F345129

General Info

Members Datasets Scaffolds Average Seq Length
232 153 232 665

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10056307|Ga0207700_100563073
Length 752
Sequence MVHFPLTIPKKNTSAIKGSSSSRPRPPLRIAIDSGGTFTDCVWLQDSTLRILKVFSTPADPAQAIAGAVLKIADDIQDIVVLHGTTVGTNTLLQRKGARVAFVTTKGFEDSIEIGRQQRPKLYDFFFEKDPALAPAELRFGVDERTSAEGVVLRAPSAESLQSLASNIAAQKPEAVAISLLFSFANPTNERAVAAALARLNLPLSVSHQILPEFREYERASTVLVNAYLQPVMQGYLGKLEERLSSGRERAQARVPPPQSAQHRLALGAPVXXXQNPSAQAGAPAVHNLKKSALHSQIFVMQSSGGITALDTAAEQPVRTVLSGPAGGIVGAAAVAQRSGFDRIITFDMGGTSSDVALVDGRPSTTNEADVAGLPVRVPVLDIHTVGAGGGSLARFDAGGALRVGPESAGADPGPICYGKGERPTVTDANLLLGRLPADQFLGGDFQLDLPRTQKIVAQWLKDNQSKLTPEEFAAGVVRVVNANMEKAIRVVSIERGYDPRQFSLAAFGGAGAMHACDLAQALRIPRVIVPAYPGALSALGILISDVVKDHSRTVLLRVPGNAPGKKKDRGAQTPSPASYASGLPARQLDPVFAELKRNIAEELKKEDWQGRAVFEPSCELRYRGQGYELNLPYGTDVLQRFHAEHKRRYGYSSPERDVEIVTVRMRGRVASPEKLSRLKISEEQGNLKPSTAMVHFSGKRHKTRIIPRASIKAAKRYRGPAIITEYSATTVVPPGLAFRKDRAGNLLIEIG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
67 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 3.45
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000104 3300002459 Bacteria 46525
2 JGI25405J52794_10001007 3300003911 Unclassified 4467
3 Ga0065715_10117983 3300005293 Bacteria 2330
4 Ga0070670_100000159 3300005331 Bacteria 61313
5 Ga0070670_100007755 3300005331 Bacteria 9132
6 Ga0068869_100011821 3300005334 Bacteria 5742
7 Ga0070666_10006973 3300005335 Bacteria 6966
8 Ga0070680_100005996 3300005336 Bacteria 9221
9 Ga0070680_100017676 3300005336 Bacteria 5625
10 Ga0070682_100000091 3300005337 Bacteria 82460
11 Ga0070682_100036599 3300005337 Bacteria 3001
12 Ga0070692_10001518 3300005345 Bacteria 8502
13 Ga0070675_100103263 3300005354 Bacteria 2403
14 Ga0070671_100014112 3300005355 Bacteria 6451
15 Ga0070709_10002672 3300005434 Bacteria 9625
16 Ga0070714_100096885 3300005435 Unclassified 2592
17 Ga0070713_100003895 3300005436 Bacteria 9891
18 Ga0070713_100062224 3300005436 Bacteria 3126
19 Ga0070711_100006847 3300005439 Bacteria 6899
20 Ga0070711_100034375 3300005439 Bacteria 3381
21 Ga0070700_100016141 3300005441 Unclassified 4249
22 Ga0070700_100021028 3300005441 Unclassified 3789
23 Ga0070700_100026831 3300005441 Bacteria 3407
24 Ga0070694_100014281 3300005444 Bacteria 4970
25 Ga0070708_100001630 3300005445 Bacteria 17223
26 Ga0070708_100013380 3300005445 Bacteria 6715
27 Ga0070662_100011552 3300005457 Bacteria 5827
28 Ga0070681_10013707 3300005458 Archaea 8068
29 Ga0070681_10036189 3300005458 Unclassified 4958
30 Ga0070681_10094713 3300005458 Bacteria 2934
31 Ga0070681_10116835 3300005458 Bacteria 2604
32 Ga0068867_100016205 3300005459 Bacteria 5292
33 Ga0068867_100081499 3300005459 Bacteria 2439
34 Ga0070706_100001454 3300005467 Bacteria 24932
35 Ga0070706_100001981 3300005467 Bacteria 21120
36 Ga0070707_100003906 3300005468 Bacteria 14030
37 Ga0070707_100020628 3300005468 Bacteria 6219
38 Ga0070707_100056202 3300005468 Bacteria 3775
39 Ga0070707_100152487 3300005468 Bacteria 2250
40 Ga0070698_100000126 3300005471 Bacteria 66495
41 Ga0070698_100001323 3300005471 Bacteria 27599
42 Ga0070699_100026525 3300005518 Bacteria 4995
43 Ga0070699_100054845 3300005518 Bacteria 3451
44 Ga0070679_100007689 3300005530 Bacteria 10092
45 Ga0070679_100008993 3300005530 Bacteria 9422
46 Ga0070679_100036585 3300005530 Unclassified 4872
47 Ga0070679_100132226 3300005530 Bacteria 2476
48 Ga0070679_100144941 3300005530 Bacteria 2353
49 Ga0070697_100000100 3300005536 Bacteria 70649
50 Ga0070697_100002334 3300005536 Bacteria 14591
51 Ga0070697_100003401 3300005536 Bacteria 12230
52 Ga0070697_100013615 3300005536 Bacteria 6380
53 Ga0070697_100016043 3300005536 Bacteria 5891
54 Ga0068853_100025557 3300005539 Unclassified 4956
55 Ga0068853_100041186 3300005539 Unclassified 3944
