F345201

General Info

Members Datasets Scaffolds Average Seq Length
232 134 464 173

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10121683|Ga0265327_101216832
Length 188
Sequence MSRIGKMPIPMPGGVQISQENDILMVKGPKGSLTRKLHPAISIKVEDGNIICERPSDSKEHRSLHGLVRTLVSNMVTGVNTGFEKRMIVQGVGYRAELQGKNLSLQVGLSHPVVIEPMEGVEFEVGMDTNSRMPFVLIKCINNEVLGQQAANIRSIRPPEPYKGKGIRYATEVVRRKAGKSGKGVKGK

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
70 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
71 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
72 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
75 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
78 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
98 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 0
Rhizosphere 99.14
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10121683 3300031251 Bacteria 1236
2 JGI25407J50210_10019116 3300003373 Bacteria 1780
3 JGI25407J50210_10022111 3300003373 Bacteria 1654
4 JGI25407J50210_10059760 3300003373 Bacteria 959
5 Ga0058859_11484351 3300004798 Bacteria 1066
6 Ga0070680_100491009 3300005336 Bacteria 1050
7 Ga0070668_100023223 3300005347 Bacteria 4690
8 Ga0070703_10011405 3300005406 Bacteria 2509
9 Ga0070709_10036094 3300005434 Bacteria 3009
10 Ga0070714_100121475 3300005435 Bacteria 2324
11 Ga0070714_100220372 3300005435 Bacteria 1743
12 Ga0070714_100269090 3300005435 Bacteria 1580
13 Ga0070714_100357918 3300005435 Bacteria 1372
14 Ga0070714_100627454 3300005435 Bacteria 1033
15 Ga0070713_100354919 3300005436 Bacteria 1361
16 Ga0070705_100002600 3300005440 Bacteria 9050
17 Ga0070705_100069012 3300005440 Bacteria 2130
18 Ga0070705_100275813 3300005440 Bacteria 1193
19 Ga0070694_100415557 3300005444 Bacteria 1056
20 Ga0070708_100000929 3300005445 Bacteria 22153
21 Ga0070708_100016539 3300005445 Bacteria 6124
22 Ga0070708_100036727 3300005445 Bacteria 4274
23 Ga0070708_100076124 3300005445 Bacteria 3030
24 Ga0070708_100096809 3300005445 Bacteria 2696
25 Ga0070708_100123987 3300005445 Bacteria 2386
26 Ga0070681_10172467 3300005458 Bacteria 2085
27 Ga0070706_100000547 3300005467 Bacteria 43712
28 Ga0070706_100001515 3300005467 Bacteria 24359
29 Ga0070706_100001725 3300005467 Bacteria 22674
30 Ga0070706_100107186 3300005467 Bacteria 2599
31 Ga0070707_100001328 3300005468 Bacteria 24359
32 Ga0070707_100001828 3300005468 Bacteria 20464
33 Ga0070707_100027238 3300005468 Bacteria 5437
34 Ga0070707_100044527 3300005468 Bacteria 4249
35 Ga0070707_100068905 3300005468 Bacteria 3405
36 Ga0070707_100188389 3300005468 Bacteria 2011
37 Ga0070707_100344630 3300005468 Bacteria 1447
38 Ga0070707_100969500 3300005468 Bacteria 815
39 Ga0070698_100018273 3300005471 Bacteria 7382
40 Ga0070698_100023059 3300005471 Bacteria 6509
41 Ga0070698_100144006 3300005471 Bacteria 2333
42 Ga0070698_100145650 3300005471 Bacteria 2318
43 Ga0070698_100168712 3300005471 Bacteria 2130
44 Ga0070698_100174952 3300005471 Bacteria 2086
45 Ga0070698_100232740 3300005471 Bacteria 1776
46 Ga0070699_100009579 3300005518 Bacteria 8393
47 Ga0070699_100015992 3300005518 Bacteria 6441
48 Ga0070699_100032425 3300005518 Bacteria 4511
