F345192

General Info

Members Datasets Scaffolds Average Seq Length
232 174 464 797

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10000565|Ga0265328_100005656
Length 833
Sequence MTNTWMDIKNANVILVMGGNAAEAHPVGFKWVIEAKAHNKAKLIVVDPRFNRTASVADYYAPIRSGTDIAFLNGVIRYLLEKGQIQQDYVQAYTNAPFIVREDFDFNDGLFSGYDEKEHKYDKSSWAYELDDKGFAKVDPTLKNPRCVINLLKHHVERYTPEMVSNITGTPQKQFLEICEMLASTAAPDRTLTSLYALGWTQHSVGAQNIRALAMLQLLLGNIGMPGGGVNALRGHSNIQGLSDLGLMSDLLPGYMTMHKDDDVDRATYLDKRTPKLLRPGQMNYFVNYPKFHTSLMKAWYGPAATKENDFAYDWMPKLDKVYDGLRVFDMMHEGKFTGYFCQGFNPLASFPNKNKLSESLSKLRFLVVMDPLATETSEFWKSYGESNDVDPSKIQTEVFRLPTTLFAEEEGALVNSSRWLQWHWKGAEAPGECRTDIAIMSDLFLKLRGMYAKDGGAFPDPILNLYWPYHDAGEPTPEELAKEYNGRALADIMDPKDATKVLIKAGQQLSSFAQLADDGSTSCGTWIFNQMARRETADPSGLGIAPGWAXXXPLNRRILYNRASCDVAGKPWDAKRKLISWDGAKWGGYDVPDFKADVPPGDPMSPFIMTNEGVGRLFALDKMAEGPFPEHYEPFENPLGTNLLHPKVISNPAARVFPKDREHFGTNEAFPYVGTTYRLTEHFHFWTKHSKINASLQPEQFVEIGEELAKAKGIENGERVVVSSKRGYIKAVAVVTKRIKALDVGGKRIHQIGVPIHWGFTGAAKQGYLANTLTPFVGDANTQTPEFKSFLVNLEKDDGSKPKLVEPAPEKQAKADDIDLSRRGWLFGRRDT

