F345086

General Info

Members Datasets Scaffolds Average Seq Length
232 166 205 334

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10008326|Ga0213872_100083263
Length 368
Sequence VDIPSLAKNLQPFRLYPIRRVCFLIPMHLVGFSMRSLLRSLAILSVAGSLVTHVSADPIHLLNVSYDPTRELYEEFNQAFAKDYLTKTGKQVTIEQSHGGSGKQARSVIDGLEADVVTLGLAADIDALHDNGNLVAADWQTKFPHNSCPYTSTIVLLVRQGNPKGIKDWPDLIKPGIQVITPNPKTSSGGRWNFIAAWGYALKANQNDESKAKEFITALYKNVPVLDSGARGSTTTFVQRELGDVLIAWENEAYLSFKEFGADKFAIVNPSVSVLAEPPVAVVDKVVDKKGTRDTATAYLQYLYTPIGQEIIAKNFYRPIDPQVSAKYSKQFPNIELFTIDKVFGGWKAAQPKFFADGGIFDQIYQPK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221638 Duganella sp. Root336D2 Isolate Unclassified
7 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
8 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
11 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
12 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
13 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
14 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
15 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
16 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
17 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
18 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
19 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
20 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
21 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
159 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
163 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
164 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
165 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
166 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.36
Metatranscriptomes 0
Isolates 11.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 28.02
Nodule 2.16
Rhizoplane 4.31
Rhizosphere 55.17
Stem 0
Stem Tuber 0
Unclassified 9.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1007165 3300002739 Bacteria 1578
2 JGI25152J39213_1000082 3300002773 Bacteria 65365
3 JGI25150J39212_1001021 3300002774 Bacteria 8642
4 JGI25150J39212_1004319 3300002774 Bacteria 3179
5 JGI25159J45721_1003045 3300002987 Bacteria 6068
6 JGI25153J46596_10001132 3300003215 Bacteria 16133
7 JGI25160J50197_1005039 3300003354 Bacteria 5581
8 JGI25161J50226_1008006 3300003374 Bacteria 1678
9 Ga0055526_1008235 3300003771 Bacteria 5239
10 Ga0055526_1029011 3300003771 Bacteria 1657
11 Ga0055537_1012540 3300003773 Bacteria 1646
12 Ga0055537_1014318 3300003773 Bacteria 1446
13 Ga0055524_1000970 3300003775 Bacteria 18003
14 Ga0055524_1024641 3300003775 Bacteria 1902
15 Ga0055524_1028794 3300003775 Bacteria 1657
16 Ga0055534_1001874 3300003784 Bacteria 7802
17 Ga0055534_1015318 3300003784 Bacteria 1408
18 Ga0055528_1002025 3300003790 Bacteria 11353
19 Ga0055530_10001343 3300003791 Bacteria 18384
20 Ga0055530_10011535 3300003791 Bacteria 3165
21 Ga0055530_10011562 3300003791 Bacteria 3158
22 Ga0055531_10023860 3300003794 Bacteria 2277
23 Ga0055531_10033440 3300003794 Bacteria 1656
24 Ga0058692_1012225 3300003856 Bacteria 2043
25 Ga0055543_1000944 3300004625 Bacteria 13329
26 Ga0065165_1003067 3300005262 Bacteria 12502
27 Ga0070658_10003209 3300005327 Bacteria 13497
28 Ga0070666_10001402 3300005335 Bacteria 14566
29 Ga0070680_100261736 3300005336 Bacteria 1463
30 Ga0070661_100293778 3300005344 Bacteria 1263