49 Ga0070699_100115898 3300005518 Bacteria 2354
50 Ga0070699_100334148 3300005518 Bacteria 1363
51 Ga0070699_100358443 3300005518 Bacteria 1314
52 Ga0070699_101229801 3300005518 Bacteria 687
53 Ga0070679_100210313 3300005530 Bacteria 1909
54 Ga0070697_100001474 3300005536 Bacteria 17878
55 Ga0070697_100008491 3300005536 Bacteria 8016
56 Ga0070697_100010522 3300005536 Bacteria 7221
57 Ga0070697_100016182 3300005536 Bacteria 5864
58 Ga0070697_100050931 3300005536 Bacteria 3363
59 Ga0070697_100083498 3300005536 Bacteria 2634
60 Ga0070697_100119127 3300005536 Bacteria 2207
61 Ga0070697_100167809 3300005536 Bacteria 1857
62 Ga0070697_100563238 3300005536 Bacteria 1000
63 Ga0070697_100692140 3300005536 Bacteria 899
64 Ga0070695_100071423 3300005545 Bacteria 2273
65 Ga0070695_100158234 3300005545 Bacteria 1588
66 Ga0070696_100015270 3300005546 Bacteria 5155
67 Ga0070696_100900840 3300005546 Bacteria 734
68 Ga0070704_100022112 3300005549 Bacteria 4135
69 Ga0068857_100129652 3300005577 Bacteria 2274
70 Ga0068862_100405070 3300005844 Bacteria 1277
71 Ga0081455_10010736 3300005937 Bacteria 9264
72 Ga0081538_10001605 3300005981 Bacteria 23193
73 Ga0070717_10000007 3300006028 Bacteria 304340
74 Ga0070717_10008962 3300006028 Bacteria 7501
75 Ga0075432_10015070 3300006058 Bacteria 2634
76 Ga0070715_10030293 3300006163 Bacteria 2186
77 Ga0070716_100460873 3300006173 Bacteria 929
78 Ga0070712_100809880 3300006175 Bacteria 804
79 Ga0075428_100069486 3300006844 Bacteria 3850
80 Ga0075428_100510325 3300006844 Bacteria 1286
81 Ga0075431_100384525 3300006847 Bacteria 1407
82 Ga0075431_100507411 3300006847 Bacteria 1197
83 Ga0075433_10012940 3300006852 Bacteria 6763
84 Ga0075433_10016581 3300006852 Bacteria 6077
85 Ga0075434_100078534 3300006871 Bacteria 3296
86 Ga0075434_100148563 3300006871 Bacteria 2363
87 Ga0075434_100290588 3300006871 Bacteria 1655
88 Ga0075436_100004044 3300006914 Bacteria 10055
89 Ga0075436_100043738 3300006914 Bacteria 3088
90 Ga0075436_100191392 3300006914 Bacteria 1447
91 Ga0075436_100629779 3300006914 Bacteria 791
92 Ga0075435_100028105 3300007076 Bacteria 4408
93 Ga0099794_10000117 3300007265 Bacteria 29179
94 Ga0099795_10023118 3300007788 Bacteria 2059
95 Ga0114129_10006513 3300009147 Bacteria 16568
96 Ga0114129_10096524 3300009147 Bacteria 4092
97 Ga0114129_10963989 3300009147 Bacteria 1076
98 Ga0157380_11850154 3300014326 Bacteria 663
99 Ga0207653_10001462 3300025885 Bacteria 7662
100 Ga0207699_10069645 3300025906 Bacteria 2146
101 Ga0207699_10344954 3300025906 Bacteria 1050
102 Ga0207684_10000026 3300025910 Bacteria 316711
103 Ga0207684_10000148 3300025910 Bacteria 124604
104 Ga0207684_10000222 3300025910 Bacteria 87705
105 Ga0207684_10297010 3300025910 Bacteria 1393
106 Ga0207707_10511003 3300025912 Unclassified 1024
107 Ga0207652_10238836 3300025921 Unclassified 1638
108 Ga0207646_10000093 3300025922 Bacteria 119533
109 Ga0207646_10000394 3300025922 Bacteria 58624
110 Ga0207646_10000668 3300025922 Bacteria 44376
111 Ga0207646_10018156 3300025922 Bacteria 6567
112 Ga0207646_10081083 3300025922 Bacteria 2901