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
162 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
163 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
166 2721755523 Delftia sp. HK171 Isolate Unclassified
167 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
168 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
169 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
170 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
171 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
172 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
173 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
174 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.84
Nodule 0.86
Rhizoplane 4.74
Rhizosphere 62.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10000565 3300031239 Bacteria 17186
2 JGI24735J21928_10000655 3300002067 Bacteria 12239
3 JGI25162J39368_1000032 3300002737 Bacteria 195871
4 JGI25165J46597_1000067 3300003214 Bacteria 196411
5 Ga0055538_1000033 3300003751 Bacteria 195914
6 Ga0055539_1000045 3300003752 Bacteria 195316
7 Ga0055533_1000054 3300003756 Bacteria 195914
8 Ga0055533_1000808 3300003756 Bacteria 9751
9 Ga0055525_1000065 3300003759 Bacteria 195779
10 Ga0055537_1003813 3300003773 Bacteria 4515
11 Ga0055524_1000509 3300003775 Bacteria 30057
12 Ga0055536_1000159 3300003781 Bacteria 58702
13 Ga0055541_1000031 3300003841 Bacteria 195914
14 Ga0070670_100000745 3300005331 Bacteria 25289
15 Ga0070667_100000012 3300005367 Bacteria 258575
16 Ga0070713_100012485 3300005436 Bacteria 6233
17 Ga0070663_100000630 3300005455 Bacteria 18912
18 Ga0070698_100005136 3300005471 Bacteria 14329
19 Ga0068853_100003185 3300005539 Bacteria 12532
20 Ga0068853_100014297 3300005539 Bacteria 6495
21 Ga0070665_100000095 3300005548 Bacteria 170459
22 Ga0070665_100031439 3300005548 Bacteria 5344
23 Ga0068859_100009189 3300005617 Bacteria 9981
24 Ga0068862_100035484 3300005844 Bacteria 4224
25 Ga0070717_10015173 3300006028 Bacteria 5943
26 Ga0075368_10000471 3300006042 Bacteria 11930
27 Ga0075364_10013043 3300006051 Bacteria 5100
28 Ga0070712_100015938 3300006175 Bacteria 4848
29 Ga0097620_100009189 3300006931 Bacteria 9981
30 Ga0079104_1000011 3300006946 Bacteria 359962
31 Ga0105251_10001383 3300009011 Bacteria 20991
32 Ga0105240_10103908 3300009093 Bacteria 3451
33 Ga0105243_10000661 3300009148 Bacteria 34076
34 Ga0105248_10000468 3300009177 Bacteria 45955
35 Ga0105248_10019798 3300009177 Bacteria 7454
36 Ga0105248_10059877 3300009177 Bacteria 4277
37 Ga0105237_10006809 3300009545 Bacteria 12602
38 Ga0105238_10111166 3300009551 Bacteria 2721
39 Ga0105249_10000469 3300009553 Bacteria 37523
40 Ga0105239_10060928 3300010375 Bacteria 4142
41 Ga0163162_10001890 3300013306 Bacteria 19727
42 Ga0183368_1002 3300015687 Bacteria 1865598
43 Ga0213872_10000564 3300021361 Bacteria 28670
44 Ga0213872_10004254 3300021361 Bacteria 7674
45 Ga0213876_10013098 3300021384 Bacteria 4406
46 Ga0209784_100048 3300025224 Bacteria 198885
47 Ga0209566_100060 3300025225 Bacteria 198885
48 Ga0209674_100014 3300025226 Bacteria 704989
49 Ga0209674_100082 3300025226 Bacteria 198885
50 Ga0209563_100082 3300025230 Bacteria 198750
51 Ga0207427_100378 3300025231 Bacteria 26906
52 Ga0209437_100125 3300025233 Bacteria 198146
53 Ga0209258_101822 3300025242 Bacteria 6520
54 Ga0209677_100046 3300025253 Bacteria 198287