31 Ga0070667_100370390 3300005367 Bacteria 1299
32 Ga0070709_10037993 3300005434 Bacteria 2945
33 Ga0070714_100000020 3300005435 Bacteria 169262
34 Ga0070714_100069377 3300005435 Unclassified 3044
35 Ga0070714_100079746 3300005435 Bacteria 2847
36 Ga0070713_100002572 3300005436 Bacteria 11861
37 Ga0070710_10016355 3300005437 Bacteria 3773
38 Ga0070708_100019391 3300005445 Bacteria 5715
39 Ga0070708_100235404 3300005445 Bacteria 1719
40 Ga0070681_10072466 3300005458 Bacteria 3407
41 Ga0070681_10080362 3300005458 Bacteria 3216
42 Ga0070706_100123579 3300005467 Bacteria 2413
43 Ga0070706_100141543 3300005467 Bacteria 2245
44 Ga0070707_100005002 3300005468 Bacteria 12421
45 Ga0070698_100192212 3300005471 Bacteria 1978
46 Ga0070699_100010011 3300005518 Bacteria 8205
47 Ga0070679_100081946 3300005530 Bacteria 3216
48 Ga0070665_100021009 3300005548 Bacteria 6563
49 Ga0068855_100019435 3300005563 Bacteria 8162
50 Ga0068855_100295117 3300005563 Bacteria 1796
51 Ga0068851_10038254 3300005834 Bacteria 2406
52 Ga0068858_100014648 3300005842 Bacteria 7385
53 Ga0075363_100008892 3300006048 Bacteria 4699
54 Ga0070712_100131510 3300006175 Bacteria 1897
55 Ga0075362_10055518 3300006177 Bacteria 1781
56 Ga0075366_10008671 3300006195 Bacteria 5661
57 Ga0075428_100005564 3300006844 Bacteria 14006
58 Ga0099795_10006388 3300007788 Bacteria 3213
59 Ga0105251_10008448 3300009011 Bacteria 6195
60 Ga0111539_10005551 3300009094 Bacteria 16310
61 Ga0105238_10089051 3300009551 Bacteria 3073
62 Ga0157371_10005576 3300013102 Bacteria 10576
63 Ga0157371_10077894 3300013102 Bacteria 2348
64 Ga0157370_10020590 3300013104 Bacteria 6585
65 Ga0157369_10004801 3300013105 Bacteria 15882
66 Ga0157369_10129172 3300013105 Bacteria 2678
67 Ga0213872_10006025 3300021361 Bacteria 6143
68 Ga0213872_10008326 3300021361 Bacteria 5023
69 Ga0213872_10014431 3300021361 Bacteria 3686
70 Ga0213872_10060391 3300021361 Bacteria 1714
71 Ga0213876_10004571 3300021384 Bacteria 7717
72 Ga0213876_10069209 3300021384 Bacteria 1864
73 Ga0209436_100185 3300025208 Bacteria 28976
74 Ga0209436_100799 3300025208 Bacteria 12950
75 Ga0207425_1000001 3300025245 Bacteria 2525432
76 Ga0207425_1000194 3300025245 Bacteria 48678
77 Ga0207425_1006111 3300025245 Bacteria 3333
78 Ga0209129_1000001 3300025258 Bacteria 1452436
79 Ga0209129_1002734 3300025258 Bacteria 8264
80 Ga0209565_1000567 3300025263 Bacteria 25399
81 Ga0209565_1006204 3300025263 Bacteria 3383
82 Ga0209673_1023996 3300025273 Bacteria 2060
83 Ga0209130_1000391 3300025284 Bacteria 48004
84 Ga0209130_1003089 3300025284 Bacteria 7448
85 Ga0209675_1000496 3300025291 Bacteria 29513
86 Ga0209675_1001691 3300025291 Bacteria 12232
87 Ga0209564_1000813 3300025295 Bacteria 42574
88 Ga0209564_1002459 3300025295 Bacteria 14536
89 Ga0209758_1000055 3300025297 Bacteria 336183
90 Ga0209050_1000334 3300025298 Bacteria 93637
91 Ga0209050_1000743 3300025298 Bacteria 46935
92 Ga0209050_1014272 3300025298 Bacteria 3438
93 Ga0209256_1000269 3300025299 Bacteria 91493
94 Ga0209256_1000780 3300025299 Bacteria 41123
95 Ga0209256_1000867 3300025299 Bacteria 37536
96 Ga0209256_1025078 3300025299 Bacteria 1743
97 Ga0207426_1003655 3300025302 Bacteria 8110
98 Ga0209257_1000010 3300025304 Bacteria 1158682
99 Ga0209257_1001145 3300025304 Bacteria 33847
100 Ga0209257_1005235 3300025304 Bacteria 9278
