F345442

General Info

Members Datasets Scaffolds Average Seq Length
232 150 232 747

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000070|Ga0496104_0000070_64358_66928
Length 812
Sequence VRIALVSPYSWTYPGGVTRHIDALARQLRRQGHEADVLAPFDPDDAASRRLHRGARPQACAPPPGFISLGRTVGIPANGAVSNLTATPGSALALRRALRAGGYDVAHIHEPVVPVIGWDALMCAGELPLVGTFHTYSTNRLTNGIAAIPLGARRRMNRLHARIAVSEAAAWTARRFYGGRYRIVPNGVLLPVDAPGNGELACAGAVLDGAGATYARGTGEPPALRILFVGQAVERKGLPVLLSAFEALRDQVPATLTLIGASAREIAPILMDDRGVRALGKVPDEDKHAELARADVLCAPSLRGESFGMVLTEAFAAGAPVVASDMPGYRDVARHGLDSVLVPPGDALALAEALRELALDPPRRERMALAARERAERFSWTHVAAEVADVYEQAIAAARANERRCEIASAIPAARSARVGALAXXXVASRVQRFALRHGFVPGDGLPRVPARRLASLEPPRPVRHRVLHTLSRAGLALSSLVGVMLALLALRKIGVERVIESLVASSPGLVAAGVGVMCASMFVRGIAWHAILRAAPTWRPARRRDALQGTFIGVLMSATLPARLGEPSRALIVARRLGRARETLPVVLGTMVSQTLLNLLALAILGGVMFSSVDFAGRHTGALLLVALSPLALLRSRRMGRALASVRAALVRVRAGLSVFRHPRQAALATAVQLSAWALQCASCYLLLMALGLSAGRHGQVGFGAAAAVLFAVNVTAVIPATPANVGVFQAACVAVLAGAYHVHTADALAYGIVLQAVEIATAVAMGAPALVNEGLSWRDVRLRTMHAAPVKLGPLPGGAARPASRSLEAR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.59
Nodule 0
Rhizoplane 18.1
Rhizosphere 71.12
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100009204 3300005329 Bacteria 8434
2 Ga0070683_100012940 3300005329 Bacteria 7263
3 Ga0070682_100029961 3300005337 Bacteria 3280
4 Ga0068868_100064540 3300005338 Bacteria 2907
5 Ga0070660_100002733 3300005339 Bacteria 12120
6 Ga0070661_100000032 3300005344 Bacteria 112964
7 Ga0070675_100000022 3300005354 Bacteria 146580
8 Ga0070688_100000031 3300005365 Bacteria 65288
9 Ga0070688_100011798 3300005365 Bacteria 4871
10 Ga0070659_100005558 3300005366 Bacteria 9058
11 Ga0070713_100000239 3300005436 Bacteria 36304
12 Ga0070713_100033372 3300005436 Bacteria 4122
13 Ga0070710_10032687 3300005437 Bacteria 2820
14 Ga0070678_100026492 3300005456 Bacteria 3921
15 Ga0070685_10004137 3300005466 Bacteria 7320
16 Ga0070684_100039016 3300005535 Bacteria 4084
17 Ga0070672_100000013 3300005543 Bacteria 75650
18 Ga0070665_100001252 3300005548 Bacteria 30657
19 Ga0070704_100044976 3300005549 Bacteria 3071
20 Ga0068856_100006809 3300005614 Bacteria 11185
21 Ga0068856_100074005 3300005614 Bacteria 3372
22 Ga0068852_100027758 3300005616 Bacteria 4619
23 Ga0068852_100035759 3300005616 Bacteria 4147
24 Ga0081455_10005529 3300005937 Bacteria 13841
25 Ga0081455_10041197 3300005937 Bacteria 4065
26 Ga0081538_10000999 3300005981 Bacteria 30090
27 Ga0081538_10002173 3300005981 Bacteria 19454
28 Ga0081538_10020706 3300005981 Bacteria 4830
29 Ga0081540_1000545 3300005983 Bacteria 36477
30 Ga0075365_10001786 3300006038 Bacteria 10030
31 Ga0075365_10012245 3300006038 Bacteria 5085
32 Ga0075365_10036675 3300006038 Bacteria 3178
33 Ga0075364_10013007 3300006051 Bacteria 5106
34 Ga0070712_100008010 3300006175 Bacteria 6627
35 Ga0070712_100012641 3300006175 Bacteria 5372
36 Ga0075428_100025218 3300006844 Bacteria 6580
37 Ga0075428_100054564 3300006844 Bacteria 4379
38 Ga0075430_100012387 3300006846 Bacteria 7254
39 Ga0075431_100000608 3300006847 Bacteria 30234
40 Ga0075435_100024000 3300007076 Bacteria 4726
41 Ga0105240_10008627 3300009093 Bacteria 14563
42 Ga0111539_10002937 3300009094 Bacteria 22601
43 Ga0111539_10117297 3300009094 Bacteria 3121
44 Ga0105245_10001783 3300009098 Bacteria 19591
45 Ga0105245_10010210 3300009098 Bacteria 8176
46 Ga0114129_10058873 3300009147 Bacteria 5373
47 Ga0105243_10072515 3300009148 Bacteria 2788
48 Ga0105249_10011785 3300009553 Bacteria 7686
49 Ga0105239_10011961 3300010375 Bacteria 9676
50 Ga0105239_10014651 3300010375 Bacteria 8694
51 Ga0157374_10029088 3300013296 Bacteria 4998
52 Ga0157378_10009334 3300013297 Bacteria 8545
53 Ga0157378_10019348 3300013297 Bacteria 5987
54 Ga0157372_10000239 3300013307 Bacteria 60707
55 Ga0157372_10058966 3300013307 Bacteria 4292
56 Ga0163163_10018151 3300014325 Bacteria 6578
