F345541

General Info

Members Datasets Scaffolds Average Seq Length
232 135 232 187

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_120810_c1|nmdc:mga00v17_120810_c1_846_1502
Length 218
Sequence VRFEKPVRRTSPPTLAKPTPFSDGEGRAIIEGVFDLDEFVSECQQANAESEPRRAIREVLDRALVDASSIGDALKPGEGGITLLHHADDLTVLHAVWAPGMRLYPHNHEMWAAIGIYAGQEDNAFYRRRAPGDRFLTESGGKQLRTGDTVLLGDDTIHAVTNPLRSLTAAIHIYGGDFVNQPRSQWGPGPEEERPYDYDLVRQQFADANAAWRAEADA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
76 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.02
Nodule 0
Rhizoplane 6.9
Rhizosphere 87.93
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100196552 3300005329 Bacteria 1915
2 Ga0070680_100000279 3300005336 Bacteria 33924
3 Ga0068868_100260448 3300005338 Bacteria 1462
4 Ga0068868_101286084 3300005338 Unclassified 679
5 Ga0068868_101375448 3300005338 Bacteria 658
6 Ga0070667_100629358 3300005367 Bacteria 990
7 Ga0070700_100255607 3300005441 Bacteria 1259
8 Ga0070708_100003714 3300005445 Bacteria 11969
9 Ga0070708_100035685 3300005445 Bacteria 4333
10 Ga0070708_100288551 3300005445 Bacteria 1545
11 Ga0070708_100964380 3300005445 Unclassified 800
12 Ga0070681_10000009 3300005458 Bacteria 146582
13 Ga0070681_10023743 3300005458 Bacteria 6171
14 Ga0070681_10399992 3300005458 Bacteria 1285
15 Ga0070706_100005832 3300005467 Bacteria 11681
16 Ga0070707_100014536 3300005468 Bacteria 7380
17 Ga0070707_100101437 3300005468 Bacteria 2789
18 Ga0070698_100165878 3300005471 Bacteria 2152
19 Ga0070679_100000107 3300005530 Bacteria 65501
20 Ga0070697_100598308 3300005536 Unclassified 969
21 Ga0068853_100467816 3300005539 Bacteria 1187
22 Ga0070695_100043266 3300005545 Bacteria 2863
23 Ga0068856_100044234 3300005614 Bacteria 4382
24 Ga0068856_100779131 3300005614 Bacteria 976
25 Ga0068864_101071447 3300005618 Bacteria 801
26 Ga0068863_101100495 3300005841 Bacteria 799
27 Ga0068863_101299695 3300005841 Bacteria 734
28 Ga0068858_100953007 3300005842 Bacteria 840
29 Ga0068860_100690031 3300005843 Unclassified 1030
30 Ga0070717_10981712 3300006028 Unclassified 769
31 Ga0075365_10050227 3300006038 Bacteria 2751
32 Ga0075365_10104882 3300006038 Bacteria 1939
33 Ga0075364_10026348 3300006051 Bacteria 3708
34 Ga0070712_100130960 3300006175 Bacteria 1901
35 Ga0075367_10046358 3300006178 Bacteria 2554
36 Ga0075428_100000002 3300006844 Bacteria 546374
37 Ga0075428_100025327 3300006844 Bacteria 6566
38 Ga0075428_100217811 3300006844 Bacteria 2062
39 Ga0075428_100404800 3300006844 Bacteria 1462
40 Ga0075430_100083898 3300006846 Bacteria 2669
41 Ga0075431_100092933 3300006847 Bacteria 3114
42 Ga0075431_100168177 3300006847 Bacteria 2253
43 Ga0075431_100211212 3300006847 Bacteria 1982
44 Ga0075434_100220367 3300006871 Bacteria 1917
45 Ga0075434_100238186 3300006871 Bacteria 1840
46 Ga0075434_101636890 3300006871 Unclassified 652
47 Ga0075429_100282803 3300006880 Bacteria 1453
48 Ga0075435_100654227 3300007076 Bacteria 912