55 Ga0209233_1000138 3300025261 Bacteria 198287
56 Ga0209565_1000094 3300025263 Bacteria 134853
57 Ga0209565_1002363 3300025263 Bacteria 6872
58 Ga0209675_1000079 3300025291 Bacteria 155554
59 Ga0209675_1003760 3300025291 Bacteria 7026
60 Ga0209676_1000576 3300025292 Bacteria 55231
61 Ga0209564_1000166 3300025295 Bacteria 160208
62 Ga0209564_1000308 3300025295 Bacteria 96489
63 Ga0209758_1005845 3300025297 Bacteria 9189
64 Ga0209256_1000905 3300025299 Bacteria 36349
65 Ga0209256_1002412 3300025299 Bacteria 15325
66 Ga0209051_1001060 3300025303 Bacteria 25669
67 Ga0209051_1005358 3300025303 Bacteria 7532
68 Ga0209051_1009332 3300025303 Bacteria 5068
69 Ga0207713_1002356 3300025735 Bacteria 13840
70 Ga0207647_10007898 3300025904 Bacteria 7651
71 Ga0207695_10039794 3300025913 Bacteria 5049
72 Ga0207671_10007763 3300025914 Bacteria 9240
73 Ga0207700_10062143 3300025928 Bacteria 2836
74 Ga0207709_10000074 3300025935 Bacteria 174947
75 Ga0207711_10000406 3300025941 Bacteria 45644
76 Ga0207711_10038926 3300025941 Bacteria 4043
77 Ga0207712_10001383 3300025961 Bacteria 16608
78 Ga0207658_10000027 3300025986 Bacteria 174626
79 Ga0207678_10000258 3300026067 Bacteria 48084
80 Ga0209281_1000005 3300027111 Bacteria 1242284
81 Ga0209813_10000541 3300027866 Bacteria 8923
82 Ga0268266_10000001 3300028379 Bacteria 4040580
83 Ga0268266_10051223 3300028379 Bacteria 3544
84 Ga0268265_10000158 3300028380 Bacteria 83123
85 Ga0268265_10009023 3300028380 Bacteria 6746
86 Ga0265338_10002184 3300028800 Bacteria 30002
87 Ga0265338_10034916 3300028800 Bacteria 4847
88 Ga0265339_10002468 3300031249 Bacteria 13229
89 Ga0265331_10000030 3300031250 Bacteria 215032
90 Ga0265327_10000072 3300031251 Bacteria 215055
91 Ga0265342_10000039 3300031712 Bacteria 140091
92 Ga0373925_0056790 3300037068 Bacteria 2933
93 Ga0395900_0014877 3300037418 Bacteria 7929
94 Ga0395905_0024623 3300037471 Bacteria 5678
95 Ga0436365_0760767 3300039437 Bacteria 27378
96 Ga0436361_0131723 3300039447 Bacteria 18618
97 Ga0436361_0507032 3300039447 Bacteria 49226
98 Ga0436361_0629455 3300039447 Bacteria 4021
99 Ga0436361_0908905 3300039447 Bacteria 4848
100 Ga0439465_0000670 3300041413 Bacteria 10457
101 Ga0453684_0000005 3300044712 Bacteria 1431632
102 Ga0453684_0003131 3300044712 Bacteria 38095
103 Ga0451576_0007575 3300045051 Bacteria 12935
104 Ga0495603_0000139 3300046455 Bacteria 36220
105 Ga0495590_0000634 3300046457 Bacteria 16318
106 Ga0495591_000713 3300046458 Bacteria 24121
107 Ga0495629_0000663 3300046459 Bacteria 27810
108 Ga0495629_0004597 3300046459 Bacteria 10331
109 Ga0495629_0010710 3300046459 Bacteria 6668
110 Ga0495638_0028124 3300046460 Bacteria 3632
111 Ga0495651_0008833 3300046462 Bacteria 7731
112 Ga0495653_0001022 3300046463 Bacteria 21574
113 Ga0495653_0012736 3300046463 Bacteria 6869
114 Ga0495653_0021981 3300046463 Bacteria 5162
115 Ga0495650_0002531 3300046471 Bacteria 14603
116 Ga0495580_0003791 3300046472 Bacteria 12807
117 Ga0495580_0008906 3300046472 Bacteria 7936
118 Ga0495664_0017430 3300046477 Bacteria 4105
119 Ga0495606_0006983 3300046507 Bacteria 10261
120 Ga0495608_0001033 3300046511 Bacteria 19551
121 Ga0495618_0002415 3300046514 Bacteria 12008
122 Ga0495628_0000457 3300046516 Bacteria 37378
123 Ga0495628_0005433 3300046516 Bacteria 11159
124 Ga0495628_0005694 3300046516 Bacteria 10912
125 Ga0495630_0025307 3300046517 Bacteria 4387