57 Ga0163163_10101463 3300014325 Bacteria 2900
58 Ga0157380_10000039 3300014326 Bacteria 78322
59 Ga0213874_10000944 3300021377 Bacteria 5938
60 Ga0213876_10008305 3300021384 Bacteria 5617
61 Ga0213876_10027240 3300021384 Bacteria 3017
62 Ga0213875_10000183 3300021388 Bacteria 64140
63 Ga0207692_10022389 3300025898 Bacteria 2907
64 Ga0207688_10000917 3300025901 Bacteria 14887
65 Ga0207695_10020864 3300025913 Bacteria 7486
66 Ga0207693_10001402 3300025915 Bacteria 21377
67 Ga0207693_10006262 3300025915 Bacteria 9868
68 Ga0207657_10007658 3300025919 Bacteria 11049
69 Ga0207649_10000015 3300025920 Bacteria 245662
70 Ga0207659_10000030 3300025926 Bacteria 124433
71 Ga0207687_10005788 3300025927 Bacteria 8181
72 Ga0207687_10014919 3300025927 Bacteria 5089
73 Ga0207700_10000019 3300025928 Bacteria 183117
74 Ga0207706_10007186 3300025933 Bacteria 10302
75 Ga0207706_10056909 3300025933 Bacteria 3446
76 Ga0207691_10000095 3300025940 Bacteria 76860
77 Ga0207661_10000666 3300025944 Bacteria 22202
78 Ga0207661_10006470 3300025944 Bacteria 8281
79 Ga0207677_10026944 3300026023 Bacteria 3612
80 Ga0207678_10007770 3300026067 Bacteria 9474
81 Ga0207678_10100758 3300026067 Bacteria 2467
82 Ga0207708_10000223 3300026075 Bacteria 45098
83 Ga0207708_10078775 3300026075 Bacteria 2530
84 Ga0207702_10015467 3300026078 Bacteria 6319
85 Ga0207683_10042460 3300026121 Bacteria 3972
86 Ga0207698_10024393 3300026142 Bacteria 4245
87 Ga0207428_10021932 3300027907 Bacteria 5397
88 Ga0268266_10000428 3300028379 Bacteria 63292
89 Ga0265337_1003691 3300028556 Bacteria 6555
90 Ga0265326_10000212 3300028558 Bacteria 28661
91 Ga0265319_1000215 3300028563 Bacteria 43681
92 Ga0265318_10000398 3300028577 Bacteria 34001
93 Ga0265336_10000001 3300028666 Bacteria 916179
94 Ga0265338_10000532 3300028800 Bacteria 66760
95 Ga0265324_10003301 3300029957 Bacteria 7752
96 Ga0265320_10013682 3300031240 Bacteria 4654
97 Ga0265340_10000002 3300031247 Bacteria 711693
98 Ga0307413_10041747 3300031824 Bacteria 2689
99 Ga0307410_10004660 3300031852 Bacteria 7126
100 Ga0307409_100006812 3300031995 Bacteria 6761
101 Ga0307416_100004224 3300032002 Bacteria 8623
102 Ga0307415_100000462 3300032126 Bacteria 17530
103 Ga0307415_100005631 3300032126 Bacteria 6668
104 Ga0373933_0018499 3300035724 Bacteria 3919
105 Ga0395900_0001633 3300037418 Bacteria 26335
106 Ga0395898_0001181 3300037466 Bacteria 39826
107 Ga0395898_0015820 3300037466 Bacteria 7731
108 Ga0395898_0042537 3300037466 Bacteria 4481
109 Ga0436364_0085664 3300037853 Bacteria 18164
110 Ga0436364_0124396 3300037853 Bacteria 3876
111 Ga0436364_0343630 3300037853 Bacteria 43614
112 Ga0436364_0524411 3300037853 Bacteria 14062
113 Ga0436364_0833531 3300037853 Bacteria 5071
114 Ga0436364_0838495 3300037853 Bacteria 5234
115 Ga0436364_1499944 3300037853 Bacteria 4236
116 Ga0395901_0025860 3300038443 Bacteria 6028
117 Ga0436365_0533233 3300039437 Bacteria 16280
118 Ga0436365_0817074 3300039437 Bacteria 3023
119 Ga0436365_1343432 3300039437 Bacteria 8906
120 Ga0436365_1359140 3300039437 Bacteria 3983
121 Ga0436365_1396720 3300039437 Bacteria 4237
122 Ga0436365_1564749 3300039437 Bacteria 3016
123 Ga0436363_0518351 3300039450 Bacteria 21080
124 Ga0436362_0278356 3300039453 Bacteria 4021
125 Ga0436362_0742880 3300039453 Bacteria 4252
126 Ga0466969_0004848 3300044656 Bacteria 7164
127 Ga0466965_0018574 3300044683 Bacteria 3335
128 Ga0466961_0004156 3300044693 Bacteria 9042
129 Ga0466961_0005923 3300044693 Bacteria 7748
130 Ga0466963_0000090 3300044694 Bacteria 31845
131 Ga0466963_0003343 3300044694 Bacteria 9154
132 Ga0466957_0015362 3300044842 Bacteria 4472
133 Ga0466959_0006330 3300045049 Bacteria 8188
134 Ga0466959_0010383 3300045049 Bacteria 6654
135 Ga0466959_0028363 3300045049 Bacteria 4151
136 Ga0466958_0007545 3300045836 Bacteria 5987