49 Ga0111539_10017154 3300009094 Bacteria 8963
50 Ga0111539_10529872 3300009094 Bacteria 1372
51 Ga0111539_10867051 3300009094 Bacteria 1050
52 Ga0105245_10005312 3300009098 Bacteria 11318
53 Ga0114129_10248010 3300009147 Bacteria 2391
54 Ga0114129_10856751 3300009147 Unclassified 1155
55 Ga0105243_10024785 3300009148 Bacteria 4579
56 Ga0105241_10108988 3300009174 Bacteria 2214
57 Ga0105242_10010935 3300009176 Bacteria 6971
58 Ga0105249_10665209 3300009553 Bacteria 1100
59 Ga0105239_10279994 3300010375 Bacteria 1877
60 Ga0105239_10796293 3300010375 Bacteria 1083
61 Ga0157370_10080927 3300013104 Bacteria 3058
62 Ga0157369_10071866 3300013105 Bacteria 3713
63 Ga0157379_10242120 3300014968 Bacteria 1636
64 Ga0163161_10526787 3300017792 Bacteria 966
65 Ga0213874_10016733 3300021377 Bacteria 1958
66 Ga0213876_10078444 3300021384 Bacteria 1745
67 Ga0207645_10139894 3300025907 Bacteria 1577
68 Ga0207684_10008038 3300025910 Bacteria 9419
69 Ga0207654_10343515 3300025911 Unclassified 1026
70 Ga0207707_10000396 3300025912 Bacteria 45547
71 Ga0207707_10012345 3300025912 Bacteria 7424
72 Ga0207707_10344415 3300025912 Bacteria 1285
73 Ga0207660_10000105 3300025917 Bacteria 47224
74 Ga0207652_10000118 3300025921 Bacteria 87541
75 Ga0207646_10016218 3300025922 Bacteria 6998
76 Ga0207646_10099584 3300025922 Bacteria 2605
77 Ga0207687_10052923 3300025927 Bacteria 2834
78 Ga0207687_10167502 3300025927 Bacteria 1692
79 Ga0207644_10282175 3300025931 Bacteria 1334
80 Ga0207644_10505022 3300025931 Bacteria 998
81 Ga0207686_10041821 3300025934 Bacteria 2797
82 Ga0207686_10350374 3300025934 Bacteria 1111
83 Ga0207709_10660638 3300025935 Bacteria 833
84 Ga0207704_10367316 3300025938 Bacteria 1125
85 Ga0207689_10373472 3300025942 Bacteria 1187
86 Ga0207661_10238922 3300025944 Bacteria 1611
87 Ga0207712_10574543 3300025961 Bacteria 972
88 Ga0207639_10372731 3300026041 Bacteria 1280
89 Ga0207708_10054729 3300026075 Bacteria 3042
90 Ga0207702_10647800 3300026078 Bacteria 1039
91 Ga0207641_10999543 3300026088 Bacteria 833
92 Ga0207428_10084908 3300027907 Bacteria 2466
93 Ga0207428_10211479 3300027907 Bacteria 1457
94 Ga0268264_10463397 3300028381 Bacteria 1230
95 Ga0316576_10316589 3300031727 Bacteria 1164
96 Ga0307410_10567844 3300031852 Bacteria 942
97 Ga0307416_100553391 3300032002 Bacteria 1224
98 Ga0373937_0586129 3300036401 Bacteria 1059
99 Ga0373925_0031576 3300037068 Bacteria 3893
100 Ga0436365_0431313 3300039437 Bacteria 1099
101 Ga0436365_1579874 3300039437 Bacteria 6196
102 Ga0436360_0330241 3300039438 Bacteria 641
103 Ga0436363_1203956 3300039450 Bacteria 2397
104 Ga0436362_0729919 3300039453 Bacteria 1794
105 Ga0436362_0865812 3300039453 Bacteria 2664
106 Ga0451791_0192888 3300041451 Bacteria 1117
107 Ga0439452_026924 3300042010 Bacteria 1448
108 Ga0466961_0036656 3300044693 Bacteria 3148
109 Ga0466961_0130671 3300044693 Bacteria 1574
110 Ga0466964_0100661 3300044706 Unclassified 1273
111 Ga0466971_0029414 3300044719 Bacteria 2457