56 Ga0070672_100059883 3300005543 Bacteria 2997
57 Ga0070686_100002788 3300005544 Bacteria 9624
58 Ga0070686_100008566 3300005544 Bacteria 5730
59 Ga0070695_100005325 3300005545 Bacteria 7574
60 Ga0070693_100011219 3300005547 Bacteria 4509
61 Ga0070693_100032561 3300005547 Bacteria 2868
62 Ga0068854_100032733 3300005578 Bacteria 3619
63 Ga0068852_100024428 3300005616 Bacteria 4884
64 Ga0068859_100003945 3300005617 Bacteria 15149
65 Ga0068861_100056678 3300005719 Unclassified 2992
66 Ga0068858_100016873 3300005842 Bacteria 6857
67 Ga0068858_100017659 3300005842 Bacteria 6688
68 Ga0068860_100060361 3300005843 Bacteria 3604
69 Ga0068862_100015482 3300005844 Bacteria 6333
70 Ga0081455_10006322 3300005937 Bacteria 12720
71 Ga0081538_10007797 3300005981 Bacteria 9196
72 Ga0081540_1004090 3300005983 Bacteria 11277
73 Ga0081539_10007968 3300005985 Bacteria 9419
74 Ga0070716_100000234 3300006173 Bacteria 22234
75 Ga0070712_100002402 3300006175 Bacteria 11530
76 Ga0070712_100006928 3300006175 Bacteria 7062
77 Ga0070712_100065028 3300006175 Bacteria 2588
78 Ga0068871_100004332 3300006358 Bacteria 9856
79 Ga0075429_100014969 3300006880 Bacteria 6727
80 Ga0075436_100002887 3300006914 Bacteria 11775
81 Ga0075436_100017911 3300006914 Bacteria 4850
82 Ga0105240_10035123 3300009093 Bacteria 6464
83 Ga0105240_10092856 3300009093 Bacteria 3684
84 Ga0111539_10007287 3300009094 Bacteria 14162
85 Ga0111539_10028621 3300009094 Bacteria 6796
86 Ga0105247_10002783 3300009101 Bacteria 11708
87 Ga0105247_10017027 3300009101 Bacteria 4361
88 Ga0114129_10069368 3300009147 Bacteria 4913
89 Ga0114129_10209207 3300009147 Bacteria 2638
90 Ga0105243_10005108 3300009148 Bacteria 10298
91 Ga0105242_10039548 3300009176 Bacteria 3797
92 Ga0105248_10000056 3300009177 Bacteria 139437
93 Ga0105248_10133010 3300009177 Bacteria 2806
94 Ga0105237_10000334 3300009545 Bacteria 66523
95 Ga0157370_10069248 3300013104 Unclassified 3332
96 Ga0157369_10007737 3300013105 Bacteria 12360
97 Ga0157369_10084469 3300013105 Bacteria 3393
98 Ga0157378_10000145 3300013297 Bacteria 66719
99 Ga0157378_10042830 3300013297 Unclassified 4019
100 Ga0157378_10105832 3300013297 Bacteria 2573
101 Ga0163162_10127284 3300013306 Bacteria 2654
102 Ga0157372_10349416 3300013307 Bacteria 1723
103 Ga0163163_10000305 3300014325 Bacteria 48233
104 Ga0157380_10008978 3300014326 Bacteria 7141
105 Ga0157380_10032020 3300014326 Bacteria 4041
106 Ga0157379_10005871 3300014968 Bacteria 10562
107 Ga0182007_10006177 3300015262 Bacteria 5168
108 Ga0224569_100165 3300022732 Bacteria 5165
109 Ga0228598_1000741 3300024227 Bacteria 6981
110 Ga0207692_10004809 3300025898 Bacteria 5369
111 Ga0207710_10001505 3300025900 Bacteria 11542
112 Ga0207710_10010975 3300025900 Bacteria 3816
113 Ga0207699_10004687 3300025906 Bacteria 6534
114 Ga0207684_10001729 3300025910 Bacteria 23117
115 Ga0207684_10002323 3300025910 Bacteria 19304
116 Ga0207707_10007649 3300025912 Archaea 9414
117 Ga0207695_10118211 3300025913 Bacteria 2622
118 Ga0207671_10001998 3300025914 Bacteria 22476
119 Ga0207693_10000308 3300025915 Bacteria 45611
120 Ga0207693_10001728 3300025915 Bacteria 19200
121 Ga0207693_10011669 3300025915 Bacteria 7108
122 Ga0207660_10005201 3300025917 Archaea 8452
123 Ga0207662_10031427 3300025918 Unclassified 3085
124 Ga0207652_10005378 3300025921 Archaea 10388
125 Ga0207652_10025696 3300025921 Unclassified 4898
126 Ga0207652_10063192 3300025921 Bacteria 3201
127 Ga0207646_10001860 3300025922 Bacteria 25448
128 Ga0207646_10005052 3300025922 Bacteria 14031
129 Ga0207646_10039824 3300025922 Bacteria 4229
130 Ga0207650_10000007 3300025925 Bacteria 530810
131 Ga0207650_10003018 3300025925 Bacteria 11599
132 Ga0207700_10028033 3300025928 Bacteria 3952
133 Ga0207700_10056307 3300025928 Bacteria 2959