137 Ga0466958_0008389 3300045836 Bacteria 5729
138 Ga0466967_0000362 3300045976 Bacteria 21086
139 Ga0466967_0068225 3300045976 Bacteria 3175
140 Ga0495629_0000489 3300046459 Bacteria 33145
141 Ga0495651_0050113 3300046462 Bacteria 3222
142 Ga0495664_0000044 3300046477 Bacteria 62991
143 Ga0495606_0000550 3300046507 Bacteria 60050
144 Ga0495608_0000042 3300046511 Bacteria 115906
145 Ga0495618_0000077 3300046514 Bacteria 69702
146 Ga0495630_0000027 3300046517 Bacteria 146589
147 Ga0495640_0049993 3300046533 Bacteria 2881
148 Ga0495645_0000050 3300046543 Bacteria 87415
149 Ga0495645_0001809 3300046543 Bacteria 14530
150 Ga0495588_0000180 3300046674 Bacteria 76700
151 Ga0495657_0000011 3300046675 Bacteria 207360
152 Ga0495657_0000040 3300046675 Bacteria 115899
153 Ga0495657_0050290 3300046675 Bacteria 2802
154 Ga0495647_0000129 3300046681 Bacteria 19359
155 Ga0495658_0010873 3300046683 Bacteria 4560
156 Ga0495613_0000324 3300046689 Bacteria 42895
157 Ga0495624_0000031 3300046690 Bacteria 91702
158 Ga0495604_0001400 3300047317 Bacteria 19762
159 Ga0495604_0008557 3300047317 Bacteria 8080
160 Ga0495676_0001442 3300047321 Bacteria 20517
161 Ga0495676_0012257 3300047321 Bacteria 7726
162 Ga0495680_0013483 3300047322 Bacteria 7130
163 Ga0495675_0000051 3300047444 Bacteria 80375
164 Ga0495684_0001131 3300047471 Bacteria 21483
165 Ga0495602_0000038 3300048088 Bacteria 130758
166 Ga0496100_0000028 3300048903 Bacteria 113912
167 Ga0496100_0000226 3300048903 Bacteria 30341
168 Ga0496100_0003294 3300048903 Bacteria 8401
169 Ga0496101_0000005 3300048904 Bacteria 331455
170 Ga0496101_0000492 3300048904 Bacteria 24919
171 Ga0496101_0001434 3300048904 Bacteria 14237
172 Ga0496102_0000040 3300048905 Bacteria 196737
173 Ga0496102_0004320 3300048905 Bacteria 12019
174 Ga0496103_0000707 3300048906 Bacteria 24728
175 Ga0496103_0042179 3300048906 Bacteria 2807
176 Ga0496104_0000070 3300048907 Bacteria 107129
177 Ga0496104_0011468 3300048907 Bacteria 7940
178 Ga0496104_0015158 3300048907 Bacteria 6976
179 Ga0496105_0003020 3300048908 Bacteria 12364
180 Ga0496105_0025539 3300048908 Bacteria 4809
181 Ga0496106_0000033 3300048909 Bacteria 131412
182 Ga0496107_0000004 3300048910 Bacteria 297680
183 Ga0496107_0017088 3300048910 Bacteria 5101
184 Ga0496108_0000042 3300048911 Bacteria 146397
185 Ga0496108_0003832 3300048911 Bacteria 12058
186 Ga0496108_0022507 3300048911 Bacteria 5182
187 Ga0496109_0000034 3300048912 Bacteria 160397
188 Ga0496109_0001876 3300048912 Bacteria 17420
189 Ga0496109_0004918 3300048912 Bacteria 11155
190 Ga0496109_0011075 3300048912 Bacteria 7733
191 Ga0496110_0000328 3300048913 Bacteria 31640
192 Ga0496110_0005177 3300048913 Bacteria 10198
193 Ga0496110_0022330 3300048913 Bacteria 5371
194 Ga0496110_0043517 3300048913 Bacteria 3921
195 Ga0496111_0000040 3300048914 Bacteria 51054
196 Ga0496111_0003680 3300048914 Bacteria 9525
197 Ga0496111_0004933 3300048914 Bacteria 8474
198 Ga0496112_0003107 3300048915 Bacteria 13621
199 Ga0496112_0020308 3300048915 Bacteria 6294
200 Ga0496112_0056402 3300048915 Bacteria 3866
201 Ga0496113_0000002 3300048916 Bacteria 220193
202 Ga0496113_0002753 3300048916 Bacteria 10332
203 Ga0496113_0020057 3300048916 Bacteria 4692
204 Ga0496115_0000005 3300048918 Bacteria 290756
205 Ga0496115_0000290 3300048918 Bacteria 43459
206 Ga0496115_0000320 3300048918 Bacteria 40940
207 Ga0496115_0017099 3300048918 Bacteria 5533
208 Ga0496121_0002509 3300048924 Bacteria 27896
209 Ga0501031_0015547 3300049568 Bacteria 4941
210 Ga0501036_0060869 3300049572 Bacteria 3197
211 Ga0501042_0019876 3300049578 Bacteria 4670
212 Ga0501046_0052200 3300049580 Bacteria 3222
213 Ga0501068_0027281 3300049584 Bacteria 3371
214 Ga0501070_0029882 3300049586 Bacteria 4565
215 Ga0501071_0076782 3300049587 Bacteria 2440
216 Ga0501079_0019548 3300049741 Bacteria 5174
