783
220 Ga0501047_0260036 3300049581 Bacteria 1584
221 Ga0501035_0172425 3300049822 Bacteria 1868
222 Ga0501044_0116331 3300049823 Bacteria 2679
223 Ga0500635_0000048 3300053080 Bacteria 80957
224 Ga0500555_000530 3300053103 Bacteria 15216
225 Ga0500595_046565 3300053119 Bacteria 1363
226 Ga0500636_0013347 3300053177 Bacteria 4824
227 Ga0500637_0071750 3300053178 Bacteria 1991
228 Ga0500645_020663 3300053730 Bacteria 2038
229 2643998441 2643221598 Bacteria 4578346
230 2644086691 2643221614 Bacteria 4260023
231 2644341645 2643221661 Bacteria 4267604
232 2644367932 2643221666 Bacteria 4265935
233 Ga0068864_100173408
234 Ga0055531_10035676
235 Ga0065165_1000331
236 Ga0065165_1020870
237 Ga0070658_10032108
238 Ga0070670_100000035
239 Ga0070670_100100068
240 Ga0070680_100267751
241 Ga0070680_100294561
242 Ga0070660_100012196
243 Ga0070660_100024813
244 Ga0070668_100001477
245 Ga0070668_100002182
246 Ga0070668_100003111
247 Ga0070668_100004551
248 Ga0070668_100111038
249 Ga0070671_100054644
250 Ga0070671_100066073
251 Ga0070673_100079164
252 Ga0070659_100000553
253 Ga0070659_100029633
254 Ga0070659_100032264
255 Ga0070667_100000711
256 Ga0070667_100006239
257 Ga0070667_100012708
258 Ga0070681_10001467
259 Ga0070681_10344453
260 Ga0070681_10506440
261 Ga0070698_100406468
262 Ga0070679_100083333
263 Ga0068853_100020174
264 Ga0070665_100000433
265 Ga0070665_100001010
266 Ga0070665_100006544
267 Ga0068855_100060548
268 Ga0068855_100061653
269 Ga0068855_100064732
270 Ga0068855_100066076
271 Ga0068855_100353851
272 Ga0068854_100105982
273 Ga0068854_100259502
274 Ga0068856_100196707
275 Ga0068856_100228124
276 Ga0068859_100003513
277 Ga0068859_100023142
278 Ga0068864_100000102
279 Ga0068864_100000165
280 Ga0068864_100003190
281 Ga0068864_100111701
282 Ga0068861_100137951
283 Ga0068863_100000128
284 Ga0068863_100002006
285 Ga0068858_100004655
286 Ga0068860_100000100
287 Ga0068860_100000157
288 Ga0068860_100054514
289 Ga0068860_100300622
290 Ga0068862_100000368
291 Ga0068862_100002848
292 Ga0068862_100033565
293 Ga0068862_100106884
294 Ga0068862_100224766
295 Ga0075362_10043428
296 Ga0097621_100046200
297 Ga0068865_100003733
298 Ga0068865_100088614
299 Ga0097620_100003513
300 Ga0097620_100023142
301 Ga0079104_1028134
302 Ga0105250_10009810
303 Ga0105240_10002462
304 Ga0105240_10033911
305 Ga0105240_10037044
306 Ga0105241_10080878
307 Ga0105248_10000106
308 Ga0105248_10028850
309 Ga0105248_10037520
310 Ga0105248_10102694
311 Ga0105238_10036921
312 Ga0105238_10215398
313 Ga0105238_10226019
314 Ga0105238_10357192
315 Ga0105249_10000525
316 Ga0105249_10374177
317 Ga0105239_10138980
318 Ga0157373_10014255
319 Ga0157373_10014307
320 Ga0157370_10233108
321 Ga0163162_10280979
322 Ga0163163_10008143
323 Ga0163163_10164307
324 Ga0163163_10182609
325 Ga0163163_10759796
326 Ga0157379_10277254
327 Ga0213872_10090268
328 Ga0209026_1001873
329 Ga0209758_1000334
330 Ga0209050_1000130
331 Ga0209257_1000059
332 Ga0207680_10252019
333 Ga0207707_10227714
334 Ga0207707_10370479
335 Ga0207695_10000237
336 Ga0207695_10001222
337 Ga0207695_10026883
338 Ga0207695_10051583
339 Ga0207695_10140156
340 Ga0207660_10043685
341 Ga0207660_10076016
342 Ga0207657_10000314
343 Ga0207657_10013900
344 Ga0207657_10054813
345 Ga0207694_10095760
346 Ga0207694_10238875
347 Ga0207650_10000350
348 Ga0207650_10030183
349 Ga0207650_10134220
350 Ga0207687_10061108
351 Ga0207644_10015356
352 Ga0207644_10127070
353 Ga0207690_10000159
354 Ga0207690_10005002
355 Ga0207704_10011758
356 Ga0207711_10000098
357 Ga0207711_10004912
358 Ga0207711_10228802
359 Ga0207711_10320814
360 Ga0207689_10079457
