F345019

General Info

Members Datasets Scaffolds Average Seq Length
232 124 458 296

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10062463|Ga0105237_100624632
Length 339
Sequence VRSYKFLAIGASARAGKKLNENFHIKPPIMYTRRSFLRAASLYSAGALAAPALVSFVANARPSDNGSPIHTAGHPTIGLQLYTVRDAMQTDPSGTLAKVANIGYNSLEGATYTGTEKFYGMAPKEFKDLLKSNGLKMRSCHYRLGEDKGKEAEMKGTILDDWSRAVDDGAELGLQYMVCAWLSPAERKDLDHYKWMAGEFNKAAEVCKKAGIQFCYHNHDFEFDQQDGKYPYDTLLENTDKDLVKMEMDLYWVTKAGQEPLALFAKHPGRFPLWHLKDMDATPEHSFTEVGNGTIDFKKIFTHAHEAGMKYFFVEQDKCPGSPFDSITKSMDYIKKNLV

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
124 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 0
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 9.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10062463 3300009545 Bacteria 3724
2 rootH1_10078494 3300003316 Bacteria 2924
3 rootH2_10005170 3300003320 Bacteria 79894
4 rootH2_10091427 3300003320 Bacteria 9721
5 rootH1_10015499 3300003323 Bacteria 86587
6 rootH1_10281372 3300003323 Bacteria 8405
7 JGI25160J50197_1016843 3300003354 Bacteria 2339
8 Ga0065712_10171424 3300005290 Bacteria 1181
9 Ga0070658_10200784 3300005327 Bacteria 1682
10 Ga0070683_100002039 3300005329 Bacteria 15909
11 Ga0070683_100043713 3300005329 Bacteria 4129
12 Ga0068869_100168033 3300005334 Bacteria 1712
13 Ga0070680_100001989 3300005336 Bacteria 15039
14 Ga0070682_100001734 3300005337 Bacteria 12127
15 Ga0070660_100061954 3300005339 Bacteria 2905
16 Ga0070691_10003740 3300005341 Bacteria 6870
17 Ga0070667_100111836 3300005367 Bacteria 2369
18 Ga0070667_100440776 3300005367 Bacteria 1189
19 Ga0070681_10006547 3300005458 Bacteria 11339
20 Ga0070681_10028894 3300005458 Bacteria 5571
21 Ga0068867_100017106 3300005459 Bacteria 5151
22 Ga0068867_100201260 3300005459 Bacteria 1594
23 Ga0070679_100046608 3300005530 Bacteria 4320
24 Ga0070679_100107077 3300005530 Bacteria 2781
25 Ga0070684_100076005 3300005535 Unclassified 2963
26 Ga0070684_100269593 3300005535 Bacteria 1558
27 Ga0068853_100001498 3300005539 Bacteria 16965
28 Ga0068853_100022286 3300005539 Bacteria 5289
29 Ga0068853_100085957 3300005539 Bacteria 2758
30 Ga0068853_100330845 3300005539 Bacteria 1414
31 Ga0070693_100017726 3300005547 Bacteria 3708
32 Ga0070665_100000047 3300005548 Bacteria 269702
33 Ga0068855_100003169 3300005563 Bacteria 20134
34 Ga0068855_100008174 3300005563 Bacteria 12650
35 Ga0068855_100014689 3300005563 Bacteria 9432
36 Ga0068855_100019509 3300005563 Bacteria 8148
37 Ga0068855_100033374 3300005563 Bacteria 6143
38 Ga0068857_100001156 3300005577 Bacteria 20612
39 Ga0068854_100091527 3300005578 Unclassified 2264
40 Ga0068854_100291209 3300005578 Unclassified 1318
41 Ga0068856_100028544 3300005614 Bacteria 5448
42 Ga0068856_100351619 3300005614 Bacteria 1492
43 Ga0068852_100000884 3300005616 Bacteria 19821
44 Ga0068852_100001611 3300005616 Bacteria 15376
45 Ga0068852_100060513 3300005616 Bacteria 3287
46 Ga0068852_100382994 3300005616 Bacteria 1380
47 Ga0068859_100176284 3300005617 Bacteria 2220
48 Ga0068860_100000003 3300005843 Bacteria 575741