134 Ga0207664_10072148 3300025929 Bacteria 2783
135 Ga0207644_10009656 3300025931 Bacteria 6341
136 Ga0207709_10002551 3300025935 Bacteria 11352
137 Ga0207665_10000351 3300025939 Bacteria 31888
138 Ga0207665_10006529 3300025939 Bacteria 7735
139 Ga0207665_10085067 3300025939 Bacteria 2183
140 Ga0207711_10000063 3300025941 Bacteria 121296
141 Ga0207711_10007417 3300025941 Bacteria 9178
142 Ga0207689_10004875 3300025942 Bacteria 12097
143 Ga0207667_10021930 3300025949 Bacteria 7070
144 Ga0207651_10007718 3300025960 Bacteria 5750
145 Ga0207703_10049823 3300026035 Bacteria 3387
146 Ga0207639_10007725 3300026041 Bacteria 7343
147 Ga0207639_10015323 3300026041 Bacteria 5406
148 Ga0207708_10000080 3300026075 Bacteria 74889
149 Ga0207708_10062639 3300026075 Bacteria 2841
150 Ga0207648_10040338 3300026089 Bacteria 4103
151 Ga0207648_10043025 3300026089 Unclassified 3966
152 Ga0207674_10057737 3300026116 Bacteria 3934
153 Ga0207674_10083128 3300026116 Bacteria 3202
154 Ga0207428_10016015 3300027907 Bacteria 6462
155 Ga0268264_10031118 3300028381 Unclassified 4375
156 Ga0268264_10043943 3300028381 Bacteria 3704
157 Ga0268264_10047512 3300028381 Bacteria 3569
158 Ga0265339_10000017 3300031249 Bacteria 185084
159 Ga0316575_10000579 3300031665 Bacteria 10744
160 Ga0316575_10012556 3300031665 Bacteria 3153
161 Ga0316579_10002934 3300031691 Bacteria 6548
162 Ga0265342_10003286 3300031712 Bacteria 13386
163 Ga0316576_10032311 3300031727 Bacteria 3718
164 Ga0316578_10039342 3300031728 Bacteria 2731
165 Ga0316577_10005858 3300031733 Bacteria 6469
166 Ga0316577_10006391 3300031733 Bacteria 6218
167 Ga0316577_10020478 3300031733 Bacteria 3665
168 Ga0307406_10003944 3300031901 Bacteria 8060
169 Ga0307407_10013079 3300031903 Bacteria 4014
170 Ga0307411_10009296 3300032005 Bacteria 5158
171 Ga0316585_10011064 3300032137 Bacteria 2655
172 Ga0373923_0009294 3300035111 Bacteria 3543
173 Ga0373945_0000050 3300035116 Bacteria 25089
174 Ga0373955_0020531 3300035172 Bacteria 3323
175 Ga0316574_0000237 3300035398 Bacteria 19967
176 Ga0316574_0001570 3300035398 Bacteria 10916
177 Ga0316574_0006019 3300035398 Bacteria 6518
178 Ga0316574_0046737 3300035398 Bacteria 2685
179 Ga0373924_0002601 3300035410 Bacteria 6086
180 Ga0373935_0032920 3300035692 Bacteria 3223
181 Ga0373927_0012115 3300035695 Bacteria 5737
182 Ga0373947_0025679 3300035725 Bacteria 3435
183 Ga0373937_0000132 3300036401 Bacteria 72758
184 Ga0373937_0103212 3300036401 Unclassified 2648
185 Ga0316582_0056275 3300036647 Unclassified 2508
186 Ga0316584_0001371 3300036712 Bacteria 14496
187 Ga0316584_0003595 3300036712 Bacteria 10129
188 Ga0316584_0005101 3300036712 Bacteria 8761
189 Ga0373925_0023079 3300037068 Bacteria 4540
190 Ga0373925_0024674 3300037068 Bacteria 4390
191 Ga0395898_0198555 3300037466 Bacteria 1916
192 Ga0316581_0000219 3300037588 Bacteria 9752
193 Ga0400483_065980 3300039062 Bacteria 3412
194 Ga0436365_1842662 3300039437 Bacteria 3913
195 Ga0466963_0018219 3300044694 Unclassified 4386
196 Ga0453684_0002498 3300044712 Bacteria 44362
197 Ga0453684_0022879 3300044712 Bacteria 9248
198 Ga0466957_0000419 3300044842 Bacteria 20895
199 Ga0466959_0004390 3300045049 Bacteria 9437
200 Ga0466967_0006711 3300045976 Bacteria 8186
201 Ga0495580_0000734 3300046472 Bacteria 28060
202 Ga0495580_0001452 3300046472 Bacteria 20782
203 Ga0495584_0040593 3300046491 Unclassified 2350
204 Ga0495663_0000200 3300046525 Bacteria 23938
205 Ga0495598_0000002 3300046537 Bacteria 56235
206 Ga0495621_0000696 3300046539 Bacteria 8488
207 Ga0495659_0009655 3300046664 Bacteria 3085
208 Ga0495624_0065035 3300046690 Unclassified 2279
209 Ga0495672_0028149 3300047320 Unclassified 3561
210 Ga0495686_0000031 3300047472 Bacteria 350171
211 Ga0496102_0050898 3300048905 Bacteria 3773