126 Ga0495648_0004824 3300046524 Bacteria 11380
127 Ga0495666_0000229 3300046526 Bacteria 23906
128 Ga0495666_0003981 3300046526 Bacteria 7472
129 Ga0495642_0016580 3300046528 Bacteria 2873
130 Ga0495652_0001464 3300046529 Bacteria 26081
131 Ga0495652_0001621 3300046529 Bacteria 24558
132 Ga0495652_0021615 3300046529 Bacteria 5718
133 Ga0495665_0000139 3300046531 Bacteria 35407
134 Ga0495665_0011764 3300046531 Bacteria 4741
135 Ga0495640_0007580 3300046533 Bacteria 8525
136 Ga0495640_0029472 3300046533 Bacteria 3941
137 Ga0495586_0000124 3300046535 Bacteria 47092
138 Ga0495586_0007881 3300046535 Bacteria 5678
139 Ga0495587_0007825 3300046536 Bacteria 6905
140 Ga0495587_0026526 3300046536 Bacteria 3533
141 Ga0495597_0007251 3300046542 Bacteria 5650
142 Ga0495645_0032253 3300046543 Bacteria 3820
143 Ga0495645_0036777 3300046543 Bacteria 3568
144 Ga0495667_0073139 3300046559 Bacteria 2233
145 Ga0495634_0006812 3300046642 Bacteria 8648
146 Ga0495661_0006341 3300046665 Bacteria 8319
147 Ga0495661_0012617 3300046665 Bacteria 5702
148 Ga0495599_0018796 3300046678 Bacteria 4308
149 Ga0495623_0005035 3300046679 Bacteria 8668
150 Ga0495623_0011565 3300046679 Bacteria 5714
151 Ga0495646_0013417 3300046680 Bacteria 5210
152 Ga0495613_0005900 3300046689 Bacteria 9169
153 Ga0495613_0007348 3300046689 Bacteria 8208
154 Ga0495613_0011637 3300046689 Bacteria 6540
155 Ga0495624_0003578 3300046690 Bacteria 11505
156 Ga0495589_0000759 3300046794 Bacteria 20588
157 Ga0495589_0007957 3300046794 Bacteria 5549
158 Ga0495600_0004452 3300046809 Bacteria 8384
159 Ga0495604_0018576 3300047317 Bacteria 5569
160 Ga0495676_0049688 3300047321 Bacteria 3369
161 Ga0495680_0001071 3300047322 Bacteria 30324
162 Ga0495680_0005720 3300047322 Bacteria 11643
163 Ga0495683_0003408 3300047323 Bacteria 9278
164 Ga0495683_0003502 3300047323 Bacteria 9136
165 Ga0495687_000121 3300047443 Bacteria 120336
166 Ga0495675_0016523 3300047444 Bacteria 4668
167 Ga0495675_0030555 3300047444 Bacteria 3437
168 Ga0495675_0031401 3300047444 Bacteria 3391
169 Ga0495679_000269 3300047446 Bacteria 43503
170 Ga0495679_001522 3300047446 Bacteria 13086
171 Ga0495686_0000370 3300047472 Bacteria 73065
172 Ga0495686_0010395 3300047472 Bacteria 6623
173 Ga0495593_0001753 3300047673 Bacteria 12846
174 Ga0495593_0002072 3300047673 Bacteria 11973
175 Ga0495593_0016297 3300047673 Bacteria 4193
176 Ga0495602_0000446 3300048088 Bacteria 38693
177 Ga0495602_0000614 3300048088 Bacteria 33492
178 Ga0495602_0018110 3300048088 Bacteria 7046
179 Ga0495614_0000125 3300048089 Bacteria 26649
180 Ga0496102_0026611 3300048905 Bacteria 5162
181 Ga0496103_0011269 3300048906 Bacteria 5294
182 Ga0496105_0006555 3300048908 Bacteria 8955
183 Ga0496107_0005731 3300048910 Bacteria 8501
184 Ga0496110_0009100 3300048913 Bacteria 8015
185 Ga0496112_0017831 3300048915 Bacteria 6681
186 Ga0496113_0032387 3300048916 Bacteria 3800
187 Ga0496114_0003936 3300048917 Bacteria 11456
188 Ga0496114_0028227 3300048917 Bacteria 4603
189 Ga0496115_0000379 3300048918 Bacteria 36717
190 Ga0496115_0001104 3300048918 Bacteria 19472
191 Ga0496117_0004268 3300048920 Bacteria 15934
192 Ga0496118_0000198 3300048921 Bacteria 105857
193 Ga0496118_0021355 3300048921 Bacteria 5700
194 Ga0496121_0031420 3300048924 Bacteria 4851
195 Ga0496122_0001667 3300048925 Bacteria 34447
196 Ga0496122_0013402 3300048925 Bacteria 8028
197 Ga0496123_0000107 3300048926 Bacteria 166923