49 Ga0081540_1003946 3300005983 Bacteria 11527
50 Ga0081539_10000081 3300005985 Bacteria 222614
51 Ga0097621_100000768 3300006237 Bacteria 22494
52 Ga0097621_100077067 3300006237 Bacteria 2767
53 Ga0068871_100083797 3300006358 Bacteria 2645
54 Ga0068871_100295221 3300006358 Bacteria 1421
55 Ga0097620_100176286 3300006931 Bacteria 2220
56 Ga0105240_10000356 3300009093 Bacteria 85978
57 Ga0105240_10000383 3300009093 Bacteria 83057
58 Ga0105240_10000401 3300009093 Bacteria 80500
59 Ga0105240_10002143 3300009093 Bacteria 32241
60 Ga0105240_10003287 3300009093 Bacteria 25283
61 Ga0105240_10036036 3300009093 Bacteria 6370
62 Ga0105240_10049382 3300009093 Bacteria 5310
63 Ga0105240_10058183 3300009093 Bacteria 4826
64 Ga0105240_10142096 3300009093 Bacteria 2869
65 Ga0105240_10171994 3300009093 Bacteria 2564
66 Ga0105241_10000785 3300009174 Bacteria 24123
67 Ga0105241_10026807 3300009174 Bacteria 4289
68 Ga0105241_10028730 3300009174 Bacteria 4144
69 Ga0105241_10032056 3300009174 Unclassified 3936
70 Ga0105242_10158114 3300009176 Bacteria 1981
71 Ga0105237_10000284 3300009545 Bacteria 69955
72 Ga0105237_10019217 3300009545 Bacteria 7060
73 Ga0105237_10030430 3300009545 Bacteria 5483
74 Ga0105237_10057640 3300009545 Unclassified 3887
75 Ga0105238_10000986 3300009551 Bacteria 29095
76 Ga0105238_10002681 3300009551 Bacteria 17698
77 Ga0105238_10017383 3300009551 Bacteria 7307
78 Ga0105238_10430583 3300009551 Unclassified 1315
79 Ga0105239_10000129 3300010375 Bacteria 106549
80 Ga0105239_10000683 3300010375 Bacteria 48374
81 Ga0105239_10014443 3300010375 Bacteria 8764
82 Ga0105239_10060703 3300010375 Bacteria 4150
83 Ga0105239_10210166 3300010375 Bacteria 2181
84 Ga0157373_10026392 3300013100 Bacteria 4195
85 Ga0157373_10102570 3300013100 Bacteria 2013
86 Ga0157373_10300654 3300013100 Bacteria 1139
87 Ga0157371_10006216 3300013102 Bacteria 9899
88 Ga0157371_10026013 3300013102 Bacteria 4258
89 Ga0157371_10054425 3300013102 Bacteria 2842
90 Ga0157371_10067773 3300013102 Bacteria 2526
91 Ga0157370_10001966 3300013104 Bacteria 25315
92 Ga0157370_10003837 3300013104 Bacteria 17527
93 Ga0157370_10006208 3300013104 Bacteria 13252
94 Ga0157370_10026220 3300013104 Bacteria 5758
95 Ga0157370_10139191 3300013104 Bacteria 2262
96 Ga0157370_10176841 3300013104 Bacteria 1983
97 Ga0157370_10203438 3300013104 Unclassified 1837
98 Ga0157370_10208090 3300013104 Bacteria 1813
99 Ga0157369_10018209 3300013105 Bacteria 7877
100 Ga0157369_10053005 3300013105 Bacteria 4386
101 Ga0157369_10054234 3300013105 Bacteria 4329
102 Ga0157369_10352475 3300013105 Unclassified 1528
103 Ga0157369_10617115 3300013105 Bacteria 1119
104 Ga0163162_10005732 3300013306 Bacteria 12011
105 Ga0163162_10006912 3300013306 Bacteria 11003
106 Ga0163162_10046972 3300013306 Bacteria 4328
107 Ga0157372_10001911 3300013307 Bacteria 22615
108 Ga0157372_10008796 3300013307 Bacteria 10724
109 Ga0157372_10017043 3300013307 Bacteria 7799
110 Ga0157372_10049705 3300013307 Bacteria 4664
111 Ga0157372_10093773 3300013307 Bacteria 3417