212 Ga0496104_0000068 3300048907 Bacteria 107801
213 Ga0496104_0071733 3300048907 Bacteria 3293
214 Ga0496104_0075334 3300048907 Bacteria 3213
215 Ga0496105_0007133 3300048908 Bacteria 8621
216 Ga0496112_0024001 3300048915 Bacteria 5834
217 Ga0496112_0054406 3300048915 Unclassified 3932
218 Ga0496113_0000152 3300048916 Bacteria 30160
219 Ga0496126_0000005 3300048929 Bacteria 891906
220 Ga0501212_003747 3300049851 Bacteria 1927
221 nmdc:mga05p37_175591_c1 3300050507 Bacteria 2610
222 nmdc:mga05p37_54198_c1 3300050507 Bacteria 4934
223 nmdc:mga09592_11836_c1 3300050508 Bacteria 7096
224 nmdc:mga06r32_40654_c1 3300050510 Bacteria 4416
225 nmdc:mga08y16_42568_c1 3300050511 Bacteria 4756
226 nmdc:mga08y16_5263_c1 3300050511 Bacteria 13516
227 Ga0495601_0003899 3300053077 Bacteria 8587
228 Ga0495619_0011876 3300053085 Bacteria 5484
229 Ga0500555_001258 3300053103 Bacteria 8127
230 Ga0500616_0001379 3300053153 Bacteria 23511
231 Ga0500616_0017587 3300053153 Bacteria 4055
232 Ga0500645_004156 3300053730 Bacteria 5636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10002672 Ga0070709_100026727 523
2 3300005436 Ga0070713_100003895 Ga0070713_1000038958 523
3 3300006175 Ga0070712_100006928 Ga0070712_1000069285 523
4 3300006914 Ga0075436_100017911 Ga0075436_1000179113 523
5 3300025906 Ga0207699_10004687 Ga0207699_100046872 523
6 3300025915 Ga0207693_10000308 Ga0207693_1000030837 523
7 3300025928 Ga0207700_10028033 Ga0207700_100280332 523
8 3300025929 Ga0207664_10072148 Ga0207664_100721482 523
9 3300013307 Ga0157372_10349416 Ga0157372_103494161 526
10 3300005331 Ga0070670_100007755 Ga0070670_1000077554 533
11 3300005536 Ga0070697_100016043 Ga0070697_1000160432 533
12 3300025925 Ga0207650_10003018 Ga0207650_100030188 533
13 3300024227 Ga0228598_1000741 Ga0228598_10007412 536
14 3300005985 Ga0081539_10007968 Ga0081539_100079686 539
15 3300006175 Ga0070712_100065028 Ga0070712_1000650281 539
16 3300015262 Ga0182007_10006177 Ga0182007_100061773 539
17 3300048915 Ga0496112_0054406 Ga0496112_0054406_32_1996 539
18 3300005518 Ga0070699_100054845 Ga0070699_1000548452 540
19 3300005468 Ga0070707_100056202 Ga0070707_1000562022 541
20 3300025922 Ga0207646_10039824 Ga0207646_100398243 541
21 3300048907 Ga0496104_0071733 Ga0496104_0071733_248_2281 545
22 3300048907 Ga0496104_0075334 Ga0496104_0075334_408_2444 546
23 3300036401 Ga0373937_0103212 Ga0373937_0103212_84_2153 547
24 3300005983 Ga0081540_1004090 Ga0081540_10040904 550
25 3300025939 Ga0207665_10006529 Ga0207665_100065292 551
26 3300005335 Ga0070666_10006973 Ga0070666_100069732 552
27 3300005336 Ga0070680_100017676 Ga0070680_1000176762 552
28 3300005457 Ga0070662_100011552 Ga0070662_1000115525 552
29 3300005458 Ga0070681_10036189 Ga0070681_100361894 552
30 3300005530 Ga0070679_100036585 Ga0070679_1000365852 552
31 3300009176 Ga0105242_10039548 Ga0105242_100395483 552
32 3300013105 Ga0157369_10084469 Ga0157369_100844692 552
33 3300025921 Ga0207652_10025696 Ga0207652_100256962 552
34 3300025941 Ga0207711_10007417 Ga0207711_100074177 552
35 3300005578 Ga0068854_100032733 Ga0068854_1000327332 553
36 3300005617 Ga0068859_100003945 Ga0068859_1000039458 553
37 3300005843 Ga0068860_100060361 Ga0068860_1000603613 553
38 3300006914 Ga0075436_100002887 Ga0075436_10000288711 553
39 3300009093 Ga0105240_10035123 Ga0105240_100351232 553
40 3300009177 Ga0105248_10000056 Ga0105248_1000005695 553
41 3300013297 Ga0157378_10000145 Ga0157378_100001454 553
42 3300025941 Ga0207711_10000063 Ga0207711_1000006311 553
43 3300026075 Ga0207708_10000080 Ga0207708_1000008055 553
44 3300026116 Ga0207674_10083128 Ga0207674_100831282 553
45 3300028381 Ga0268264_10047512 Ga0268264_100475123 553
46 3300031901 Ga0307406_10003944 Ga0307406_100039443 553
47 3300031903 Ga0307407_10013079 Ga0307407_100130793 553