361 Ga0207667_10010250
362 Ga0207667_10112400
363 Ga0207712_10368636
364 Ga0207668_10000025
365 Ga0207668_10000035
366 Ga0207668_10003496
367 Ga0207668_10016710
368 Ga0207640_10155916
369 Ga0207640_10223627
370 Ga0207658_10000300
371 Ga0207658_10001621
372 Ga0207658_10436200
373 Ga0207703_10000726
374 Ga0207639_10272055
375 Ga0207702_10124596
376 Ga0207641_10000005
377 Ga0207641_10016442
378 Ga0207676_10000066
379 Ga0207676_10001155
380 Ga0207676_10007091
381 Ga0207675_100240513
382 Ga0207698_10106964
383 Ga0268266_10000003
384 Ga0268266_10002311
385 Ga0268266_10004865
386 Ga0268266_10012482
387 Ga0268265_10002131
388 Ga0268265_10007958
389 Ga0268265_10014709
390 Ga0268265_10055047
391 Ga0268265_10093039
392 Ga0268264_10000002
393 Ga0268264_10000211
394 Ga0268264_10020569
395 Ga0265326_10018995
396 Ga0307517_10003359
397 Ga0265338_10036862
398 Ga0265327_10114553
399 Ga0307513_10005351
400 Ga0307513_10010060
401 Ga0265314_10029775
402 Ga0307516_10000019
403 Ga0307413_10089034
404 Ga0307411_10385336
405 Ga0307510_10053330
406 Ga0373936_0046992
407 Ga0373927_0001359
408 Ga0373925_0000032
409 Ga0395899_0000018
410 Ga0395899_0000680
411 Ga0395899_0281899
412 Ga0395900_0000111
413 Ga0395900_0235213
414 Ga0395900_0303086
415 Ga0395898_0155802
416 Ga0395898_0235871
417 Ga0395905_0018478
418 Ga0395905_0039591
419 Ga0395901_0000032
420 Ga0395901_0246523
421 Ga0436361_0992833
422 Ga0453684_0274985
423 Ga0495642_0005332
424 Ga0495642_0127080
425 Ga0495645_0130086
426 Ga0495668_0023247
427 Ga0495668_0036907
428 Ga0495669_0000012
429 Ga0495669_0000250
430 Ga0495669_0021117
431 Ga0495672_0060679
432 Ga0495677_0041365
433 Ga0495677_0070610
434 Ga0495686_0007283
435 Ga0496101_0043111
436 Ga0496102_0018777
437 Ga0496102_0147187
438 Ga0496103_0078448
439 Ga0496106_0085205
440 Ga0496106_0243708
441 Ga0496108_0053899
442 Ga0496109_0006327
443 Ga0496110_0117697
444 Ga0496112_0082470
445 Ga0496112_0373517
446 Ga0496113_0079183
447 Ga0496115_0000465
448 Ga0496115_0231780
449 Ga0501037_0189882
450 Ga0501047_0000771
451 Ga0501047_0214411
452 Ga0501047_0260036
453 Ga0501035_0172425
454 Ga0501044_0116331
455 Ga0500635_0000048
456 Ga0500555_000530
457 Ga0500595_046565
458 Ga0500636_0013347
459 Ga0500637_0071750
460 Ga0500645_020663
461 2643998441
462 2644086691
463 2644341645
464 2644367932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

156

291

0.94

PF00892

EamA

EamA-like transporter family

15

144

0.89

PF06027

SLC35F

Solute carrier family 35

89

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7835 12 293
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.7818 212 287
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7512 12 293
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7418 17 287
7b0k-assembly1.cif.gz_A membrane protein structure 0.7386 17 287
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8768 21 289 1.20.1740.10
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8387 203 288 1.10.3730.20
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8016 21 289 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7941 13 294 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7882 16 290 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A0Q7S587-F1-model_v4 EamA domain-containing protein 0.9466 9 294 GO:0016020
AF-U2EEG3-F1-model_v4 Transporter Drug-Metabolite Exporter family protein 0.9266 15 294 GO:0016020
AF-A0A2U1F0Y7-F1-model_v4 Threonine/homoserine efflux transporter RhtA 0.9213 12 292 GO:0016020
AF-A0A7Z8GNK2-F1-model_v4 deleted 0.921 15 294
AF-A0A7C6YT11-F1-model_v4 DMT family transporter 0.9208 13 294 GO:0016020

Map