101 Ga0207655_1061782 3300025728 Bacteria 1444
102 Ga0207713_1049991 3300025735 Bacteria 1672
103 Ga0207680_10000525 3300025903 Bacteria 18250
104 Ga0207705_10037733 3300025909 Bacteria 3457
105 Ga0207684_10013904 3300025910 Bacteria 6952
106 Ga0207684_10076027 3300025910 Bacteria 2854
107 Ga0207684_10138385 3300025910 Unclassified 2092
108 Ga0207707_10009338 3300025912 Bacteria 8505
109 Ga0207707_10049572 3300025912 Bacteria 3658
110 Ga0207695_10008647 3300025913 Bacteria 12710
111 Ga0207693_10175171 3300025915 Bacteria 1688
112 Ga0207657_10014891 3300025919 Bacteria 7566
113 Ga0207652_10040878 3300025921 Bacteria 3939
114 Ga0207646_10015211 3300025922 Bacteria 7280
115 Ga0207694_10036656 3300025924 Bacteria 3764
116 Ga0207700_10018977 3300025928 Bacteria 4636
117 Ga0207664_10000023 3300025929 Bacteria 204730
118 Ga0207664_10010324 3300025929 Bacteria 6595
119 Ga0207690_10001386 3300025932 Bacteria 15230
120 Ga0207706_10006952 3300025933 Bacteria 10458
121 Ga0207667_10029251 3300025949 Bacteria 5976
122 Ga0207667_10067770 3300025949 Bacteria 3717
123 Ga0207667_10285036 3300025949 Bacteria 1688
124 Ga0207658_10012460 3300025986 Bacteria 5809
125 Ga0207639_10182239 3300026041 Bacteria 1787
126 Ga0268256_1012112 3300030500 Bacteria 2686
127 Ga0265328_10000241 3300031239 Bacteria 25163
128 Ga0265320_10000539 3300031240 Bacteria 29285
129 Ga0265339_10010923 3300031249 Bacteria 5613
130 Ga0265339_10111547 3300031249 Bacteria 1414
131 Ga0265331_10000141 3300031250 Bacteria 94896
132 Ga0265331_10028446 3300031250 Bacteria 2795
133 Ga0265316_10030374 3300031344 Bacteria 4431
134 Ga0307408_100002629 3300031548 Bacteria 12490
135 Ga0307408_100005255 3300031548 Bacteria 8675
136 Ga0307408_100040157 3300031548 Bacteria 3312
137 Ga0307408_100094665 3300031548 Bacteria 2262
138 Ga0265313_10001156 3300031595 Bacteria 25214
139 Ga0265314_10140214 3300031711 Bacteria 1495
140 Ga0395899_0000004 3300037312 Bacteria 874267
141 Ga0395905_0214593 3300037471 Bacteria 1802
142 Ga0436364_0494373 3300037853 Bacteria 5722
143 Ga0436364_0904177 3300037853 Bacteria 1474
144 Ga0436365_0742888 3300039437 Bacteria 55848
145 Ga0436365_1906141 3300039437 Bacteria 12694
146 Ga0436360_0316453 3300039438 Bacteria 2190
147 Ga0436360_1324886 3300039438 Bacteria 1684
148 Ga0436361_0039495 3300039447 Bacteria 4196
149 Ga0436361_0106270 3300039447 Unclassified 1655
150 Ga0436361_0198924 3300039447 Bacteria 2786
151 Ga0436361_0269658 3300039447 Bacteria 3150
152 Ga0436361_0320431 3300039447 Bacteria 8054
153 Ga0436361_0409017 3300039447 Bacteria 2302
154 Ga0436361_0522578 3300039447 Unclassified 2194
155 Ga0436361_0625336 3300039447 Bacteria 1954
156 Ga0436361_0657885 3300039447 Bacteria 6835
157 Ga0436361_1033770 3300039447 Bacteria 18152
158 Ga0436361_1092565 3300039447 Bacteria 11920
159 Ga0436363_0578425 3300039450 Bacteria 10853
160 Ga0436362_0859863 3300039453 Unclassified 2626
161 Ga0439436_0035730 3300041404 Bacteria 1435
162 Ga0466961_0044445 3300044693 Bacteria 2842
163 Ga0453684_0000006 3300044712 Bacteria 1364191
164 Ga0451576_0252021 3300045051 Bacteria 1845
165 Ga0451576_0372636 3300045051 Bacteria 1496
166 Ga0495638_0000090 3300046460 Bacteria 148040
167 Ga0495648_0063072 3300046524 Bacteria 2191
168 Ga0495581_0100886 3300047315 Bacteria 1677
169 Ga0495604_0011840 3300047317 Bacteria 6938