112 Ga0157372_10107467 3300013307 Bacteria 3193
113 Ga0157375_10209065 3300013308 Bacteria 2108
114 Ga0157379_10013740 3300014968 Bacteria 7096
115 Ga0157376_10002786 3300014969 Bacteria 11938
116 Ga0157376_10003651 3300014969 Bacteria 10623
117 Ga0157376_10007370 3300014969 Bacteria 7846
118 Ga0157376_10010794 3300014969 Bacteria 6704
119 Ga0157376_10041807 3300014969 Bacteria 3756
120 Ga0209646_1000002 3300025246 Bacteria 1425781
121 Ga0209026_1000300 3300025250 Bacteria 53962
122 Ga0209758_1002488 3300025297 Bacteria 18730
123 Ga0207426_1000322 3300025302 Bacteria 91914
124 Ga0207426_1052353 3300025302 Bacteria 1209
125 Ga0207647_10033220 3300025904 Unclassified 3305
126 Ga0207705_10169730 3300025909 Bacteria 1642
127 Ga0207654_10009973 3300025911 Unclassified 4830
128 Ga0207707_10001095 3300025912 Bacteria 25842
129 Ga0207707_10063779 3300025912 Bacteria 3206
130 Ga0207695_10000209 3300025913 Bacteria 157802
131 Ga0207695_10000300 3300025913 Bacteria 122104
132 Ga0207695_10000365 3300025913 Bacteria 103398
133 Ga0207695_10000483 3300025913 Bacteria 85395
134 Ga0207695_10027308 3300025913 Bacteria 6358
135 Ga0207695_10097131 3300025913 Unclassified 2947
136 Ga0207695_10105982 3300025913 Bacteria 2797
137 Ga0207671_10000650 3300025914 Bacteria 45400
138 Ga0207671_10001902 3300025914 Bacteria 23210
139 Ga0207671_10012219 3300025914 Bacteria 6922
140 Ga0207660_10003143 3300025917 Bacteria 10804
141 Ga0207657_10008593 3300025919 Bacteria 10343
142 Ga0207657_10024556 3300025919 Bacteria 5575
143 Ga0207657_10147143 3300025919 Unclassified 1921
144 Ga0207652_10016801 3300025921 Bacteria 5980
145 Ga0207652_10025130 3300025921 Bacteria 4948
146 Ga0207652_10138925 3300025921 Bacteria 2171
147 Ga0207652_10259800 3300025921 Unclassified 1566
148 Ga0207694_10006077 3300025924 Bacteria 9231
149 Ga0207694_10087711 3300025924 Bacteria 2452
150 Ga0207650_10517683 3300025925 Bacteria 998
151 Ga0207691_10068422 3300025940 Bacteria 3208
152 Ga0207691_10202034 3300025940 Bacteria 1729
153 Ga0207661_10001596 3300025944 Bacteria 15402
154 Ga0207667_10000902 3300025949 Bacteria 37879
155 Ga0207667_10005516 3300025949 Bacteria 15432
156 Ga0207667_10023618 3300025949 Bacteria 6768
157 Ga0207667_10036187 3300025949 Bacteria 5292
158 Ga0207667_10043309 3300025949 Bacteria 4778
159 Ga0207667_10050284 3300025949 Bacteria 4398
160 Ga0207667_10102443 3300025949 Bacteria 2953
161 Ga0207667_10117982 3300025949 Unclassified 2735
162 Ga0207640_10106127 3300025981 Unclassified 1981
163 Ga0207639_10010679 3300026041 Bacteria 6360
164 Ga0207639_10285928 3300026041 Unclassified 1452
165 Ga0207639_10428676 3300026041 Unclassified 1197
166 Ga0207702_10032871 3300026078 Bacteria 4330
167 Ga0207648_10015668 3300026089 Bacteria 6961
168 Ga0207674_10006016 3300026116 Bacteria 14350
169 Ga0207698_10001281 3300026142 Bacteria 14671
170 Ga0207698_10012945 3300026142 Bacteria 5484
171 Ga0268266_10000104 3300028379 Bacteria 178320
172 Ga0268264_10000028 3300028381 Bacteria 426662
173 Ga0268264_10149449 3300028381 Bacteria 2093