198 Ga0496124_0011488 3300048927 Bacteria 8848
199 Ga0496125_0034877 3300048928 Bacteria 4426
200 Ga0496126_0000032 3300048929 Bacteria 372456
201 Ga0496126_0002439 3300048929 Bacteria 25116
202 Ga0496126_0010474 3300048929 Bacteria 9714
203 Ga0501046_0012775 3300049580 Bacteria 7143
204 Ga0501048_0001473 3300049582 Bacteria 17844
205 Ga0501075_0007070 3300049591 Bacteria 7755
206 Ga0501044_0116194 3300049823 Bacteria 2681
207 nmdc:mga06z11_307_c1 3300050494 Bacteria 18616
208 nmdc:mga04h51_542_c1 3300050495 Bacteria 8991
209 Ga0500643_001109 3300053087 Bacteria 16124
210 Ga0500651_0001244 3300053093 Bacteria 12675
211 Ga0500566_0000080 3300053094 Bacteria 47299
212 Ga0500640_000072 3300053095 Bacteria 16616
213 Ga0500572_000408 3300053111 Bacteria 15091
214 Ga0500595_000078 3300053119 Bacteria 68089
215 Ga0500595_000240 3300053119 Bacteria 37131
216 Ga0500597_000135 3300053120 Bacteria 14916
217 Ga0500559_0005289 3300053136 Bacteria 5945
218 Ga0500568_0000299 3300053139 Bacteria 40229
219 Ga0500603_000064 3300053150 Bacteria 24659
220 Ga0500630_000172 3300053159 Bacteria 24102
221 Ga0500639_000017 3300053163 Bacteria 114464
222 Ga0500645_000486 3300053730 Bacteria 26878
223 2643754809 2643221547 Bacteria 4740017
224 2722883979 2721755523 Bacteria 6430384
225 2839140248 2839138175 Bacteria 6549354
226 2842718444 2842718218 Bacteria 4560148
227 2885384302 2885383462 Bacteria 9473874
228 2891635125 2891633521 Bacteria 4602265
229 2904618312 2904615490 Bacteria 10047340
230 2953995845 2953994433 Bacteria 4303959
231 2968120828 2968117919 Bacteria 6536078
232 2974320809 2974320154 Bacteria 4571377
233 Ga0265328_10000565
234 JGI24735J21928_10000655
235 JGI25162J39368_1000032
236 JGI25165J46597_1000067
237 Ga0055538_1000033
238 Ga0055539_1000045
239 Ga0055533_1000054
240 Ga0055533_1000808
241 Ga0055525_1000065
242 Ga0055537_1003813
243 Ga0055524_1000509
244 Ga0055536_1000159
245 Ga0055541_1000031
246 Ga0070670_100000745
247 Ga0070667_100000012
248 Ga0070713_100012485
249 Ga0070663_100000630
250 Ga0070698_100005136
251 Ga0068853_100003185
252 Ga0068853_100014297
253 Ga0070665_100000095
254 Ga0070665_100031439
255 Ga0068859_100009189
256 Ga0068862_100035484
257 Ga0070717_10015173
258 Ga0075368_10000471
259 Ga0075364_10013043
260 Ga0070712_100015938
261 Ga0097620_100009189
262 Ga0079104_1000011
263 Ga0105251_10001383
264 Ga0105240_10103908
265 Ga0105243_10000661
266 Ga0105248_10000468
267 Ga0105248_10019798
268 Ga0105248_10059877
269 Ga0105237_10006809
270 Ga0105238_10111166
271 Ga0105249_10000469
272 Ga0105239_10060928
273 Ga0163162_10001890
274 Ga0183368_1002
275 Ga0213872_10000564
276 Ga0213872_10004254
277 Ga0213876_10013098
278 Ga0209784_100048
279 Ga0209566_100060
280 Ga0209674_100014
281 Ga0209674_100082
282 Ga0209563_100082
283 Ga0207427_100378
284 Ga0209437_100125
285 Ga0209258_101822
286 Ga0209677_100046
287 Ga0209233_1000138
288 Ga0209565_1000094
289 Ga0209565_1002363
290 Ga0209675_1000079
291 Ga0209675_1003760
292 Ga0209676_1000576
293 Ga0209564_1000166
294 Ga0209564_1000308
295 Ga0209758_1005845
296 Ga0209256_1000905
297 Ga0209256_1002412
298 Ga0209051_1001060
299 Ga0209051_1005358
300 Ga0209051_1009332
301 Ga0207713_1002356
302 Ga0207647_10007898
303 Ga0207695_10039794
304 Ga0207671_10007763
305 Ga0207700_10062143
306 Ga0207709_10000074
307 Ga0207711_10000406
308 Ga0207711_10038926