217 nmdc:mga00v17_9751_c1 3300050491 Bacteria 5213
218 nmdc:mga0yw44_21504_c1 3300050492 Bacteria 3600
219 nmdc:mga05p37_104936_c1 3300050507 Bacteria 3477
220 nmdc:mga0qj67_9599_c1 3300050509 Bacteria 7213
221 nmdc:mga06r32_1012_c1 3300050510 Bacteria 25245
222 nmdc:mga06r32_39888_c1 3300050510 Bacteria 4457
223 nmdc:mga08y16_36985_c1 3300050511 Bacteria 5127
224 nmdc:mga0rr50_19372_c1 3300050513 Bacteria 4591
225 Ga0495601_0000019 3300053077 Bacteria 161673
226 Ga0495601_0001623 3300053077 Bacteria 12376
227 Ga0495612_0000034 3300053078 Bacteria 73096
228 Ga0495595_0000009 3300053084 Bacteria 193039
229 Ga0495595_0029363 3300053084 Bacteria 2460
230 Ga0495619_0000057 3300053085 Bacteria 93948
231 Ga0495619_0025498 3300053085 Bacteria 3797
232 Ga0501082_0006449 3300060353 Bacteria 10175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10100758 Ga0207678_101007581 548
2 3300006846 Ga0075430_100012387 Ga0075430_1000123877 608
3 3300009094 Ga0111539_10117297 Ga0111539_101172972 641
4 3300053077 Ga0495601_0001623 Ga0495601_0001623_2677_5031 641
5 3300026075 Ga0207708_10078775 Ga0207708_100787751 646
6 3300031240 Ga0265320_10013682 Ga0265320_100136823 651
7 3300048918 Ga0496115_0000290 Ga0496115_0000290_11399_13567 657
8 3300050509 nmdc:mga0qj67_9599_c1 nmdc:mga0qj67_9599_c1_2116_4452 657
9 3300048918 Ga0496115_0000320 Ga0496115_0000320_27422_29794 658
10 3300037853 Ga0436364_0124396 Ga0436364_0124396_1194_3545 663
11 3300031995 Ga0307409_100006812 Ga0307409_1000068122 666
12 3300031852 Ga0307410_10004660 Ga0307410_100046603 667
13 3300032002 Ga0307416_100004224 Ga0307416_1000042243 667
14 3300037853 Ga0436364_1499944 Ga0436364_1499944_1426_3765 667
15 3300005548 Ga0070665_100001252 Ga0070665_10000125226 670
16 3300013297 Ga0157378_10009334 Ga0157378_100093343 670
17 3300028379 Ga0268266_10000428 Ga0268266_1000042842 670
18 3300046689 Ga0495613_0000324 Ga0495613_0000324_33417_35531 670
19 3300053077 Ga0495601_0000019 Ga0495601_0000019_97817_99931 670
20 3300046477 Ga0495664_0000044 Ga0495664_0000044_44442_46913 672
21 3300046543 Ga0495645_0000050 Ga0495645_0000050_17281_19626 672
22 3300046514 Ga0495618_0000077 Ga0495618_0000077_16810_19155 675
23 3300005344 Ga0070661_100000032 Ga0070661_10000003268 676
24 3300025920 Ga0207649_10000015 Ga0207649_1000001536 676
25 3300046674 Ga0495588_0000180 Ga0495588_0000180_36806_38926 676
26 3300005981 Ga0081538_10020706 Ga0081538_100207063 677
27 3300039453 Ga0436362_0742880 Ga0436362_0742880_600_2774 677
28 3300048911 Ga0496108_0003832 Ga0496108_0003832_1100_3430 677
29 3300048912 Ga0496109_0001876 Ga0496109_0001876_11353_13683 677
30 3300048913 Ga0496110_0022330 Ga0496110_0022330_1088_3418 677
31 3300048914 Ga0496111_0003680 Ga0496111_0003680_4851_7181 677
32 3300048915 Ga0496112_0020308 Ga0496112_0020308_1097_3427 677
33 3300044694 Ga0466963_0003343 Ga0466963_0003343_2516_4876 678
34 3300005456 Ga0070678_100026492 Ga0070678_1000264921 681
35 3300026121 Ga0207683_10042460 Ga0207683_100424603 681
36 3300046459 Ga0495629_0000489 Ga0495629_0000489_6678_8813 681
37 3300046507 Ga0495606_0000550 Ga0495606_0000550_32715_34850 681
38 3300048913 Ga0496110_0043517 Ga0496110_0043517_722_2857 681
39 3300044656 Ga0466969_0004848 Ga0466969_0004848_1173_3521 682
40 3300045049 Ga0466959_0006330 Ga0466959_0006330_20_2368 682
41 3300025933 Ga0207706_10056909 Ga0207706_100569092 683
42 3300048924 Ga0496121_0002509 Ga0496121_0002509_12416_14755 685
43 3300037466 Ga0395898_0042537 Ga0395898_0042537_821_3127 686
44 3300006038 Ga0075365_10036675 Ga0075365_100366752 687
45 3300037466 Ga0395898_0015820 Ga0395898_0015820_3848_6154 687
46 3300050492 nmdc:mga0yw44_21504_c1 nmdc:mga0yw44_21504_c1_256_2547 687
47 3300047317 Ga0495604_0001400 Ga0495604_0001400_9648_12059 689
48 3300021388 Ga0213875_10000183 Ga0213875_1000018329 690