174 Ga0307517_10003352 3300028786 Bacteria 24924
175 Ga0307511_10000002 3300030521 Bacteria 199923
176 Ga0307509_10199447 3300031507 Bacteria 1840
177 Ga0307516_10000590 3300031730 Bacteria 49207
178 Ga0307416_100212266 3300032002 Bacteria 1848
179 Ga0307414_10445776 3300032004 Bacteria 1134
180 Ga0307510_10016025 3300033180 Bacteria 8851
181 Ga0307510_10063075 3300033180 Bacteria 3778
182 Ga0373955_0066363 3300035172 Bacteria 2006
183 Ga0373937_0342752 3300036401 Bacteria 1415
184 Ga0395898_0453046 3300037466 Bacteria 1222
185 Ga0466965_0013309 3300044683 Unclassified 3881
186 Ga0466961_0126388 3300044693 Unclassified 1604
187 Ga0453684_0000328 3300044712 Bacteria 199181
188 Ga0453684_0170842 3300044712 Bacteria 2562
189 Ga0466971_0011187 3300044719 Bacteria 3931
190 Ga0466968_0211265 3300044735 Unclassified 912
191 Ga0466959_0000330 3300045049 Bacteria 27908
192 Ga0451576_0025157 3300045051 Bacteria 6418
193 Ga0466958_0044453 3300045836 Bacteria 2677
194 Ga0495629_0133764 3300046459 Bacteria 1727
195 Ga0495638_0013672 3300046460 Bacteria 5515
196 Ga0495606_0002459 3300046507 Bacteria 21479
197 Ga0495616_0013795 3300046513 Bacteria 4545
198 Ga0495630_0239965 3300046517 Bacteria 1385
199 Ga0495648_0001088 3300046524 Bacteria 27639
200 Ga0495587_0215475 3300046536 Bacteria 1084
201 Ga0495633_0178791 3300046558 Bacteria 977
202 Ga0495611_0000030 3300046648 Bacteria 111786
203 Ga0495657_0104735 3300046675 Bacteria 1799
204 Ga0495600_0220629 3300046809 Bacteria 1213
205 Ga0495581_0178395 3300047315 Bacteria 1242
206 Ga0495683_0055113 3300047323 Bacteria 1980
207 Ga0495687_001236 3300047443 Bacteria 24392
208 Ga0495686_0000005 3300047472 Bacteria 827143
209 Ga0495686_0000098 3300047472 Bacteria 183131
210 Ga0501034_0067300 3300049571 Bacteria 3595
211 Ga0501034_0329661 3300049571 Bacteria 1458
212 Ga0501043_0147483 3300049579 Unclassified 1842
213 Ga0501046_0014333 3300049580 Bacteria 6694
214 Ga0501047_0269558 3300049581 Unclassified 1549
215 Ga0501067_0006973 3300049583 Bacteria 6269
216 Ga0501070_0036910 3300049586 Bacteria 4080
217 Ga0501070_0200643 3300049586 Bacteria 1638
218 Ga0501080_0285131 3300049742 Unclassified 1500
219 Ga0501083_0039811 3300049744 Bacteria 3191
220 Ga0501044_0053626 3300049823 Bacteria 4148
221 nmdc:mga08y16_439494_c1 3300050511 Bacteria 1332
222 Ga0495619_0045003 3300053085 Bacteria 2899
223 Ga0500583_0020549 3300053092 Bacteria 2728
224 Ga0500642_0004674 3300053130 Bacteria 4320
225 Ga0500568_0003220 3300053139 Bacteria 9246
226 Ga0500637_0087788 3300053178 Bacteria 1799
227 Ga0501082_0018212 3300060353 Bacteria 6047
228 2929923727 2929921140 Bacteria 8649150
229 8003153746 8003151029 Bacteria 8187759
230 Ga0105237_10062463
231 rootH1_10078494
232 rootH2_10005170
233 rootH2_10091427
234 rootH1_10015499
235 rootH1_10281372
236 JGI25160J50197_1016843
237 Ga0065712_10171424
238 Ga0070658_10200784
239 Ga0070683_100002039
240 Ga0070683_100043713
241 Ga0068869_100168033
242 Ga0070680_100001989
243 Ga0070682_100001734
244 Ga0070660_100061954
245 Ga0070691_10003740