309 Ga0207712_10001383
310 Ga0207658_10000027
311 Ga0207678_10000258
312 Ga0209281_1000005
313 Ga0209813_10000541
314 Ga0268266_10000001
315 Ga0268266_10051223
316 Ga0268265_10000158
317 Ga0268265_10009023
318 Ga0265338_10002184
319 Ga0265338_10034916
320 Ga0265339_10002468
321 Ga0265331_10000030
322 Ga0265327_10000072
323 Ga0265342_10000039
324 Ga0373925_0056790
325 Ga0395900_0014877
326 Ga0395905_0024623
327 Ga0436365_0760767
328 Ga0436361_0131723
329 Ga0436361_0507032
330 Ga0436361_0629455
331 Ga0436361_0908905
332 Ga0439465_0000670
333 Ga0453684_0000005
334 Ga0453684_0003131
335 Ga0451576_0007575
336 Ga0495603_0000139
337 Ga0495590_0000634
338 Ga0495591_000713
339 Ga0495629_0000663
340 Ga0495629_0004597
341 Ga0495629_0010710
342 Ga0495638_0028124
343 Ga0495651_0008833
344 Ga0495653_0001022
345 Ga0495653_0012736
346 Ga0495653_0021981
347 Ga0495650_0002531
348 Ga0495580_0003791
349 Ga0495580_0008906
350 Ga0495664_0017430
351 Ga0495606_0006983
352 Ga0495608_0001033
353 Ga0495618_0002415
354 Ga0495628_0000457
355 Ga0495628_0005433
356 Ga0495628_0005694
357 Ga0495630_0025307
358 Ga0495648_0004824
359 Ga0495666_0000229
360 Ga0495666_0003981
361 Ga0495642_0016580
362 Ga0495652_0001464
363 Ga0495652_0001621
364 Ga0495652_0021615
365 Ga0495665_0000139
366 Ga0495665_0011764
367 Ga0495640_0007580
368 Ga0495640_0029472
369 Ga0495586_0000124
370 Ga0495586_0007881
371 Ga0495587_0007825
372 Ga0495587_0026526
373 Ga0495597_0007251
374 Ga0495645_0032253
375 Ga0495645_0036777
376 Ga0495667_0073139
377 Ga0495634_0006812
378 Ga0495661_0006341
379 Ga0495661_0012617
380 Ga0495599_0018796
381 Ga0495623_0005035
382 Ga0495623_0011565
383 Ga0495646_0013417
384 Ga0495613_0005900
385 Ga0495613_0007348
386 Ga0495613_0011637
387 Ga0495624_0003578
388 Ga0495589_0000759
389 Ga0495589_0007957
390 Ga0495600_0004452
391 Ga0495604_0018576
392 Ga0495676_0049688
393 Ga0495680_0001071
394 Ga0495680_0005720
395 Ga0495683_0003408
396 Ga0495683_0003502
397 Ga0495687_000121
398 Ga0495675_0016523
399 Ga0495675_0030555
400 Ga0495675_0031401
401 Ga0495679_000269
402 Ga0495679_001522
403 Ga0495686_0000370
404 Ga0495686_0010395
405 Ga0495593_0001753
406 Ga0495593_0002072
407 Ga0495593_0016297
408 Ga0495602_0000446
409 Ga0495602_0000614
410 Ga0495602_0018110
411 Ga0495614_0000125
412 Ga0496102_0026611
413 Ga0496103_0011269
414 Ga0496105_0006555
415 Ga0496107_0005731
416 Ga0496110_0009100
417 Ga0496112_0017831
418 Ga0496113_0032387
419 Ga0496114_0003936
420 Ga0496114_0028227
421 Ga0496115_0000379
422 Ga0496115_0001104
423 Ga0496117_0004268
424 Ga0496118_0000198
425 Ga0496118_0021355
426 Ga0496121_0031420
427 Ga0496122_0001667
428 Ga0496122_0013402
429 Ga0496123_0000107
430 Ga0496124_0011488
431 Ga0496125_0034877
432 Ga0496126_0000032
433 Ga0496126_0002439
434 Ga0496126_0010474
435 Ga0501046_0012775
436 Ga0501048_0001473
437 Ga0501075_0007070
438 Ga0501044_0116194
439 nmdc:mga06z11_307_c1
440 nmdc:mga04h51_542_c1
441 Ga0500643_001109
442 Ga0500651_0001244
443 Ga0500566_0000080
444 Ga0500640_000072
445 Ga0500572_000408
446 Ga0500595_000078
447 Ga0500595_000240
448 Ga0500597_000135
449 Ga0500559_0005289
450 Ga0500568_0000299
451 Ga0500603_000064
452 Ga0500630_000172
453 Ga0500639_000017
454 Ga0500645_000486
455 2643754809
456 2722883979
457 2839140248
458 2842718444
459 2885384302
460 2891635125
461 2904618312
462 2953995845
463 2968120828
464 2974320809