113 Ga0207646_10082944 3300025922 Bacteria 2867
114 Ga0207646_10102032 3300025922 Bacteria 2572
115 Ga0207646_10193562 3300025922 Bacteria 1836
116 Ga0207646_10296371 3300025922 Bacteria 1461
117 Ga0207700_10005510 3300025928 Bacteria 7590
118 Ga0207700_10207503 3300025928 Bacteria 1654
119 Ga0207664_10112174 3300025929 Bacteria 2270
120 Ga0207664_10517067 3300025929 Bacteria 1070
121 Ga0207664_10702208 3300025929 Bacteria 909
122 Ga0207664_10921591 3300025929 Bacteria 784
123 Ga0207665_10641265 3300025939 Bacteria 832
124 Ga0207674_10144435 3300026116 Bacteria 2338
125 Ga0207675_101377699 3300026118 Bacteria 726
126 Ga0209588_1000036 3300027671 Bacteria 65612
127 Ga0268265_10111347 3300028380 Bacteria 2236
128 Ga0265334_10014057 3300028573 Bacteria 3343
129 Ga0265338_10001848 3300028800 Bacteria 33242
130 Ga0265314_10018895 3300031711 Bacteria 5351
131 Ga0265314_10059521 3300031711 Bacteria 2613
132 Ga0316577_10130572 3300031733 Bacteria 1414
133 Ga0307416_100706837 3300032002 Bacteria 1097
134 Ga0307415_100326046 3300032126 Bacteria 1282
135 Ga0316593_10004917 3300032168 Bacteria 3478
136 Ga0316593_10086111 3300032168 Bacteria 1102
137 Ga0316592_1000001 3300033524 Bacteria 24674
138 Ga0316592_1000010 3300033524 Bacteria 13748
139 Ga0316592_1000023 3300033524 Bacteria 11911
140 Ga0373947_0006684 3300035725 Bacteria 6693
141 Ga0373937_0110871 3300036401 Bacteria 2552
142 Ga0395900_0607601 3300037418 Bacteria 1033
143 Ga0395898_0195546 3300037466 Bacteria 1932
144 Ga0395905_0323145 3300037471 Bacteria 1433
145 Ga0395901_0038114 3300038443 Bacteria 4972
146 Ga0439448_0076675 3300042005 Bacteria 1118
147 Ga0439448_0091073 3300042005 Bacteria 1030
148 Ga0439451_005906 3300042009 Bacteria 2500
149 Ga0439463_128901 3300042016 Bacteria 654
150 Ga0450888_000750 3300042126 Bacteria 3109
151 Ga0450902_054032 3300042137 Bacteria 691
152 Ga0439444_0008341 3300042437 Bacteria 1613
153 Ga0439464_0050295 3300042439 Bacteria 1203
154 Ga0439460_0064269 3300042461 Bacteria 1125
155 Ga0450916_061163 3300042530 Bacteria 612
156 Ga0450893_0011831 3300042532 Bacteria 1445
157 Ga0451577_1257463 3300042876 Unclassified 659
158 Ga0451577_1352356 3300042876 Bacteria 632
159 Ga0439440_0006638 3300042993 Bacteria 2333
160 Ga0453683_0029102 3300044673 Bacteria 3495
161 Ga0453683_0062889 3300044673 Unclassified 2320
162 Ga0453683_0124354 3300044673 Bacteria 1624
163 Ga0453683_0172590 3300044673 Bacteria 1370
164 Ga0453684_0014057 3300044712 Bacteria 12880
165 Ga0453684_0128219 3300044712 Bacteria 3049
166 Ga0453684_1740247 3300044712 Bacteria 636
167 Ga0451576_0000048 3300045051 Unclassified 325145
168 Ga0451576_0009051 3300045051 Bacteria 11594
169 Ga0495603_0048861 3300046455 Bacteria 2519
170 Ga0495629_0259033 3300046459 Bacteria 1196
171 Ga0495641_0001140 3300046461 Bacteria 22893
172 Ga0495641_0257540 3300046461 Bacteria 785
173 Ga0495631_0131246 3300046518 Bacteria 1076
174 Ga0495644_0008478 3300046523 Bacteria 3959
175 Ga0495644_0211106 3300046523 Bacteria 749
176 Ga0495640_0221200 3300046533 Bacteria 1194
177 Ga0495656_0001550 3300046615 Bacteria 7511
178 Ga0495635_0465996 3300046663 Bacteria 834