112 Ga0466968_0158937 3300044735 Bacteria 1042
113 Ga0466957_0002722 3300044842 Bacteria 9558
114 Ga0466958_0012305 3300045836 Bacteria 4844
115 Ga0495624_0061641 3300046690 Bacteria 2349
116 Ga0495581_0147135 3300047315 Bacteria 1375
117 Ga0496100_0048819 3300048903 Bacteria 2734
118 Ga0496101_0053903 3300048904 Bacteria 2903
119 Ga0496102_0729500 3300048905 Bacteria 914
120 Ga0496104_0011723 3300048907 Bacteria 7863
121 Ga0496106_0186979 3300048909 Bacteria 1646
122 Ga0496108_0672610 3300048911 Bacteria 899
123 Ga0496109_0151390 3300048912 Bacteria 2172
124 Ga0496109_0442526 3300048912 Bacteria 1228
125 Ga0496109_0653813 3300048912 Bacteria 988
126 Ga0496110_0138048 3300048913 Bacteria 2204
127 Ga0496110_0655420 3300048913 Bacteria 950
128 Ga0496111_0069349 3300048914 Bacteria 2564
129 Ga0496114_0039772 3300048917 Bacteria 3892
130 Ga0496114_0458931 3300048917 Bacteria 1128
131 Ga0496115_0333754 3300048918 Bacteria 1238
132 Ga0501031_0029061 3300049568 Bacteria 3605
133 Ga0501031_0045626 3300049568 Bacteria 2860
134 Ga0501031_0090492 3300049568 Bacteria 1996
135 Ga0501031_0119169 3300049568 Unclassified 1724
136 Ga0501033_0052492 3300049570 Bacteria 3021
137 Ga0501033_0068083 3300049570 Bacteria 2618
138 Ga0501033_1004820 3300049570 Unclassified 557
139 Ga0501036_0008564 3300049572 Bacteria 8389
140 Ga0501036_0074869 3300049572 Bacteria 2864
141 Ga0501036_0193114 3300049572 Unclassified 1713
142 Ga0501037_0251177 3300049573 Bacteria 1238
143 Ga0501038_0116577 3300049574 Bacteria 2207
144 Ga0501039_0005221 3300049575 Bacteria 9835
145 Ga0501039_0009764 3300049575 Bacteria 7311
146 Ga0501039_0022701 3300049575 Bacteria 4815
147 Ga0501039_0175488 3300049575 Bacteria 1685
148 Ga0501040_0015352 3300049576 Bacteria 5064
149 Ga0501040_0021776 3300049576 Bacteria 4285
150 Ga0501040_0666324 3300049576 Bacteria 752
151 Ga0501041_0015065 3300049577 Bacteria 4592
152 Ga0501041_0201235 3300049577 Bacteria 1248
153 Ga0501042_0031148 3300049578 Bacteria 3774
154 Ga0501042_0062525 3300049578 Unclassified 2660
155 Ga0501042_0069895 3300049578 Bacteria 2511
156 Ga0501042_0231110 3300049578 Bacteria 1334
157 Ga0501043_0120221 3300049579 Bacteria 2060
158 Ga0501043_0475346 3300049579 Bacteria 936
159 Ga0501046_0110886 3300049580 Bacteria 2096
160 Ga0501046_0235969 3300049580 Unclassified 1350
161 Ga0501048_0012084 3300049582 Bacteria 6434
162 Ga0501068_0071110 3300049584 Bacteria 2124
163 Ga0501068_0202463 3300049584 Bacteria 1259
164 Ga0501071_0007079 3300049587 Bacteria 7328
165 Ga0501071_0008766 3300049587 Bacteria 6699
166 Ga0501071_0038246 3300049587 Bacteria 3428
167 Ga0501071_0045385 3300049587 Bacteria 3155
168 Ga0501071_0427340 3300049587 Bacteria 1013
169 Ga0501071_0620523 3300049587 Unclassified 831
170 Ga0501072_0003175 3300049588 Bacteria 12358
171 Ga0501072_0011389 3300049588 Bacteria 6797
172 Ga0501072_0019717 3300049588 Bacteria 5216
173 Ga0501072_0226621 3300049588 Bacteria 1489