246 Ga0070667_100111836
247 Ga0070667_100440776
248 Ga0070681_10006547
249 Ga0070681_10028894
250 Ga0068867_100017106
251 Ga0068867_100201260
252 Ga0070679_100046608
253 Ga0070679_100107077
254 Ga0070684_100076005
255 Ga0070684_100269593
256 Ga0068853_100001498
257 Ga0068853_100022286
258 Ga0068853_100085957
259 Ga0068853_100330845
260 Ga0070693_100017726
261 Ga0070665_100000047
262 Ga0068855_100003169
263 Ga0068855_100008174
264 Ga0068855_100014689
265 Ga0068855_100019509
266 Ga0068855_100033374
267 Ga0068857_100001156
268 Ga0068854_100091527
269 Ga0068854_100291209
270 Ga0068856_100028544
271 Ga0068856_100351619
272 Ga0068852_100000884
273 Ga0068852_100001611
274 Ga0068852_100060513
275 Ga0068852_100382994
276 Ga0068859_100176284
277 Ga0068860_100000003
278 Ga0081540_1003946
279 Ga0081539_10000081
280 Ga0097621_100000768
281 Ga0097621_100077067
282 Ga0068871_100083797
283 Ga0068871_100295221
284 Ga0097620_100176286
285 Ga0105240_10000356
286 Ga0105240_10000383
287 Ga0105240_10000401
288 Ga0105240_10002143
289 Ga0105240_10003287
290 Ga0105240_10036036
291 Ga0105240_10049382
292 Ga0105240_10058183
293 Ga0105240_10142096
294 Ga0105240_10171994
295 Ga0105241_10000785
296 Ga0105241_10026807
297 Ga0105241_10028730
298 Ga0105241_10032056
299 Ga0105242_10158114
300 Ga0105237_10000284
301 Ga0105237_10019217
302 Ga0105237_10030430
303 Ga0105237_10057640
304 Ga0105238_10000986
305 Ga0105238_10002681
306 Ga0105238_10017383
307 Ga0105238_10430583
308 Ga0105239_10000129
309 Ga0105239_10000683
310 Ga0105239_10014443
311 Ga0105239_10060703
312 Ga0105239_10210166
313 Ga0157373_10026392
314 Ga0157373_10102570
315 Ga0157373_10300654
316 Ga0157371_10006216
317 Ga0157371_10026013
318 Ga0157371_10054425
319 Ga0157371_10067773
320 Ga0157370_10001966
321 Ga0157370_10003837
322 Ga0157370_10006208
323 Ga0157370_10026220
324 Ga0157370_10139191
325 Ga0157370_10176841
326 Ga0157370_10203438
327 Ga0157370_10208090
328 Ga0157369_10018209
329 Ga0157369_10053005
330 Ga0157369_10054234
331 Ga0157369_10352475
332 Ga0157369_10617115
333 Ga0163162_10005732
334 Ga0163162_10006912
335 Ga0163162_10046972
336 Ga0157372_10001911
337 Ga0157372_10008796
338 Ga0157372_10017043
339 Ga0157372_10049705
340 Ga0157372_10093773
341 Ga0157372_10107467
342 Ga0157375_10209065
343 Ga0157379_10013740
344 Ga0157376_10002786
345 Ga0157376_10003651
346 Ga0157376_10007370
347 Ga0157376_10010794
348 Ga0157376_10041807
349 Ga0209646_1000002
350 Ga0209026_1000300
351 Ga0209758_1002488
352 Ga0207426_1000322
353 Ga0207426_1052353
354 Ga0207647_10033220
355 Ga0207705_10169730
356 Ga0207654_10009973
357 Ga0207707_10001095
358 Ga0207707_10063779
359 Ga0207695_10000209
360 Ga0207695_10000300
361 Ga0207695_10000365
362 Ga0207695_10000483
363 Ga0207695_10027308
364 Ga0207695_10097131
365 Ga0207695_10105982
366 Ga0207671_10000650
367 Ga0207671_10001902
368 Ga0207671_10012219
369 Ga0207660_10003143
370 Ga0207657_10008593
371 Ga0207657_10024556
372 Ga0207657_10147143
373 Ga0207652_10016801
374 Ga0207652_10025130
375 Ga0207652_10138925
376 Ga0207652_10259800