170 Ga0495672_0009602 3300047320 Bacteria 6986
171 Ga0495676_0044999 3300047321 Bacteria 3597
172 Ga0496100_0018108 3300048903 Bacteria 4173
173 Ga0496101_0189031 3300048904 Bacteria 1589
174 Ga0496104_0029833 3300048907 Bacteria 5063
175 Ga0496105_0008238 3300048908 Bacteria 8104
176 Ga0496106_0067993 3300048909 Bacteria 2717
177 Ga0496108_0015662 3300048911 Bacteria 6184
178 Ga0496109_0010858 3300048912 Bacteria 7795
179 Ga0496113_0006656 3300048916 Bacteria 7352
180 Ga0496114_0046599 3300048917 Bacteria 3603
181 Ga0496115_0007086 3300048918 Bacteria 8236
182 Ga0496119_0001507 3300048922 Bacteria 27861
183 Ga0496121_0000630 3300048924 Bacteria 65787
184 Ga0496122_0109514 3300048925 Bacteria 1818
185 Ga0501034_0028106 3300049571 Bacteria 5720
186 Ga0501037_0062161 3300049573 Bacteria 2722
187 Ga0501042_0107941 3300049578 Bacteria 2004
188 Ga0501047_0065294 3300049581 Bacteria 3508
189 Ga0501070_0041175 3300049586 Bacteria 3848
190 Ga0501071_0139868 3300049587 Bacteria 1802
191 Ga0501073_0013751 3300049589 Bacteria 5886
192 Ga0501074_0004341 3300049590 Bacteria 10126
193 Ga0501080_0024247 3300049742 Bacteria 5624
194 Ga0501044_0014881 3300049823 Bacteria 8387
195 nmdc:mga03683_1075_c1 3300050489 Bacteria 8004
196 nmdc:mga03683_161878_c1 3300050489 Bacteria 1014
197 nmdc:mga03n38_52729_c1 3300050490 Bacteria 1822
198 nmdc:mga0k408_351_c1 3300050493 Bacteria 25242
199 nmdc:mga0k408_437_c1 3300050493 Bacteria 22803
200 nmdc:mga0k408_4394_c2 3300050493 Bacteria 5891
201 nmdc:mga08y16_9266_c1 3300050511 Bacteria 10329
202 Ga0500556_0000897 3300053104 Bacteria 16623
203 Ga0500642_0014608 3300053130 Bacteria 2926
204 Ga0500616_0012459 3300053153 Bacteria 4975
205 Ga0501084_0304306 3300054114 Bacteria 1347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0522578 Ga0436361_0522578_1326_2156 275
2 3300047315 Ga0495581_0100886 Ga0495581_0100886_617_1606 301
3 3300047321 Ga0495676_0044999 Ga0495676_0044999_153_1142 301
4 3300048903 Ga0496100_0018108 Ga0496100_0018108_2259_3248 301
5 3300048904 Ga0496101_0189031 Ga0496101_0189031_358_1347 301
6 3300048907 Ga0496104_0029833 Ga0496104_0029833_3320_4309 301
7 3300048908 Ga0496105_0008238 Ga0496105_0008238_3162_4151 301
8 3300048909 Ga0496106_0067993 Ga0496106_0067993_1157_2146 301
9 3300048911 Ga0496108_0015662 Ga0496108_0015662_3597_4586 301
10 3300048912 Ga0496109_0010858 Ga0496109_0010858_2524_3513 301
11 3300048916 Ga0496113_0006656 Ga0496113_0006656_2396_3385 301
12 3300048917 Ga0496114_0046599 Ga0496114_0046599_17_1006 301
13 3300048918 Ga0496115_0007086 Ga0496115_0007086_5647_6636 301
14 3300005435 Ga0070714_100069377 Ga0070714_1000693772 308
15 3300025929 Ga0207664_10010324 Ga0207664_100103247 308
16 3300037471 Ga0395905_0214593 Ga0395905_0214593_15_1022 309
17 3300050489 nmdc:mga03683_161878_c1 nmdc:mga03683_161878_c1_24_998 311
18 3300025922 Ga0207646_10015211 Ga0207646_100152117 314
19 3300054114 Ga0501084_0304306 Ga0501084_0304306_79_1077 315
20 3300046460 Ga0495638_0000090 Ga0495638_0000090_20892_21902 316
21 3300049571 Ga0501034_0028106 Ga0501034_0028106_4193_5209 317
22 3300005471 Ga0070698_100192212 Ga0070698_1001922122 318
23 3300025910 Ga0207684_10013904 Ga0207684_100139043 318
24 3300039438 Ga0436360_0316453 Ga0436360_0316453_29_997 318
25 3300005445 Ga0070708_100235404 Ga0070708_1002354042 319