174 Ga0501074_0082004 3300049590 Bacteria 2313
175 Ga0501074_0200460 3300049590 Bacteria 1422
176 Ga0501075_0005970 3300049591 Bacteria 8338
177 Ga0501075_0014561 3300049591 Bacteria 5638
178 Ga0501075_0071170 3300049591 Bacteria 2628
179 Ga0501075_0093252 3300049591 Bacteria 2286
180 Ga0501076_0060260 3300049592 Bacteria 3019
181 Ga0501076_0085792 3300049592 Bacteria 2530
182 Ga0501076_0297207 3300049592 Unclassified 1323
183 Ga0501076_0425051 3300049592 Bacteria 1093
184 Ga0501076_0615785 3300049592 Bacteria 896
185 Ga0501077_0000888 3300049593 Bacteria 17971
186 Ga0501077_0036713 3300049593 Bacteria 3122
187 Ga0501079_0059945 3300049741 Bacteria 2935
188 Ga0501079_0099422 3300049741 Bacteria 2254
189 Ga0501079_0306169 3300049741 Unclassified 1243
190 Ga0501081_0036210 3300049743 Bacteria 3364
191 Ga0501083_0099976 3300049744 Unclassified 1913
192 Ga0501035_0093954 3300049822 Bacteria 2638
193 Ga0501035_0268282 3300049822 Unclassified 1445
194 Ga0501035_0341693 3300049822 Bacteria 1254
195 Ga0501044_0468883 3300049823 Bacteria 1164
196 Ga0501044_1028502 3300049823 Bacteria 695
197 Ga0501045_0001378 3300049824 Bacteria 16195
198 Ga0501045_0037014 3300049824 Bacteria 3546
199 Ga0501045_0056703 3300049824 Bacteria 2866
200 Ga0501045_0076087 3300049824 Bacteria 2473
201 Ga0501045_0680863 3300049824 Bacteria 759
202 nmdc:mga00v17_120810_c1 3300050491 Bacteria 1668
203 nmdc:mga0yw44_52919_c1 3300050492 Bacteria 2463
204 nmdc:mga0yw44_771093_c1 3300050492 Bacteria 653
205 nmdc:mga05p37_31336_c1 3300050507 Bacteria 6495
206 nmdc:mga05p37_35389_c1 3300050507 Bacteria 6122
207 nmdc:mga09592_585864_c1 3300050508 Bacteria 956
208 nmdc:mga0qj67_246711_c1 3300050509 Bacteria 1449
209 nmdc:mga06r32_14563_c1 3300050510 Bacteria 7140
210 nmdc:mga06r32_296414_c1 3300050510 Bacteria 1603
211 nmdc:mga06r32_328041_c1 3300050510 Bacteria 1516
212 nmdc:mga08y16_176326_c1 3300050511 Bacteria 2220
213 nmdc:mga08y16_37553_c1 3300050511 Bacteria 5086
214 nmdc:mga08y16_80049_c1 3300050511 Bacteria 3406
215 nmdc:mga0n895_200404_c1 3300050512 Bacteria 2027
216 nmdc:mga08x19_77992_c1 3300050514 Unclassified 2170
217 nmdc:mga0a205_728191_c1 3300050515 Unclassified 841
218 Ga0495595_0019363 3300053084 Bacteria 2953
219 Ga0501084_0094544 3300054114 Bacteria 2509
220 Ga0501082_0072331 3300060353 Bacteria 2970
221 Ga0501082_0112758 3300060353 Bacteria 2354
222 Ga0501082_0314216 3300060353 Bacteria 1364
223 Ga0501082_0635081 3300060353 Unclassified 934
224 Ga0501082_0713571 3300060353 Bacteria 878
225 Ga0501082_0879363 3300060353 Bacteria 784
226 Ga0501082_0904724 3300060353 Bacteria 772
227 Ga0466962_0010516 3300061719 Bacteria 4451
228 Ga0530510_0039874 3300061734 Bacteria 3389
229 Ga0530510_0058612 3300061734 Bacteria 2784
230 Ga0530510_0214650 3300061734 Bacteria 1429
231 Ga0530510_0341655 3300061734 Unclassified 1124
232 Ga0530510_0798746 3300061734 Bacteria 720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_1004820 Ga0501033_1004820_82_546 153