49 3300037853 Ga0436364_0343630 Ga0436364_0343630_2149_4488 690
50 3300046543 Ga0495645_0001809 Ga0495645_0001809_7789_10065 690
51 3300039437 Ga0436365_1343432 Ga0436365_1343432_3571_5949 691
52 3300044693 Ga0466961_0004156 Ga0466961_0004156_1960_4212 692
53 3300044693 Ga0466961_0005923 Ga0466961_0005923_1487_3853 692
54 3300045049 Ga0466959_0028363 Ga0466959_0028363_246_2612 692
55 3300045836 Ga0466958_0007545 Ga0466958_0007545_2023_4275 692
56 3300045836 Ga0466958_0008389 Ga0466958_0008389_2700_5066 692
57 3300044842 Ga0466957_0015362 Ga0466957_0015362_310_2667 693
58 3300005339 Ga0070660_100002733 Ga0070660_1000027338 694
59 3300025919 Ga0207657_10007658 Ga0207657_100076585 694
60 3300046675 Ga0495657_0000011 Ga0495657_0000011_124430_126952 694
61 3300048903 Ga0496100_0000226 Ga0496100_0000226_3448_5784 694
62 3300048904 Ga0496101_0000492 Ga0496101_0000492_9813_12149 694
63 3300014325 Ga0163163_10101463 Ga0163163_101014632 695
64 3300048912 Ga0496109_0004918 Ga0496109_0004918_1485_3791 695
65 3300048916 Ga0496113_0020057 Ga0496113_0020057_1521_3827 695
66 3300053078 Ga0495612_0000034 Ga0495612_0000034_17078_19456 696
67 3300048915 Ga0496112_0056402 Ga0496112_0056402_825_3134 697
68 3300045976 Ga0466967_0068225 Ga0466967_0068225_101_2461 699
69 3300005338 Ga0068868_100064540 Ga0068868_1000645402 700
70 3300005614 Ga0068856_100074005 Ga0068856_1000740052 700
71 3300005616 Ga0068852_100027758 Ga0068852_1000277582 700
72 3300009553 Ga0105249_10011785 Ga0105249_100117858 700
73 3300010375 Ga0105239_10011961 Ga0105239_100119614 700
74 3300013296 Ga0157374_10029088 Ga0157374_100290882 700
75 3300013307 Ga0157372_10058966 Ga0157372_100589662 700
76 3300014325 Ga0163163_10018151 Ga0163163_100181514 700
77 3300025901 Ga0207688_10000917 Ga0207688_100009174 700
78 3300025933 Ga0207706_10007186 Ga0207706_100071869 700
79 3300026067 Ga0207678_10007770 Ga0207678_100077702 700
80 3300026075 Ga0207708_10000223 Ga0207708_100002239 700
81 3300035724 Ga0373933_0018499 Ga0373933_0018499_1208_3544 700
82 3300048906 Ga0496103_0042179 Ga0496103_0042179_449_2755 700
83 3300048907 Ga0496104_0015158 Ga0496104_0015158_471_2777 700
84 3300048908 Ga0496105_0003020 Ga0496105_0003020_422_2728 700
85 3300048912 Ga0496109_0011075 Ga0496109_0011075_331_2637 700
86 3300048913 Ga0496110_0005177 Ga0496110_0005177_7770_10076 700
87 3300005937 Ga0081455_10005529 Ga0081455_1000552912 702
88 3300037853 Ga0436364_0838495 Ga0436364_0838495_2788_5121 702
89 3300049572 Ga0501036_0060869 Ga0501036_0060869_32_2371 702
90 3300049580 Ga0501046_0052200 Ga0501046_0052200_71_2410 702
91 3300049584 Ga0501068_0027281 Ga0501068_0027281_79_2418 702
92 3300049586 Ga0501070_0029882 Ga0501070_0029882_548_2887 702
93 3300049587 Ga0501071_0076782 Ga0501071_0076782_32_2371 702
94 3300049741 Ga0501079_0019548 Ga0501079_0019548_2581_4920 702
95 3300060353 Ga0501082_0006449 Ga0501082_0006449_431_2770 702
96 3300005983 Ga0081540_1000545 Ga0081540_100054510 705
97 3300048918 Ga0496115_0000005 Ga0496115_0000005_36739_39015 705
98 3300005549 Ga0070704_100044976 Ga0070704_1000449761 706
99 3300005981 Ga0081538_10002173 Ga0081538_100021738 706
100 3300032126 Ga0307415_100005631 Ga0307415_1000056316 706
101 3300005337 Ga0070682_100029961 Ga0070682_1000299612 707
102 3300009098 Ga0105245_10001783 Ga0105245_100017837 707
103 3300009148 Ga0105243_10072515 Ga0105243_100725152 707
104 3300010375 Ga0105239_10014651 Ga0105239_100146512 707
105 3300025915 Ga0207693_10006262 Ga0207693_100062622 707
106 3300047321 Ga0495676_0012257 Ga0495676_0012257_4717_7026 707
107 3300048903 Ga0496100_0003294 Ga0496100_0003294_2893_5202 707
108 3300048904 Ga0496101_0001434 Ga0496101_0001434_6932_9241 707
109 3300048905 Ga0496102_0004320 Ga0496102_0004320_4068_6377 707
110 3300048907 Ga0496104_0011468 Ga0496104_0011468_462_2771 707
111 3300048908 Ga0496105_0025539 Ga0496105_0025539_1935_4244 707