26 3300005518 Ga0070699_100010011 Ga0070699_1000100115 319
27 3300006048 Ga0075363_100008892 Ga0075363_1000088921 319
28 3300006195 Ga0075366_10008671 Ga0075366_100086712 319
29 3300050489 nmdc:mga03683_1075_c1 nmdc:mga03683_1075_c1_4035_5033 319
30 3300050490 nmdc:mga03n38_52729_c1 nmdc:mga03n38_52729_c1_311_1309 319
31 3300050493 nmdc:mga0k408_351_c1 nmdc:mga0k408_351_c1_21993_22991 319
32 3300050493 nmdc:mga0k408_437_c1 nmdc:mga0k408_437_c1_12414_13412 319
33 3300053104 Ga0500556_0000897 Ga0500556_0000897_9284_10282 319
34 3300053130 Ga0500642_0014608 Ga0500642_0014608_862_1860 319
35 3300037853 Ga0436364_0494373 Ga0436364_0494373_78_1049 321
36 3300039447 Ga0436361_0106270 Ga0436361_0106270_201_1172 321
37 3300003791 Ga0055530_10011535 Ga0055530_100115352 323
38 3300025298 Ga0209050_1014272 Ga0209050_10142724 323
39 iso_pu_bacteria 8055693939 8055694032 323
40 3300005467 Ga0070706_100141543 Ga0070706_1001415432 324
41 3300005468 Ga0070707_100005002 Ga0070707_1000050027 324
42 3300006844 Ga0075428_100005564 Ga0075428_10000556411 324
43 3300021384 Ga0213876_10004571 Ga0213876_100045719 324
44 3300025910 Ga0207684_10076027 Ga0207684_100760272 324
45 3300039437 Ga0436365_0742888 Ga0436365_0742888_27099_28097 324
46 iso_pu_bacteria 2939611941 2939612841 324
47 3300039453 Ga0436362_0859863 Ga0436362_0859863_1074_2069 325
48 3300041404 Ga0439436_0035730 Ga0439436_0035730_232_1269 325
49 3300045051 Ga0451576_0252021 Ga0451576_0252021_650_1651 325
50 iso_pu_bacteria 2510065053 2510284104 325
51 iso_pu_bacteria 2510065055 2510293220 325
52 iso_pu_bacteria 2510065058 2510312714 325
53 iso_pu_bacteria 2773857672 2774130492 325
54 iso_pu_bacteria 2917832318 2917836175 325
55 iso_pu_bacteria 2919125081 2919128326 325
56 iso_pu_bacteria 2974298342 2974301479 325
57 iso_pu_bacteria 2984499530 2984503959 325
58 iso_pu_bacteria 2984504281 2984507455 325
59 iso_pu_bacteria 8016728285 8016730429 325
60 3300037853 Ga0436364_0904177 Ga0436364_0904177_200_1204 326
61 iso_pu_bacteria 2894232714 2894237902 326
62 3300039447 Ga0436361_0409017 Ga0436361_0409017_696_1703 327
63 3300044712 Ga0453684_0000006 Ga0453684_0000006_1167614_1168618 327
64 3300005435 Ga0070714_100000020 Ga0070714_10000002073 328
65 3300009551 Ga0105238_10089051 Ga0105238_100890514 328
66 3300013105 Ga0157369_10129172 Ga0157369_101291722 328
67 3300021361 Ga0213872_10006025 Ga0213872_100060257 328
68 3300025909 Ga0207705_10037733 Ga0207705_100377333 328
69 3300025919 Ga0207657_10014891 Ga0207657_100148915 328
70 3300025924 Ga0207694_10036656 Ga0207694_100366564 328
71 3300025929 Ga0207664_10000023 Ga0207664_10000023107 328
72 3300025932 Ga0207690_10001386 Ga0207690_1000138611 328
73 3300025933 Ga0207706_10006952 Ga0207706_100069529 328
74 3300025949 Ga0207667_10029251 Ga0207667_100292515 328
75 3300026041 Ga0207639_10182239 Ga0207639_101822392 328
76 3300039447 Ga0436361_0198924 Ga0436361_0198924_779_1789 328
77 3300039447 Ga0436361_0657885 Ga0436361_0657885_3538_4548 328
78 3300003856 Ga0058692_1012225 Ga0058692_10122252 329
79 3300005335 Ga0070666_10001402 Ga0070666_1000140214 329
80 3300005563 Ga0068855_100019435 Ga0068855_1000194356 329
81 3300005842 Ga0068858_100014648 Ga0068858_1000146485 329
82 3300006177 Ga0075362_10055518 Ga0075362_100555183 329
83 3300009011 Ga0105251_10008448 Ga0105251_100084484 329
84 3300013102 Ga0157371_10005576 Ga0157371_100055767 329