2 3300026075 Ga0207708_10054729 Ga0207708_100547292 163
3 3300060353 Ga0501082_0904724 Ga0501082_0904724_108_701 173
4 3300044735 Ga0466968_0158937 Ga0466968_0158937_478_1023 178
5 3300005468 Ga0070707_100101437 Ga0070707_1001014373 179
6 3300006178 Ga0075367_10046358 Ga0075367_100463581 179
7 3300009174 Ga0105241_10108988 Ga0105241_101089882 179
8 3300010375 Ga0105239_10279994 Ga0105239_102799942 179
9 3300025911 Ga0207654_10343515 Ga0207654_103435152 179
10 3300025927 Ga0207687_10167502 Ga0207687_101675022 179
11 3300025934 Ga0207686_10350374 Ga0207686_103503742 179
12 3300049568 Ga0501031_0045626 Ga0501031_0045626_348_890 179
13 3300049572 Ga0501036_0074869 Ga0501036_0074869_2244_2786 179
14 3300049575 Ga0501039_0022701 Ga0501039_0022701_3970_4512 179
15 3300049578 Ga0501042_0231110 Ga0501042_0231110_188_730 179
16 3300049580 Ga0501046_0235969 Ga0501046_0235969_299_841 179
17 3300049587 Ga0501071_0038246 Ga0501071_0038246_1651_2193 179
18 3300049588 Ga0501072_0011389 Ga0501072_0011389_1237_1779 179
19 3300049590 Ga0501074_0082004 Ga0501074_0082004_299_841 179
20 3300049591 Ga0501075_0014561 Ga0501075_0014561_1614_2156 179
21 3300049592 Ga0501076_0297207 Ga0501076_0297207_629_1171 179
22 3300049741 Ga0501079_0306169 Ga0501079_0306169_392_934 179
23 3300049822 Ga0501035_0341693 Ga0501035_0341693_642_1184 179
24 3300049824 Ga0501045_0056703 Ga0501045_0056703_1352_1894 179
25 3300060353 Ga0501082_0072331 Ga0501082_0072331_1997_2539 179
26 3300061734 Ga0530510_0039874 Ga0530510_0039874_999_1541 179
27 3300006175 Ga0070712_100130960 Ga0070712_1001309602 180
28 3300007076 Ga0075435_100654227 Ga0075435_1006542272 180
29 3300027907 Ga0207428_10211479 Ga0207428_102114793 180
30 3300028381 Ga0268264_10463397 Ga0268264_104633971 180
31 3300031727 Ga0316576_10316589 Ga0316576_103165892 180
32 3300036401 Ga0373937_0586129 Ga0373937_0586129_37_582 180
33 3300048903 Ga0496100_0048819 Ga0496100_0048819_1373_1921 180
34 3300048904 Ga0496101_0053903 Ga0496101_0053903_1411_1959 180
35 3300048907 Ga0496104_0011723 Ga0496104_0011723_4956_5504 180
36 3300048909 Ga0496106_0186979 Ga0496106_0186979_87_635 180
37 3300048912 Ga0496109_0442526 Ga0496109_0442526_624_1172 180
38 3300048917 Ga0496114_0039772 Ga0496114_0039772_2423_2971 180
39 3300048918 Ga0496115_0333754 Ga0496115_0333754_183_731 180
40 3300050511 nmdc:mga08y16_80049_c1 nmdc:mga08y16_80049_c1_1485_2072 180
41 3300053084 Ga0495595_0019363 Ga0495595_0019363_2287_2832 180
42 3300005338 Ga0068868_101375448 Ga0068868_1013754481 181
43 3300031852 Ga0307410_10567844 Ga0307410_105678441 181
44 3300032002 Ga0307416_100553391 Ga0307416_1005533912 181
45 3300039437 Ga0436365_0431313 Ga0436365_0431313_200_841 181
46 3300039453 Ga0436362_0729919 Ga0436362_0729919_317_871 181
47 3300041451 Ga0451791_0192888 Ga0451791_0192888_16_570 181
48 3300042010 Ga0439452_026924 Ga0439452_026924_553_1101 181