112 3300048910 Ga0496107_0017088 Ga0496107_0017088_415_2724 707
113 3300048911 Ga0496108_0022507 Ga0496108_0022507_1673_3982 707
114 3300048914 Ga0496111_0004933 Ga0496111_0004933_5641_7950 707
115 3300048916 Ga0496113_0002753 Ga0496113_0002753_7131_9440 707
116 3300048918 Ga0496115_0017099 Ga0496115_0017099_528_2837 707
117 3300005981 Ga0081538_10000999 Ga0081538_1000099931 708
118 3300006038 Ga0075365_10012245 Ga0075365_100122452 708
119 3300005437 Ga0070710_10032687 Ga0070710_100326871 709
120 3300006038 Ga0075365_10001786 Ga0075365_100017862 709
121 3300006051 Ga0075364_10013007 Ga0075364_100130072 709
122 3300006175 Ga0070712_100008010 Ga0070712_1000080102 709
123 3300006844 Ga0075428_100054564 Ga0075428_1000545641 709
124 3300006847 Ga0075431_100000608 Ga0075431_10000060822 709
125 3300007076 Ga0075435_100024000 Ga0075435_1000240002 709
126 3300009094 Ga0111539_10002937 Ga0111539_100029373 709
127 3300009098 Ga0105245_10010210 Ga0105245_100102103 709
128 3300009147 Ga0114129_10058873 Ga0114129_100588732 709
129 3300025898 Ga0207692_10022389 Ga0207692_100223892 709
130 3300025927 Ga0207687_10005788 Ga0207687_100057883 709
131 3300027907 Ga0207428_10021932 Ga0207428_100219322 709
132 3300032126 Ga0307415_100000462 Ga0307415_10000046210 709
133 3300038443 Ga0395901_0025860 Ga0395901_0025860_1515_3827 709
134 3300046462 Ga0495651_0050113 Ga0495651_0050113_304_2640 709
135 3300046533 Ga0495640_0049993 Ga0495640_0049993_427_2763 709
136 3300046675 Ga0495657_0050290 Ga0495657_0050290_47_2383 709
137 3300047322 Ga0495680_0013483 Ga0495680_0013483_2528_4864 709
138 3300049568 Ga0501031_0015547 Ga0501031_0015547_1369_3666 709
139 3300049578 Ga0501042_0019876 Ga0501042_0019876_249_2546 709
140 3300050491 nmdc:mga00v17_9751_c1 nmdc:mga00v17_9751_c1_1264_3570 709
141 3300050507 nmdc:mga05p37_104936_c1 nmdc:mga05p37_104936_c1_189_2501 709
142 3300050510 nmdc:mga06r32_1012_c1 nmdc:mga06r32_1012_c1_17100_19412 709
143 3300050511 nmdc:mga08y16_36985_c1 nmdc:mga08y16_36985_c1_2622_4934 709
144 3300050513 nmdc:mga0rr50_19372_c1 nmdc:mga0rr50_19372_c1_1260_3572 709
145 3300053084 Ga0495595_0029363 Ga0495595_0029363_71_2407 709
146 3300053085 Ga0495619_0025498 Ga0495619_0025498_54_2390 709
147 3300037853 Ga0436364_0085664 Ga0436364_0085664_12026_14371 710
148 3300039437 Ga0436365_0533233 Ga0436365_0533233_10008_12353 710
149 3300039437 Ga0436365_1396720 Ga0436365_1396720_1783_4143 710
150 3300031824 Ga0307413_10041747 Ga0307413_100417472 711
151 3300045049 Ga0466959_0010383 Ga0466959_0010383_1825_4197 711
152 3300009093 Ga0105240_10008627 Ga0105240_100086274 712
153 3300025913 Ga0207695_10020864 Ga0207695_100208648 712
154 3300005614 Ga0068856_100006809 Ga0068856_1000068097 713
155 3300026078 Ga0207702_10015467 Ga0207702_100154674 713
156 3300037418 Ga0395900_0001633 Ga0395900_0001633_6310_8667 713
157 3300037466 Ga0395898_0001181 Ga0395898_0001181_34946_37303 713
158 3300047317 Ga0495604_0008557 Ga0495604_0008557_3001_5280 714
159 3300048907 Ga0496104_0000070 Ga0496104_0000070_64358_66928 714
160 3300048913 Ga0496110_0000328 Ga0496110_0000328_19068_21638 714
161 3300048914 Ga0496111_0000040 Ga0496111_0000040_16284_18854 714
162 3300048915 Ga0496112_0003107 Ga0496112_0003107_2640_4919 714
163 3300048916 Ga0496113_0000002 Ga0496113_0000002_138752_141031 714
164 3300028556 Ga0265337_1003691 Ga0265337_10036911 716
165 3300028558 Ga0265326_10000212 Ga0265326_100002126 716
166 3300028563 Ga0265319_1000215 Ga0265319_100021526 716
167 3300028577 Ga0265318_10000398 Ga0265318_1000039822 716
168 3300028666 Ga0265336_10000001 Ga0265336_10000001212 716
169 3300028800 Ga0265338_10000532 Ga0265338_1000053258 716
170 3300029957 Ga0265324_10003301 Ga0265324_100033014 716
171 3300031247 Ga0265340_10000002 Ga0265340_10000002669 716