48 3300032005 Ga0307411_10009296 Ga0307411_100092963 553
49 3300047472 Ga0495686_0000031 Ga0495686_0000031_183888_185855 553
50 3300048929 Ga0496126_0000005 Ga0496126_0000005_534288_536252 553
51 3300049851 Ga0501212_003747 Ga0501212_003747_15_1751 553
52 3300009177 Ga0105248_10133010 Ga0105248_101330102 554
53 3300031249 Ga0265339_10000017 Ga0265339_1000001768 554
54 3300031712 Ga0265342_10003286 Ga0265342_1000328610 554
55 3300046664 Ga0495659_0009655 Ga0495659_0009655_618_2603 554
56 3300009101 Ga0105247_10017027 Ga0105247_100170272 555
57 3300025900 Ga0207710_10010975 Ga0207710_100109752 555
58 3300005445 Ga0070708_100013380 Ga0070708_1000133803 556
59 3300005536 Ga0070697_100003401 Ga0070697_1000034016 556
60 3300025960 Ga0207651_10007718 Ga0207651_100077182 556
61 3300039062 Ga0400483_065980 Ga0400483_065980_1194_3164 556
62 3300045049 Ga0466959_0004390 Ga0466959_0004390_4589_6598 556
63 3300005336 Ga0070680_100005996 Ga0070680_1000059966 557
64 3300005337 Ga0070682_100036599 Ga0070682_1000365992 557
65 3300005435 Ga0070714_100096885 Ga0070714_1000968852 557
66 3300005439 Ga0070711_100006847 Ga0070711_1000068472 557
67 3300005445 Ga0070708_100001630 Ga0070708_10000163010 557
68 3300005458 Ga0070681_10013707 Ga0070681_100137076 557
69 3300005458 Ga0070681_10116835 Ga0070681_101168352 557
70 3300005467 Ga0070706_100001981 Ga0070706_10000198111 557
71 3300005468 Ga0070707_100020628 Ga0070707_1000206282 557
72 3300005471 Ga0070698_100001323 Ga0070698_10000132312 557
73 3300005530 Ga0070679_100007689 Ga0070679_1000076894 557
74 3300005530 Ga0070679_100144941 Ga0070679_1001449411 557
75 3300005536 Ga0070697_100013615 Ga0070697_1000136152 557
76 3300005539 Ga0068853_100025557 Ga0068853_1000255577 557
77 3300006173 Ga0070716_100000234 Ga0070716_1000002347 557
78 3300006175 Ga0070712_100002402 Ga0070712_1000024022 557
79 3300013104 Ga0157370_10069248 Ga0157370_100692481 557
80 3300025898 Ga0207692_10004809 Ga0207692_100048092 557
81 3300025910 Ga0207684_10001729 Ga0207684_100017291 557
82 3300025912 Ga0207707_10007649 Ga0207707_100076496 557
83 3300025915 Ga0207693_10001728 Ga0207693_100017283 557
84 3300025915 Ga0207693_10011669 Ga0207693_100116693 557
85 3300025917 Ga0207660_10005201 Ga0207660_100052014 557
86 3300025921 Ga0207652_10005378 Ga0207652_100053786 557
87 3300025922 Ga0207646_10001860 Ga0207646_1000186011 557
88 3300025939 Ga0207665_10000351 Ga0207665_1000035118 557
89 3300025949 Ga0207667_10021930 Ga0207667_100219304 557
90 3300026041 Ga0207639_10007725 Ga0207639_100077256 557
91 3300035111 Ga0373923_0009294 Ga0373923_0009294_1081_3153 557
92 3300035116 Ga0373945_0000050 Ga0373945_0000050_11695_13743 557
93 3300035172 Ga0373955_0020531 Ga0373955_0020531_26_2149 557
94 3300035410 Ga0373924_0002601 Ga0373924_0002601_2113_4161 557
95 3300035692 Ga0373935_0032920 Ga0373935_0032920_569_2641 557
96 3300035695 Ga0373927_0012115 Ga0373927_0012115_1767_3839 557
97 3300035725 Ga0373947_0025679 Ga0373947_0025679_527_2599 557
98 3300036401 Ga0373937_0000132 Ga0373937_0000132_32265_34265 557
99 3300037068 Ga0373925_0023079 Ga0373925_0023079_1793_3916 557
100 3300037068 Ga0373925_0024674 Ga0373925_0024674_536_2608 557
101 3300037466 Ga0395898_0198555 Ga0395898_0198555_19_1836 557
102 3300044694 Ga0466963_0018219 Ga0466963_0018219_2511_4373 557
103 3300045976 Ga0466967_0006711 Ga0466967_0006711_2705_4714 557
104 3300046472 Ga0495580_0001452 Ga0495580_0001452_154_2157 557
105 3300046690 Ga0495624_0065035 Ga0495624_0065035_26_2098 557
106 3300048905 Ga0496102_0050898 Ga0496102_0050898_956_2968 557
107 3300048915 Ga0496112_0024001 Ga0496112_0024001_3361_5421 557
108 3300048916 Ga0496113_0000152 Ga0496113_0000152_26338_28398 557
109 3300005436 Ga0070713_100062224 Ga0070713_1000622242 558