49 3300005338 Ga0068868_101286084 Ga0068868_1012860841 182
50 3300005367 Ga0070667_100629358 Ga0070667_1006293581 182
51 3300005618 Ga0068864_101071447 Ga0068864_1010714471 182
52 3300005841 Ga0068863_101100495 Ga0068863_1011004952 182
53 3300005841 Ga0068863_101299695 Ga0068863_1012996951 182
54 3300005843 Ga0068860_100690031 Ga0068860_1006900312 182
55 3300006038 Ga0075365_10050227 Ga0075365_100502272 182
56 3300006844 Ga0075428_100000002 Ga0075428_100000002176 182
57 3300025931 Ga0207644_10282175 Ga0207644_102821752 182
58 3300026088 Ga0207641_10999543 Ga0207641_109995431 182
59 3300037068 Ga0373925_0031576 Ga0373925_0031576_3062_3625 182
60 3300046690 Ga0495624_0061641 Ga0495624_0061641_1193_1756 182
61 3300047315 Ga0495581_0147135 Ga0495581_0147135_642_1205 182
62 3300050492 nmdc:mga0yw44_52919_c1 nmdc:mga0yw44_52919_c1_1734_2300 182
63 3300005545 Ga0070695_100043266 Ga0070695_1000432662 183
64 3300006051 Ga0075364_10026348 Ga0075364_100263486 183
65 3300006871 Ga0075434_100220367 Ga0075434_1002203672 183
66 3300009094 Ga0111539_10867051 Ga0111539_108670512 183
67 3300009098 Ga0105245_10005312 Ga0105245_1000531210 183
68 3300009148 Ga0105243_10024785 Ga0105243_100247856 183
69 3300009176 Ga0105242_10010935 Ga0105242_100109353 183
70 3300009553 Ga0105249_10665209 Ga0105249_106652092 183
71 3300010375 Ga0105239_10796293 Ga0105239_107962932 183
72 3300025907 Ga0207645_10139894 Ga0207645_101398943 183
73 3300025922 Ga0207646_10099584 Ga0207646_100995842 183
74 3300025927 Ga0207687_10052923 Ga0207687_100529232 183
75 3300025934 Ga0207686_10041821 Ga0207686_100418213 183
76 3300025935 Ga0207709_10660638 Ga0207709_106606382 183
77 3300025938 Ga0207704_10367316 Ga0207704_103673162 183
78 3300025942 Ga0207689_10373472 Ga0207689_103734722 183
79 3300025961 Ga0207712_10574543 Ga0207712_105745431 183
80 3300048912 Ga0496109_0151390 Ga0496109_0151390_1265_1825 183
81 3300048913 Ga0496110_0655420 Ga0496110_0655420_344_904 183
82 3300049568 Ga0501031_0119169 Ga0501031_0119169_498_1058 183
83 3300049572 Ga0501036_0193114 Ga0501036_0193114_1138_1698 183
84 3300049576 Ga0501040_0666324 Ga0501040_0666324_140_700 183
85 3300049578 Ga0501042_0062525 Ga0501042_0062525_809_1369 183
86 3300049580 Ga0501046_0110886 Ga0501046_0110886_1522_2076 183
87 3300049587 Ga0501071_0045385 Ga0501071_0045385_1472_2032 183
88 3300049587 Ga0501071_0427340 Ga0501071_0427340_431_994 183
89 3300049591 Ga0501075_0093252 Ga0501075_0093252_1383_1943 183
90 3300049592 Ga0501076_0425051 Ga0501076_0425051_90_650 183
91 3300049823 Ga0501044_0468883 Ga0501044_0468883_439_999 183
92 3300049824 Ga0501045_0680863 Ga0501045_0680863_93_653 183
93 3300050491 nmdc:mga00v17_120810_c1 nmdc:mga00v17_120810_c1_846_1502 183
94 3300050512 nmdc:mga0n895_200404_c1 nmdc:mga0n895_200404_c1_694_1254 183
95 3300060353 Ga0501082_0713571 Ga0501082_0713571_178_747 183
96 3300061734 Ga0530510_0798746 Ga0530510_0798746_21_581 183