85 3300013102 Ga0157371_10077894 Ga0157371_100778943 329
86 3300013105 Ga0157369_10004801 Ga0157369_1000480110 329
87 3300025728 Ga0207655_1061782 Ga0207655_10617821 329
88 3300025735 Ga0207713_1049991 Ga0207713_10499911 329
89 3300025903 Ga0207680_10000525 Ga0207680_100005257 329
90 3300025949 Ga0207667_10067770 Ga0207667_100677702 329
91 3300025986 Ga0207658_10012460 Ga0207658_100124606 329
92 3300030500 Ga0268256_1012112 Ga0268256_10121123 329
93 3300031240 Ga0265320_10000539 Ga0265320_1000053912 329
94 3300031249 Ga0265339_10010923 Ga0265339_100109234 329
95 3300031249 Ga0265339_10111547 Ga0265339_101115472 329
96 3300031250 Ga0265331_10028446 Ga0265331_100284462 329
97 3300031711 Ga0265314_10140214 Ga0265314_101402142 329
98 3300037312 Ga0395899_0000004 Ga0395899_0000004_270158_271192 329
99 3300044693 Ga0466961_0044445 Ga0466961_0044445_1704_2738 329
100 3300048925 Ga0496122_0109514 Ga0496122_0109514_621_1622 329
101 3300053153 Ga0500616_0012459 Ga0500616_0012459_3894_4925 329
102 iso_pu_bacteria 2508501050 2508727558 329
103 iso_pu_bacteria 2773857925 2774868952 329
104 iso_pu_bacteria 2773857925 2774874086 329
105 iso_pu_bacteria 2882456835 2882459531 329
106 iso_pu_bacteria 2882456835 2882459764 329
107 3300005327 Ga0070658_10003209 Ga0070658_1000320910 330
108 3300005367 Ga0070667_100370390 Ga0070667_1003703902 330
109 3300005458 Ga0070681_10072466 Ga0070681_100724662 330
110 3300005548 Ga0070665_100021009 Ga0070665_1000210092 330
111 3300005563 Ga0068855_100295117 Ga0068855_1002951172 330
112 3300005834 Ga0068851_10038254 Ga0068851_100382541 330
113 3300007788 Ga0099795_10006388 Ga0099795_100063884 330
114 3300009094 Ga0111539_10005551 Ga0111539_100055518 330
115 3300021361 Ga0213872_10060391 Ga0213872_100603911 330
116 3300025912 Ga0207707_10009338 Ga0207707_100093385 330
117 3300025949 Ga0207667_10285036 Ga0207667_102850362 330
118 3300039447 Ga0436361_0269658 Ga0436361_0269658_569_1585 330
119 3300045051 Ga0451576_0372636 Ga0451576_0372636_255_1265 330
120 3300050511 nmdc:mga08y16_9266_c1 nmdc:mga08y16_9266_c1_225_1229 330
121 iso_pu_bacteria 2751185821 2753459292 330
122 iso_pu_bacteria 2791355082 2792580478 330
123 iso_pu_bacteria 2791355094 2792639847 330
124 iso_pu_bacteria 8018150411 8018150877 330
125 iso_pu_bacteria 8024486573 8024487601 330
126 3300005434 Ga0070709_10037993 Ga0070709_100379932 331
127 3300005435 Ga0070714_100079746 Ga0070714_1000797462 331
128 3300005436 Ga0070713_100002572 Ga0070713_1000025728 331
129 3300005437 Ga0070710_10016355 Ga0070710_100163551 331
130 3300005445 Ga0070708_100019391 Ga0070708_1000193914 331
131 3300005467 Ga0070706_100123579 Ga0070706_1001235792 331
132 3300006175 Ga0070712_100131510 Ga0070712_1001315102 331
133 3300021361 Ga0213872_10008326 Ga0213872_100083263 331
134 3300021361 Ga0213872_10014431 Ga0213872_100144312 331
135 3300021384 Ga0213876_10069209 Ga0213876_100692092 331
136 3300025910 Ga0207684_10138385 Ga0207684_101383852 331
137 3300025915 Ga0207693_10175171 Ga0207693_101751711 331
138 3300025928 Ga0207700_10018977 Ga0207700_100189774 331
139 3300031344 Ga0265316_10030374 Ga0265316_100303743 331
140 3300039437 Ga0436365_1906141 Ga0436365_1906141_589_1596 331
141 3300039438 Ga0436360_1324886 Ga0436360_1324886_40_1047 331
142 3300039447 Ga0436361_0039495 Ga0436361_0039495_2805_3812 331