172 3300039437 Ga0436365_1359140 Ga0436365_1359140_60_2417 716
173 3300046511 Ga0495608_0000042 Ga0495608_0000042_55350_57629 716
174 3300046675 Ga0495657_0000040 Ga0495657_0000040_55350_57629 716
175 3300047321 Ga0495676_0001442 Ga0495676_0001442_14510_16783 716
176 3300047444 Ga0495675_0000051 Ga0495675_0000051_55322_57601 716
177 3300048903 Ga0496100_0000028 Ga0496100_0000028_20510_22783 716
178 3300048904 Ga0496101_0000005 Ga0496101_0000005_170509_172782 716
179 3300048909 Ga0496106_0000033 Ga0496106_0000033_120498_122771 716
180 3300048910 Ga0496107_0000004 Ga0496107_0000004_170726_172999 716
181 3300053084 Ga0495595_0000009 Ga0495595_0000009_135411_137690 716
182 3300053085 Ga0495619_0000057 Ga0495619_0000057_58270_60549 716
183 3300005937 Ga0081455_10041197 Ga0081455_100411972 717
184 3300039437 Ga0436365_1564749 Ga0436365_1564749_633_2990 717
185 3300044683 Ga0466965_0018574 Ga0466965_0018574_18_2366 717
186 3300044694 Ga0466963_0000090 Ga0466963_0000090_29409_31757 717
187 3300045976 Ga0466967_0000362 Ga0466967_0000362_17047_19395 717
188 3300006844 Ga0075428_100025218 Ga0075428_1000252182 718
189 3300025927 Ga0207687_10014919 Ga0207687_100149194 718
190 3300026023 Ga0207677_10026944 Ga0207677_100269444 718
191 3300050510 nmdc:mga06r32_39888_c1 nmdc:mga06r32_39888_c1_514_2826 718
192 3300021384 Ga0213876_10027240 Ga0213876_100272401 719
193 3300037853 Ga0436364_0524411 Ga0436364_0524411_928_3282 719
194 3300037853 Ga0436364_0833531 Ga0436364_0833531_554_2899 719
195 3300039437 Ga0436365_0817074 Ga0436365_0817074_87_2432 719
196 3300039453 Ga0436362_0278356 Ga0436362_0278356_657_3011 719
197 3300047471 Ga0495684_0001131 Ga0495684_0001131_10086_12476 719
198 3300048905 Ga0496102_0000040 Ga0496102_0000040_181930_184311 719
199 3300048906 Ga0496103_0000707 Ga0496103_0000707_12426_14807 719
200 3300021377 Ga0213874_10000944 Ga0213874_100009442 720
201 3300021384 Ga0213876_10008305 Ga0213876_100083052 720
202 3300039450 Ga0436363_0518351 Ga0436363_0518351_8301_10661 720
203 3300048088 Ga0495602_0000038 Ga0495602_0000038_108708_110987 720
204 3300005329 Ga0070683_100012940 Ga0070683_1000129403 723
205 3300005543 Ga0070672_100000013 Ga0070672_10000001347 723
206 3300006175 Ga0070712_100012641 Ga0070712_1000126413 723
207 3300025915 Ga0207693_10001402 Ga0207693_1000140220 723
208 3300025940 Ga0207691_10000095 Ga0207691_1000009537 723
209 3300025944 Ga0207661_10000666 Ga0207661_1000066621 723
210 3300046683 Ga0495658_0010873 Ga0495658_0010873_1207_3486 724
211 3300005329 Ga0070683_100009204 Ga0070683_1000092042 725
212 3300005354 Ga0070675_100000022 Ga0070675_10000002280 725
213 3300005365 Ga0070688_100000031 Ga0070688_10000003118 725
214 3300005365 Ga0070688_100011798 Ga0070688_1000117983 725
215 3300005366 Ga0070659_100005558 Ga0070659_1000055584 725
216 3300005436 Ga0070713_100000239 Ga0070713_10000023930 725
217 3300005436 Ga0070713_100033372 Ga0070713_1000333721 725
218 3300005466 Ga0070685_10004137 Ga0070685_100041373 725
219 3300005535 Ga0070684_100039016 Ga0070684_1000390162 725
220 3300005616 Ga0068852_100035759 Ga0068852_1000357593 725
221 3300013297 Ga0157378_10019348 Ga0157378_100193483 725
222 3300013307 Ga0157372_10000239 Ga0157372_1000023925 725
223 3300014326 Ga0157380_10000039 Ga0157380_1000003923 725
224 3300025926 Ga0207659_10000030 Ga0207659_1000003056 725
225 3300025928 Ga0207700_10000019 Ga0207700_1000001987 725
226 3300025944 Ga0207661_10006470 Ga0207661_100064703 725
227 3300026142 Ga0207698_10024393 Ga0207698_100243933 725
228 3300046517 Ga0495630_0000027 Ga0495630_0000027_42458_44725 725
229 3300046681 Ga0495647_0000129 Ga0495647_0000129_4200_6467 725
230 3300046690 Ga0495624_0000031 Ga0495624_0000031_38013_40280 725
231 3300048911 Ga0496108_0000042 Ga0496108_0000042_34187_36466 725
232 3300048912 Ga0496109_0000034 Ga0496109_0000034_66826_69105 725