97 3300005441 Ga0070700_100255607 Ga0070700_1002556073 184
98 3300005458 Ga0070681_10023743 Ga0070681_100237434 184
99 3300006038 Ga0075365_10104882 Ga0075365_101048823 184
100 3300006844 Ga0075428_100025327 Ga0075428_1000253274 184
101 3300006844 Ga0075428_100217811 Ga0075428_1002178112 184
102 3300006844 Ga0075428_100404800 Ga0075428_1004048002 184
103 3300006847 Ga0075431_100168177 Ga0075431_1001681774 184
104 3300006847 Ga0075431_100211212 Ga0075431_1002112124 184
105 3300006880 Ga0075429_100282803 Ga0075429_1002828032 184
106 3300009094 Ga0111539_10017154 Ga0111539_100171545 184
107 3300009094 Ga0111539_10529872 Ga0111539_105298721 184
108 3300009147 Ga0114129_10248010 Ga0114129_102480103 184
109 3300014968 Ga0157379_10242120 Ga0157379_102421202 184
110 3300025912 Ga0207707_10012345 Ga0207707_100123454 184
111 3300025931 Ga0207644_10505022 Ga0207644_105050222 184
112 3300027907 Ga0207428_10084908 Ga0207428_100849085 184
113 3300048911 Ga0496108_0672610 Ga0496108_0672610_192_770 184
114 3300048912 Ga0496109_0653813 Ga0496109_0653813_252_830 184
115 3300048913 Ga0496110_0138048 Ga0496110_0138048_661_1239 184
116 3300048914 Ga0496111_0069349 Ga0496111_0069349_836_1414 184
117 3300049568 Ga0501031_0029061 Ga0501031_0029061_175_738 184
118 3300049570 Ga0501033_0052492 Ga0501033_0052492_984_1547 184
119 3300049570 Ga0501033_0068083 Ga0501033_0068083_1351_1923 184
120 3300049572 Ga0501036_0008564 Ga0501036_0008564_4078_4641 184
121 3300049573 Ga0501037_0251177 Ga0501037_0251177_111_683 184
122 3300049574 Ga0501038_0116577 Ga0501038_0116577_228_800 184
123 3300049575 Ga0501039_0005221 Ga0501039_0005221_5031_5603 184
124 3300049575 Ga0501039_0009764 Ga0501039_0009764_1346_1909 184
125 3300049576 Ga0501040_0015352 Ga0501040_0015352_634_1206 184
126 3300049576 Ga0501040_0021776 Ga0501040_0021776_2149_2712 184
127 3300049577 Ga0501041_0201235 Ga0501041_0201235_176_739 184
128 3300049578 Ga0501042_0031148 Ga0501042_0031148_2507_3070 184
129 3300049578 Ga0501042_0069895 Ga0501042_0069895_539_1111 184
130 3300049579 Ga0501043_0120221 Ga0501043_0120221_957_1529 184
131 3300049579 Ga0501043_0475346 Ga0501043_0475346_233_796 184
132 3300049582 Ga0501048_0012084 Ga0501048_0012084_5230_5802 184
133 3300049584 Ga0501068_0071110 Ga0501068_0071110_961_1533 184
134 3300049584 Ga0501068_0202463 Ga0501068_0202463_682_1245 184
135 3300049587 Ga0501071_0007079 Ga0501071_0007079_5900_6472 184
136 3300049587 Ga0501071_0008766 Ga0501071_0008766_459_1022 184
137 3300049588 Ga0501072_0003175 Ga0501072_0003175_9831_10394 184
138 3300049588 Ga0501072_0019717 Ga0501072_0019717_1419_1991 184
139 3300049590 Ga0501074_0200460 Ga0501074_0200460_75_647 184
140 3300049591 Ga0501075_0005970 Ga0501075_0005970_1501_2073 184
141 3300049591 Ga0501075_0071170 Ga0501075_0071170_1598_2161 184
142 3300049592 Ga0501076_0060260 Ga0501076_0060260_2376_2948 184
143 3300049593 Ga0501077_0000888 Ga0501077_0000888_677_1249 184