179 Ga0495659_0070934 3300046664 Bacteria 1305
180 Ga0495657_0049156 3300046675 Bacteria 2842
181 Ga0495646_0530877 3300046680 Bacteria 602
182 Ga0495669_0032976 3300046684 Bacteria 2279
183 Ga0495589_0078128 3300046794 Bacteria 1612
184 Ga0495673_0044963 3300047469 Bacteria 1966
185 Ga0495681_0090380 3300047470 Bacteria 1353
186 Ga0495686_0000008 3300047472 Bacteria 727479
187 Ga0495686_0011228 3300047472 Bacteria 6316
188 Ga0495686_0024116 3300047472 Bacteria 4000
189 Ga0495686_0245342 3300047472 Bacteria 1008
190 Ga0501031_0012568 3300049568 Bacteria 5530
191 Ga0501032_0059778 3300049569 Bacteria 2557
192 Ga0501034_0528433 3300049571 Bacteria 1091
193 Ga0501036_0013875 3300049572 Bacteria 6701
194 Ga0501038_0108276 3300049574 Bacteria 2304
195 Ga0501039_0011307 3300049575 Bacteria 6798
196 Ga0501040_0005394 3300049576 Bacteria 8273
197 Ga0501041_0005256 3300049577 Bacteria 7565
198 Ga0501042_0041935 3300049578 Bacteria 3255
199 Ga0501048_0014462 3300049582 Bacteria 5843
200 Ga0501069_0232158 3300049585 Bacteria 1074
201 Ga0501070_0514780 3300049586 Bacteria 960
202 Ga0501071_0060242 3300049587 Bacteria 2747
203 Ga0501072_0000401 3300049588 Bacteria 31057
204 Ga0501073_0020544 3300049589 Bacteria 4762
205 Ga0501075_0002542 3300049591 Bacteria 12148
206 Ga0501076_0083283 3300049592 Bacteria 2568
207 Ga0501257_023252 3300049686 Bacteria 1469
208 Ga0501079_0012575 3300049741 Bacteria 6464
209 Ga0501080_0090956 3300049742 Bacteria 2834
210 Ga0501081_0021152 3300049743 Bacteria 4341
211 Ga0501083_0543168 3300049744 Bacteria 756
212 Ga0501044_0060680 3300049823 Bacteria 3871
213 Ga0501045_0027525 3300049824 Bacteria 4097
214 nmdc:mga05p37_512111_c1 3300050507 Bacteria 1374
215 nmdc:mga06r32_430471_c1 3300050510 Bacteria 1300
216 nmdc:mga0n895_1081533_c1 3300050512 Bacteria 780
217 nmdc:mga0rr50_32848_c1 3300050513 Bacteria 3703
218 nmdc:mga0rr50_636794_c1 3300050513 Bacteria 910
219 nmdc:mga0rr50_741858_c1 3300050513 Bacteria 838
220 nmdc:mga08x19_128242_c1 3300050514 Bacteria 1705
221 nmdc:mga08x19_225869_c1 3300050514 Bacteria 1288
222 nmdc:mga08x19_44690_c1 3300050514 Bacteria 2829
223 nmdc:mga08x19_614199_c1 3300050514 Bacteria 771
224 nmdc:mga08x19_66154_c1 3300050514 Bacteria 2349
225 nmdc:mga08x19_8957_c1 3300050514 Bacteria 5972
226 nmdc:mga0a205_227433_c1 3300050515 Bacteria 1750
227 nmdc:mga0a205_8227_c1 3300050515 Bacteria 9480
228 Ga0500628_006092 3300053129 Bacteria 2029
229 Ga0501084_0020183 3300054114 Bacteria 5554
230 Ga0587079_028263 3300059647 Bacteria 1061
231 Ga0501082_0013928 3300060353 Bacteria 6915
232 Ga0530510_0005467 3300061734 Bacteria 8793
233 Ga0265327_10121683
234 JGI25407J50210_10019116
235 JGI25407J50210_10022111
236 JGI25407J50210_10059760
237 Ga0058859_11484351
238 Ga0070680_100491009
239 Ga0070668_100023223
240 Ga0070703_10011405
241 Ga0070709_10036094
242 Ga0070714_100121475
243 Ga0070714_100220372
244 Ga0070714_100269090
245 Ga0070714_100357918
246 Ga0070714_100627454
247 Ga0070713_100354919
248 Ga0070705_100002600
249 Ga0070705_100069012
250 Ga0070705_100275813
251 Ga0070694_100415557
252 Ga0070708_100000929
253 Ga0070708_100016539