110 3300005439 Ga0070711_100034375 Ga0070711_1000343752 558
111 3300005539 Ga0068853_100041186 Ga0068853_1000411863 558
112 3300013105 Ga0157369_10007737 Ga0157369_100077379 558
113 3300044712 Ga0453684_0002498 Ga0453684_0002498_14614_16632 558
114 3300053103 Ga0500555_001258 Ga0500555_001258_2623_4647 558
115 3300053153 Ga0500616_0001379 Ga0500616_0001379_12356_14380 558
116 3300053730 Ga0500645_004156 Ga0500645_004156_1570_3594 558
117 3300003911 JGI25405J52794_10001007 JGI25405J52794_100010072 559
118 3300005441 Ga0070700_100021028 Ga0070700_1000210282 559
119 3300005468 Ga0070707_100152487 Ga0070707_1001524871 559
120 3300005530 Ga0070679_100008993 Ga0070679_1000089938 559
121 3300005545 Ga0070695_100005325 Ga0070695_1000053251 559
122 3300005842 Ga0068858_100017659 Ga0068858_1000176594 559
123 3300005937 Ga0081455_10006322 Ga0081455_100063222 559
124 3300005981 Ga0081538_10007797 Ga0081538_100077976 559
125 3300006358 Ga0068871_100004332 Ga0068871_1000043323 559
126 3300006880 Ga0075429_100014969 Ga0075429_1000149696 559
127 3300014968 Ga0157379_10005871 Ga0157379_100058716 559
128 3300025928 Ga0207700_10056307 Ga0207700_100563073 559
129 3300025939 Ga0207665_10085067 Ga0207665_100850672 559
130 3300026041 Ga0207639_10015323 Ga0207639_100153233 559
131 3300031733 Ga0316577_10006391 Ga0316577_100063917 559
132 3300044842 Ga0466957_0000419 Ga0466957_0000419_11401_13473 559
133 3300046472 Ga0495580_0000734 Ga0495580_0000734_8363_10378 559
134 3300046491 Ga0495584_0040593 Ga0495584_0040593_110_2125 559
135 3300048907 Ga0496104_0000068 Ga0496104_0000068_20721_22763 559
136 3300050507 nmdc:mga05p37_54198_c1 nmdc:mga05p37_54198_c1_2917_4914 559
137 3300050508 nmdc:mga09592_11836_c1 nmdc:mga09592_11836_c1_3230_5344 559
138 3300050510 nmdc:mga06r32_40654_c1 nmdc:mga06r32_40654_c1_1709_3823 559
139 3300053077 Ga0495601_0003899 Ga0495601_0003899_1462_3480 559
140 3300053085 Ga0495619_0011876 Ga0495619_0011876_56_1954 559
141 3300031665 Ga0316575_10000579 Ga0316575_100005794 560
142 3300031665 Ga0316575_10012556 Ga0316575_100125562 560
143 3300031691 Ga0316579_10002934 Ga0316579_100029342 560
144 3300031727 Ga0316576_10032311 Ga0316576_100323112 560
145 3300031728 Ga0316578_10039342 Ga0316578_100393422 560
146 3300031733 Ga0316577_10005858 Ga0316577_100058584 560
147 3300031733 Ga0316577_10020478 Ga0316577_100204782 560
148 3300032137 Ga0316585_10011064 Ga0316585_100110641 560
149 3300035398 Ga0316574_0000237 Ga0316574_0000237_6434_8485 560
150 3300035398 Ga0316574_0001570 Ga0316574_0001570_6242_8215 560
151 3300035398 Ga0316574_0006019 Ga0316574_0006019_2863_4860 560
152 3300035398 Ga0316574_0046737 Ga0316574_0046737_680_2656 560
153 3300036647 Ga0316582_0056275 Ga0316582_0056275_511_2487 560
154 3300036712 Ga0316584_0001371 Ga0316584_0001371_66_2039 560
155 3300036712 Ga0316584_0003595 Ga0316584_0003595_6447_8417 560
156 3300036712 Ga0316584_0005101 Ga0316584_0005101_2998_4968 560
157 3300037588 Ga0316581_0000219 Ga0316581_0000219_1992_3965 560
158 3300044712 Ga0453684_0022879 Ga0453684_0022879_322_2517 560
159 3300048908 Ga0496105_0007133 Ga0496105_0007133_405_2471 560
160 3300005458 Ga0070681_10094713 Ga0070681_100947132 561
161 3300005530 Ga0070679_100132226 Ga0070679_1001322261 561
162 3300025921 Ga0207652_10063192 Ga0207652_100631923 561
163 3300022732 Ga0224569_100165 Ga0224569_1001653 563
164 3300026116 Ga0207674_10057737 Ga0207674_100577372 566
165 3300005518 Ga0070699_100026525 Ga0070699_1000265252 567
166 3300013297 Ga0157378_10105832 Ga0157378_101058321 567
167 3300013306 Ga0163162_10127284 Ga0163162_101272842 567
168 3300047320 Ga0495672_0028149 Ga0495672_0028149_1460_3505 567
169 3300053153 Ga0500616_0017587 Ga0500616_0017587_1830_3878 567
170 3300005334 Ga0068869_100011821 Ga0068869_1000118214 568