377 Ga0207694_10006077
378 Ga0207694_10087711
379 Ga0207650_10517683
380 Ga0207691_10068422
381 Ga0207691_10202034
382 Ga0207661_10001596
383 Ga0207667_10000902
384 Ga0207667_10005516
385 Ga0207667_10023618
386 Ga0207667_10036187
387 Ga0207667_10043309
388 Ga0207667_10050284
389 Ga0207667_10102443
390 Ga0207667_10117982
391 Ga0207640_10106127
392 Ga0207639_10010679
393 Ga0207639_10285928
394 Ga0207639_10428676
395 Ga0207702_10032871
396 Ga0207648_10015668
397 Ga0207674_10006016
398 Ga0207698_10001281
399 Ga0207698_10012945
400 Ga0268266_10000104
401 Ga0268264_10000028
402 Ga0268264_10149449
403 Ga0307517_10003352
404 Ga0307511_10000002
405 Ga0307509_10199447
406 Ga0307516_10000590
407 Ga0307416_100212266
408 Ga0307414_10445776
409 Ga0307510_10016025
410 Ga0307510_10063075
411 Ga0373955_0066363
412 Ga0373937_0342752
413 Ga0395898_0453046
414 Ga0466965_0013309
415 Ga0466961_0126388
416 Ga0453684_0000328
417 Ga0453684_0170842
418 Ga0466971_0011187
419 Ga0466968_0211265
420 Ga0466959_0000330
421 Ga0451576_0025157
422 Ga0466958_0044453
423 Ga0495629_0133764
424 Ga0495638_0013672
425 Ga0495606_0002459
426 Ga0495616_0013795
427 Ga0495630_0239965
428 Ga0495648_0001088
429 Ga0495587_0215475
430 Ga0495633_0178791
431 Ga0495611_0000030
432 Ga0495657_0104735
433 Ga0495600_0220629
434 Ga0495581_0178395
435 Ga0495683_0055113
436 Ga0495687_001236
437 Ga0495686_0000005
438 Ga0495686_0000098
439 Ga0501034_0067300
440 Ga0501034_0329661
441 Ga0501043_0147483
442 Ga0501046_0014333
443 Ga0501047_0269558
444 Ga0501067_0006973
445 Ga0501070_0036910
446 Ga0501070_0200643
447 Ga0501080_0285131
448 Ga0501083_0039811
449 Ga0501044_0053626
450 nmdc:mga08y16_439494_c1
451 Ga0495619_0045003
452 Ga0500583_0020549
453 Ga0500642_0004674
454 Ga0500568_0003220
455 Ga0500637_0087788
456 Ga0501082_0018212
457 2929923727
458 8003153746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

96

337

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8955 32 273
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8759 32 273
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8533 29 276
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8525 34 294
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8321 29 276
ID Description Score Start End Superfamily
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8013 34 294 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7978 18 293 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7788 18 293 3.20.20.150
3l23A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7785 34 294 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7653 33 294 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1Q7ZK91-F1-model_v4 Xylose isomerase 0.9833 34 295 GO:0016853
AF-A0A520GV18-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9805 43 297 GO:0016853
AF-A0A4V2BGS0-F1-model_v4 deleted 0.9792 195 297
AF-A0A1G0PH46-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9788 34 295
AF-A0A520GV18-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9766 43 297 GO:0016853

Map