254 Ga0070708_100036727
255 Ga0070708_100076124
256 Ga0070708_100096809
257 Ga0070708_100123987
258 Ga0070681_10172467
259 Ga0070706_100000547
260 Ga0070706_100001515
261 Ga0070706_100001725
262 Ga0070706_100107186
263 Ga0070707_100001328
264 Ga0070707_100001828
265 Ga0070707_100027238
266 Ga0070707_100044527
267 Ga0070707_100068905
268 Ga0070707_100188389
269 Ga0070707_100344630
270 Ga0070707_100969500
271 Ga0070698_100018273
272 Ga0070698_100023059
273 Ga0070698_100144006
274 Ga0070698_100145650
275 Ga0070698_100168712
276 Ga0070698_100174952
277 Ga0070698_100232740
278 Ga0070699_100009579
279 Ga0070699_100015992
280 Ga0070699_100032425
281 Ga0070699_100115898
282 Ga0070699_100334148
283 Ga0070699_100358443
284 Ga0070699_101229801
285 Ga0070679_100210313
286 Ga0070697_100001474
287 Ga0070697_100008491
288 Ga0070697_100010522
289 Ga0070697_100016182
290 Ga0070697_100050931
291 Ga0070697_100083498
292 Ga0070697_100119127
293 Ga0070697_100167809
294 Ga0070697_100563238
295 Ga0070697_100692140
296 Ga0070695_100071423
297 Ga0070695_100158234
298 Ga0070696_100015270
299 Ga0070696_100900840
300 Ga0070704_100022112
301 Ga0068857_100129652
302 Ga0068862_100405070
303 Ga0081455_10010736
304 Ga0081538_10001605
305 Ga0070717_10000007
306 Ga0070717_10008962
307 Ga0075432_10015070
308 Ga0070715_10030293
309 Ga0070716_100460873
310 Ga0070712_100809880
311 Ga0075428_100069486
312 Ga0075428_100510325
313 Ga0075431_100384525
314 Ga0075431_100507411
315 Ga0075433_10012940
316 Ga0075433_10016581
317 Ga0075434_100078534
318 Ga0075434_100148563
319 Ga0075434_100290588
320 Ga0075436_100004044
321 Ga0075436_100043738
322 Ga0075436_100191392
323 Ga0075436_100629779
324 Ga0075435_100028105
325 Ga0099794_10000117
326 Ga0099795_10023118
327 Ga0114129_10006513
328 Ga0114129_10096524
329 Ga0114129_10963989
330 Ga0157380_11850154
331 Ga0207653_10001462
332 Ga0207699_10069645
333 Ga0207699_10344954
334 Ga0207684_10000026
335 Ga0207684_10000148
336 Ga0207684_10000222
337 Ga0207684_10297010
338 Ga0207707_10511003
339 Ga0207652_10238836
340 Ga0207646_10000093
341 Ga0207646_10000394
342 Ga0207646_10000668
343 Ga0207646_10018156
344 Ga0207646_10081083
345 Ga0207646_10082944
346 Ga0207646_10102032
347 Ga0207646_10193562
348 Ga0207646_10296371
349 Ga0207700_10005510
350 Ga0207700_10207503
351 Ga0207664_10112174
352 Ga0207664_10517067
353 Ga0207664_10702208
354 Ga0207664_10921591
355 Ga0207665_10641265
356 Ga0207674_10144435
357 Ga0207675_101377699
358 Ga0209588_1000036
359 Ga0268265_10111347
360 Ga0265334_10014057
361 Ga0265338_10001848
362 Ga0265314_10018895
363 Ga0265314_10059521
364 Ga0316577_10130572
365 Ga0307416_100706837
366 Ga0307415_100326046
367 Ga0316593_10004917
368 Ga0316593_10086111
369 Ga0316592_1000001
370 Ga0316592_1000010
371 Ga0316592_1000023
372 Ga0373947_0006684
373 Ga0373937_0110871
374 Ga0395900_0607601
375 Ga0395898_0195546
376 Ga0395905_0323145
377 Ga0395901_0038114
378 Ga0439448_0076675
379 Ga0439448_0091073
380 Ga0439451_005906
381 Ga0439463_128901
382 Ga0450888_000750
383 Ga0450902_054032
384 Ga0439444_0008341
385 Ga0439464_0050295
386 Ga0439460_0064269
387 Ga0450916_061163