171 3300005337 Ga0070682_100000091 Ga0070682_10000009171 568
172 3300005354 Ga0070675_100103263 Ga0070675_1001032631 568
173 3300005441 Ga0070700_100026831 Ga0070700_1000268311 568
174 3300005467 Ga0070706_100001454 Ga0070706_10000145414 568
175 3300005471 Ga0070698_100000126 Ga0070698_10000012638 568
176 3300005536 Ga0070697_100000100 Ga0070697_10000010041 568
177 3300005536 Ga0070697_100002334 Ga0070697_1000023344 568
178 3300005544 Ga0070686_100002788 Ga0070686_1000027886 568
179 3300013297 Ga0157378_10042830 Ga0157378_100428302 568
180 3300025910 Ga0207684_10002323 Ga0207684_100023236 568
181 3300025942 Ga0207689_10004875 Ga0207689_100048753 568
182 3300026075 Ga0207708_10062639 Ga0207708_100626392 568
183 3300039437 Ga0436365_1842662 Ga0436365_1842662_1088_3229 568
184 3300046525 Ga0495663_0000200 Ga0495663_0000200_4169_6199 568
185 3300046537 Ga0495598_0000002 Ga0495598_0000002_16558_18606 568
186 3300046539 Ga0495621_0000696 Ga0495621_0000696_5420_7468 568
187 3300005355 Ga0070671_100014112 Ga0070671_1000141123 569
188 3300005468 Ga0070707_100003906 Ga0070707_1000039064 569
189 3300025922 Ga0207646_10005052 Ga0207646_100050524 569
190 3300025931 Ga0207644_10009656 Ga0207644_100096563 569
191 3300005345 Ga0070692_10001518 Ga0070692_100015184 570
192 3300005441 Ga0070700_100016141 Ga0070700_1000161412 570
193 3300005547 Ga0070693_100011219 Ga0070693_1000112192 570
194 3300005616 Ga0068852_100024428 Ga0068852_1000244283 570
195 3300005842 Ga0068858_100016873 Ga0068858_1000168734 570
196 3300005844 Ga0068862_100015482 Ga0068862_1000154823 570
197 3300009093 Ga0105240_10092856 Ga0105240_100928562 570
198 3300009094 Ga0111539_10007287 Ga0111539_100072874 570
199 3300009094 Ga0111539_10028621 Ga0111539_100286213 570
200 3300009545 Ga0105237_10000334 Ga0105237_1000033457 570
201 3300014326 Ga0157380_10008978 Ga0157380_100089783 570
202 3300025913 Ga0207695_10118211 Ga0207695_101182112 570
203 3300025914 Ga0207671_10001998 Ga0207671_100019983 570
204 3300027907 Ga0207428_10016015 Ga0207428_100160153 570
205 3300050511 nmdc:mga08y16_42568_c1 nmdc:mga08y16_42568_c1_297_2351 570
206 3300050511 nmdc:mga08y16_5263_c1 nmdc:mga08y16_5263_c1_4503_6515 570
207 3300005293 Ga0065715_10117983 Ga0065715_101179832 571
208 3300005444 Ga0070694_100014281 Ga0070694_1000142812 571
209 3300005543 Ga0070672_100059883 Ga0070672_1000598831 571
210 3300005544 Ga0070686_100008566 Ga0070686_1000085663 571
211 3300005719 Ga0068861_100056678 Ga0068861_1000566781 571
212 3300009147 Ga0114129_10069368 Ga0114129_100693682 571
213 3300009147 Ga0114129_10209207 Ga0114129_102092072 571
214 3300014326 Ga0157380_10032020 Ga0157380_100320201 571
215 3300025918 Ga0207662_10031427 Ga0207662_100314271 571
216 3300028381 Ga0268264_10043943 Ga0268264_100439431 571
217 3300050507 nmdc:mga05p37_175591_c1 nmdc:mga05p37_175591_c1_119_2209 571
218 3300002459 JGI24751J29686_10000104 JGI24751J29686_1000010423 572
219 3300005331 Ga0070670_100000159 Ga0070670_10000015920 572
220 3300005459 Ga0068867_100016205 Ga0068867_1000162053 572
221 3300005459 Ga0068867_100081499 Ga0068867_1000814992 572
222 3300005547 Ga0070693_100032561 Ga0070693_1000325612 572
223 3300009101 Ga0105247_10002783 Ga0105247_100027837 572
224 3300009148 Ga0105243_10005108 Ga0105243_100051083 572
225 3300014325 Ga0163163_10000305 Ga0163163_1000030527 572
226 3300025900 Ga0207710_10001505 Ga0207710_100015057 572
227 3300025925 Ga0207650_10000007 Ga0207650_10000007397 572
228 3300025935 Ga0207709_10002551 Ga0207709_100025514 572
229 3300026035 Ga0207703_10049823 Ga0207703_100498232 572
230 3300026089 Ga0207648_10040338 Ga0207648_100403383 572
231 3300026089 Ga0207648_10043025 Ga0207648_100430252 572
232 3300028381 Ga0268264_10031118 Ga0268264_100311182 572