143 3300039447 Ga0436361_0320431 Ga0436361_0320431_3014_4021 331
144 3300039447 Ga0436361_1033770 Ga0436361_1033770_919_1986 331
145 3300039447 Ga0436361_1092565 Ga0436361_1092565_2437_3444 331
146 3300039450 Ga0436363_0578425 Ga0436363_0578425_3851_4858 331
147 3300047317 Ga0495604_0011840 Ga0495604_0011840_859_1899 331
148 3300047320 Ga0495672_0009602 Ga0495672_0009602_4668_5684 331
149 3300048924 Ga0496121_0000630 Ga0496121_0000630_17514_18524 331
150 3300049573 Ga0501037_0062161 Ga0501037_0062161_1667_2674 331
151 3300049578 Ga0501042_0107941 Ga0501042_0107941_151_1158 331
152 3300049581 Ga0501047_0065294 Ga0501047_0065294_1425_2432 331
153 3300049586 Ga0501070_0041175 Ga0501070_0041175_2631_3638 331
154 3300049587 Ga0501071_0139868 Ga0501071_0139868_149_1156 331
155 3300049589 Ga0501073_0013751 Ga0501073_0013751_1591_2598 331
156 3300049590 Ga0501074_0004341 Ga0501074_0004341_3906_4913 331
157 3300049742 Ga0501080_0024247 Ga0501080_0024247_1896_2903 331
158 3300049823 Ga0501044_0014881 Ga0501044_0014881_1397_2404 331
159 3300050493 nmdc:mga0k408_4394_c2 nmdc:mga0k408_4394_c2_2598_3608 331
160 3300039447 Ga0436361_0625336 Ga0436361_0625336_515_1525 332
161 iso_pu_bacteria 2895511927 2895515800 332
162 iso_pu_bacteria 8055632911 8055634527 332
163 3300031239 Ga0265328_10000241 Ga0265328_1000024116 333
164 3300031250 Ga0265331_10000141 Ga0265331_1000014155 333
165 3300046524 Ga0495648_0063072 Ga0495648_0063072_146_1153 333
166 3300048922 Ga0496119_0001507 Ga0496119_0001507_14431_15462 333
167 iso_pu_bacteria 2643221554 2643788338 333
168 iso_pu_bacteria 2643221638 2644213734 333
169 3300005336 Ga0070680_100261736 Ga0070680_1002617362 334
170 3300005458 Ga0070681_10080362 Ga0070681_100803624 334
171 3300005530 Ga0070679_100081946 Ga0070679_1000819461 334
172 3300025912 Ga0207707_10049572 Ga0207707_100495721 334
173 3300025913 Ga0207695_10008647 Ga0207695_100086472 334
174 3300025921 Ga0207652_10040878 Ga0207652_100408781 334
175 3300005344 Ga0070661_100293778 Ga0070661_1002937781 335
176 3300013104 Ga0157370_10020590 Ga0157370_100205903 335
177 3300031595 Ga0265313_10001156 Ga0265313_100011563 335
178 3300002739 JGI25158J39367_1007165 JGI25158J39367_10071652 337
179 3300002773 JGI25152J39213_1000082 JGI25152J39213_100008252 337
180 3300002774 JGI25150J39212_1001021 JGI25150J39212_10010211 337
181 3300002774 JGI25150J39212_1004319 JGI25150J39212_10043194 337
182 3300002987 JGI25159J45721_1003045 JGI25159J45721_10030451 337
183 3300003215 JGI25153J46596_10001132 JGI25153J46596_1000113213 337
184 3300003354 JGI25160J50197_1005039 JGI25160J50197_10050394 337
185 3300003374 JGI25161J50226_1008006 JGI25161J50226_10080062 337
186 3300003771 Ga0055526_1008235 Ga0055526_10082355 337
187 3300003771 Ga0055526_1029011 Ga0055526_10290112 337
188 3300003773 Ga0055537_1012540 Ga0055537_10125401 337
189 3300003773 Ga0055537_1014318 Ga0055537_10143182 337
190 3300003775 Ga0055524_1000970 Ga0055524_10009702 337
191 3300003775 Ga0055524_1024641 Ga0055524_10246411 337
192 3300003775 Ga0055524_1028794 Ga0055524_10287942 337
193 3300003784 Ga0055534_1001874 Ga0055534_10018747 337
194 3300003784 Ga0055534_1015318 Ga0055534_10153182 337
195 3300003790 Ga0055528_1002025 Ga0055528_10020255 337
196 3300003791 Ga0055530_10001343 Ga0055530_1000134316 337