388 Ga0450893_0011831
389 Ga0451577_1257463
390 Ga0451577_1352356
391 Ga0439440_0006638
392 Ga0453683_0029102
393 Ga0453683_0062889
394 Ga0453683_0124354
395 Ga0453683_0172590
396 Ga0453684_0014057
397 Ga0453684_0128219
398 Ga0453684_1740247
399 Ga0451576_0000048
400 Ga0451576_0009051
401 Ga0495603_0048861
402 Ga0495629_0259033
403 Ga0495641_0001140
404 Ga0495641_0257540
405 Ga0495631_0131246
406 Ga0495644_0008478
407 Ga0495644_0211106
408 Ga0495640_0221200
409 Ga0495656_0001550
410 Ga0495635_0465996
411 Ga0495659_0070934
412 Ga0495657_0049156
413 Ga0495646_0530877
414 Ga0495669_0032976
415 Ga0495589_0078128
416 Ga0495673_0044963
417 Ga0495681_0090380
418 Ga0495686_0000008
419 Ga0495686_0011228
420 Ga0495686_0024116
421 Ga0495686_0245342
422 Ga0501031_0012568
423 Ga0501032_0059778
424 Ga0501034_0528433
425 Ga0501036_0013875
426 Ga0501038_0108276
427 Ga0501039_0011307
428 Ga0501040_0005394
429 Ga0501041_0005256
430 Ga0501042_0041935
431 Ga0501048_0014462
432 Ga0501069_0232158
433 Ga0501070_0514780
434 Ga0501071_0060242
435 Ga0501072_0000401
436 Ga0501073_0020544
437 Ga0501075_0002542
438 Ga0501076_0083283
439 Ga0501257_023252
440 Ga0501079_0012575
441 Ga0501080_0090956
442 Ga0501081_0021152
443 Ga0501083_0543168
444 Ga0501044_0060680
445 Ga0501045_0027525
446 nmdc:mga05p37_512111_c1
447 nmdc:mga06r32_430471_c1
448 nmdc:mga0n895_1081533_c1
449 nmdc:mga0rr50_32848_c1
450 nmdc:mga0rr50_636794_c1
451 nmdc:mga0rr50_741858_c1
452 nmdc:mga08x19_128242_c1
453 nmdc:mga08x19_225869_c1
454 nmdc:mga08x19_44690_c1
455 nmdc:mga08x19_614199_c1
456 nmdc:mga08x19_66154_c1
457 nmdc:mga08x19_8957_c1
458 nmdc:mga0a205_227433_c1
459 nmdc:mga0a205_8227_c1
460 Ga0500628_006092
461 Ga0501084_0020183
462 Ga0587079_028263
463 Ga0501082_0013928
464 Ga0530510_0005467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.96

PF00347

Ribosomal_L6

Ribosomal protein L6

90

170

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9765 2 175
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9753 9 172
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.971 2 175
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9709 9 171
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.9703 8 175
ID Description Score Start End Superfamily
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9679 83 175 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9667 85 178 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9644 1 82 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9589 83 168 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9578 83 175 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 0.9999 85 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9969 51 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A511VB55-F1-model_v4 Large ribosomal subunit protein uL6 0.9893 1 178 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A7V2Y705-F1-model_v4 Large ribosomal subunit protein uL6 0.987 1 178 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A831UBR0-F1-model_v4 Large ribosomal subunit protein uL6 0.9852 1 178 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map