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01968

Hydantoinase_A

Hydantoinase/oxoprolinase

283

551

0.95

PF05378

Hydant_A_N

Hydantoinase/oxoprolinase N-terminal region

29

200

0.93

PF19278

Hydant_A_C

Hydantoinase/oxoprolinase C-terminal domain

581

748

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yra-assembly2.cif.gz_C crystal structure of atp-dependent caprolactamase from pseudomonas jessenii 0.854 17 570
5l9w-assembly2.cif.gz_B crystal structure of the apc core complex 0.8506 5 571
5l9w-assembly2.cif.gz_B crystal structure of the apc core complex 0.8424 5 571
5l9w-assembly2.cif.gz_b crystal structure of the apc core complex 0.8292 47 568
6yra-assembly2.cif.gz_C crystal structure of atp-dependent caprolactamase from pseudomonas jessenii 0.8282 17 570
ID Description Score Start End Superfamily
af_Q58374_206_498_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9289 110 389 3.30.420.40
af_P95223_202_491_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9161 110 391 3.30.420.40
af_E7F6Z6_236_543_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.914 110 393 3.30.420.40
af_P95223_202_491_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8885 110 391 3.30.420.40
af_Q58374_206_498_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8857 110 389 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A534WV68-F1-model_v4 Hydantoinase/oxoprolinase family protein 0.9644 22 572 GO:0005829
GO:0006749
GO:0017168
AF-A0A534SXD6-F1-model_v4 Hydantoinase/oxoprolinase family protein 0.9612 101 572 GO:0005829
GO:0006749
GO:0017168
AF-A0A534VGZ5-F1-model_v4 Hydantoinase/oxoprolinase family protein 0.9588 4 426 GO:0005829
GO:0006749
GO:0017168
AF-A0A807DZI5-F1-model_v4 deleted 0.9576 9 571
AF-A0A6L7U0I9-F1-model_v4 Hydantoinase/oxoprolinase family protein 0.9576 12 572 GO:0005829
GO:0006749
GO:0017168

Feature Viewer

pLDDT pTM Quality
89.33 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map