197 3300003791 Ga0055530_10011562 Ga0055530_100115624 337
198 3300003794 Ga0055531_10023860 Ga0055531_100238603 337
199 3300003794 Ga0055531_10033440 Ga0055531_100334402 337
200 3300004625 Ga0055543_1000944 Ga0055543_10009441 337
201 3300005262 Ga0065165_1003067 Ga0065165_100306714 337
202 3300025208 Ga0209436_100185 Ga0209436_10018524 337
203 3300025208 Ga0209436_100799 Ga0209436_1007999 337
204 3300025245 Ga0207425_1000001 Ga0207425_10000012144 337
205 3300025245 Ga0207425_1000194 Ga0207425_100019420 337
206 3300025245 Ga0207425_1006111 Ga0207425_10061113 337
207 3300025258 Ga0209129_1000001 Ga0209129_10000011321 337
208 3300025258 Ga0209129_1002734 Ga0209129_10027345 337
209 3300025263 Ga0209565_1000567 Ga0209565_100056712 337
210 3300025263 Ga0209565_1006204 Ga0209565_10062044 337
211 3300025273 Ga0209673_1023996 Ga0209673_10239963 337
212 3300025284 Ga0209130_1000391 Ga0209130_100039133 337
213 3300025284 Ga0209130_1003089 Ga0209130_10030895 337
214 3300025291 Ga0209675_1000496 Ga0209675_100049618 337
215 3300025291 Ga0209675_1001691 Ga0209675_100169111 337
216 3300025295 Ga0209564_1000813 Ga0209564_100081318 337
217 3300025295 Ga0209564_1002459 Ga0209564_10024592 337
218 3300025297 Ga0209758_1000055 Ga0209758_1000055208 337
219 3300025298 Ga0209050_1000334 Ga0209050_100033476 337
220 3300025298 Ga0209050_1000743 Ga0209050_100074317 337
221 3300025299 Ga0209256_1000269 Ga0209256_100026929 337
222 3300025299 Ga0209256_1000780 Ga0209256_100078027 337
223 3300025299 Ga0209256_1000867 Ga0209256_100086722 337
224 3300025299 Ga0209256_1025078 Ga0209256_10250782 337
225 3300025302 Ga0207426_1003655 Ga0207426_10036554 337
226 3300025304 Ga0209257_1000010 Ga0209257_10000101028 337
227 3300025304 Ga0209257_1001145 Ga0209257_100114519 337
228 3300025304 Ga0209257_1005235 Ga0209257_10052352 337
229 3300031548 Ga0307408_100002629 Ga0307408_1000026297 337
230 3300031548 Ga0307408_100005255 Ga0307408_1000052557 337
231 3300031548 Ga0307408_100040157 Ga0307408_1000401574 337
232 3300031548 Ga0307408_100094665 Ga0307408_1000946652 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

61

318

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9791 22 329
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9748 22 327
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9728 22 329
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9415 22 327
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9281 23 315
ID Description Score Start End Superfamily
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9971 22 296 3.40.190.10
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.984 22 296 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9816 115 326 3.40.190.10
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9738 25 94 3.40.190.10
af_P0AG78_114_326_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9726 115 326 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Z0MZ19-F1-model_v4 Sulfate-binding protein 0.9973 19 113 GO:0042597
GO:1902358
AF-A0A098U544-F1-model_v4 deleted 0.9963 112 237
AF-A0A258AE92-F1-model_v4 deleted 0.9949 22 328
AF-A0A376J751-F1-model_v4 deleted 0.9922 229 329
AF-A0A519EI10-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9897 104 328 GO:0042597
GO:1901681
GO:1902358

Feature Viewer

pLDDT pTM Quality
91.99 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map