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

219

374

0.95

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

14

190

0.92

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

474

768

0.91

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

223

360

0.89

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

240

389

0.81

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

15

187

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gek-assembly1.cif.gz_A crystal structure of phosphatidylinositol mannosyltransferase (pima) from mycobacterium smegmatis in complex with gdp 0.877 1 367
2bfw-assembly1.cif.gz_A structure of the c domain of glycogen synthase from pyrococcus abyssi 0.8634 182 344
4n9w-assembly1.cif.gz_A crystal structure of phosphatidyl mannosyltransferase pima 0.8599 2 359
6tpk-assembly1.cif.gz_A crystal structure of the human oxytocin receptor 0.8524 183 344
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8511 169 341
ID Description Score Start End Superfamily
af_Q9SSP6_536_651_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9224 235 342 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.922 189 341 3.40.50.2000
3okaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9203 187 341 3.40.50.2000
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9201 181 338 3.40.50.2000
af_Q58469_205_369_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9171 184 338 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A4Q3ND18-F1-model_v4 Glycosyltransferase 0.9695 261 360 GO:0016757
AF-A0A7C3T104-F1-model_v4 Glycosyltransferase 0.9368 217 362 GO:0016757
AF-A0A4R1BL41-F1-model_v4 Glycosyltransferase family 1 protein 0.931 3 360 GO:0009058
GO:0016758
AF-A0A1F2WFQ9-F1-model_v4 Glycosyltransferase family 1 protein 0.9188 2 361 GO:0009058
GO:0016757
AF-A0A3L7WY42-F1-model_v4 Glycosyltransferase family 1 protein 0.9185 184 358 GO:0016758

Feature Viewer

pLDDT pTM Quality
73.6 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map