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00384

Molybdopterin

Molybdopterin oxidoreductase

1

381

0.92

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

673

792

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_A formate dehydrogenase n from e. coli 0.9364 1 809
1kqf-assembly1.cif.gz_A formate dehydrogenase n from e. coli 0.9286 1 809
8cm4-assembly2.cif.gz_C w-formate dehydrogenase c872a from desulfovibrio vulgaris - exposed to oxygen 0.9046 1 809
6sdr-assembly1.cif.gz_A w-formate dehydrogenase from desulfovibrio vulgaris - oxidized form 0.8954 1 809
8cm7-assembly1.cif.gz_A w-formate dehydrogenase m405a from desulfovibrio vulgaris 0.8954 1 809
ID Description Score Start End Superfamily
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9257 634 809 2.40.40.20
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9055 634 809 2.40.40.20
1kqgA03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.8734 1 253 3.40.228.10
1kqfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8556 320 470 3.40.50.740
2iv2X03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.8439 1 233 3.40.228.10
ID Description Score Start End GO Terms
AF-A0A378N898-F1-model_v4 Formate dehydrogenase, nitrate-inducible, major subunit (EC 1.17.1.9) 0.9947 56 191 GO:0008863
GO:0009055
GO:0009061
GO:0030151
GO:0030313
GO:0051539
AF-A0A2J0QR99-F1-model_v4 deleted 0.9865 34 175
AF-A0A6M1HVN7-F1-model_v4 deleted 0.9748 13 176
AF-A0A2M7KED2-F1-model_v4 Formate dehydrogenase 0.9743 1 196 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A0D8L381-F1-model_v4 Molybdopterin oxidoreductase domain-containing protein 0.9688 1 168 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539

Map