144 3300049593 Ga0501077_0036713 Ga0501077_0036713_1801_2364 184
145 3300049741 Ga0501079_0059945 Ga0501079_0059945_1584_2147 184
146 3300049741 Ga0501079_0099422 Ga0501079_0099422_259_831 184
147 3300049743 Ga0501081_0036210 Ga0501081_0036210_2237_2800 184
148 3300049744 Ga0501083_0099976 Ga0501083_0099976_24_587 184
149 3300049822 Ga0501035_0093954 Ga0501035_0093954_730_1302 184
150 3300049822 Ga0501035_0268282 Ga0501035_0268282_828_1391 184
151 3300049823 Ga0501044_1028502 Ga0501044_1028502_47_619 184
152 3300049824 Ga0501045_0001378 Ga0501045_0001378_10692_11264 184
153 3300049824 Ga0501045_0037014 Ga0501045_0037014_1386_1949 184
154 3300050492 nmdc:mga0yw44_771093_c1 nmdc:mga0yw44_771093_c1_20_583 184
155 3300050507 nmdc:mga05p37_31336_c1 nmdc:mga05p37_31336_c1_1458_2027 184
156 3300050507 nmdc:mga05p37_35389_c1 nmdc:mga05p37_35389_c1_2555_3148 184
157 3300050508 nmdc:mga09592_585864_c1 nmdc:mga09592_585864_c1_123_692 184
158 3300050509 nmdc:mga0qj67_246711_c1 nmdc:mga0qj67_246711_c1_184_753 184
159 3300050510 nmdc:mga06r32_14563_c1 nmdc:mga06r32_14563_c1_163_732 184
160 3300050510 nmdc:mga06r32_328041_c1 nmdc:mga06r32_328041_c1_785_1354 184
161 3300050511 nmdc:mga08y16_176326_c1 nmdc:mga08y16_176326_c1_1429_1998 184
162 3300050511 nmdc:mga08y16_37553_c1 nmdc:mga08y16_37553_c1_421_987 184
163 3300054114 Ga0501084_0094544 Ga0501084_0094544_376_939 184
164 3300060353 Ga0501082_0112758 Ga0501082_0112758_1502_2074 184
165 3300060353 Ga0501082_0314216 Ga0501082_0314216_400_963 184
166 3300061734 Ga0530510_0058612 Ga0530510_0058612_1501_2073 184
167 3300061734 Ga0530510_0214650 Ga0530510_0214650_694_1257 184
168 3300005338 Ga0068868_100260448 Ga0068868_1002604482 185
169 3300005842 Ga0068858_100953007 Ga0068858_1009530072 185
170 3300006846 Ga0075430_100083898 Ga0075430_1000838983 185
171 3300006847 Ga0075431_100092933 Ga0075431_1000929333 185
172 3300017792 Ga0163161_10526787 Ga0163161_105267872 185
173 3300021384 Ga0213876_10078444 Ga0213876_100784442 185
174 3300039437 Ga0436365_1579874 Ga0436365_1579874_2577_3143 185
175 3300039453 Ga0436362_0865812 Ga0436362_0865812_250_816 185
176 3300048905 Ga0496102_0729500 Ga0496102_0729500_66_626 185
177 3300048917 Ga0496114_0458931 Ga0496114_0458931_41_601 185
178 3300050510 nmdc:mga06r32_296414_c1 nmdc:mga06r32_296414_c1_1019_1585 185
179 3300005458 Ga0070681_10399992 Ga0070681_103999922 186
180 3300005539 Ga0068853_100467816 Ga0068853_1004678162 186
181 3300005614 Ga0068856_100044234 Ga0068856_1000442343 186
182 3300005614 Ga0068856_100779131 Ga0068856_1007791311 186
183 3300013105 Ga0157369_10071866 Ga0157369_100718664 186
184 3300025912 Ga0207707_10344415 Ga0207707_103444152 186
185 3300026041 Ga0207639_10372731 Ga0207639_103727312 186
186 3300026078 Ga0207702_10647800 Ga0207702_106478001 186
187 3300005329 Ga0070683_100196552 Ga0070683_1001965522 190
188 3300005336 Ga0070680_100000279 Ga0070680_10000027928 190
189 3300005445 Ga0070708_100003714 Ga0070708_1000037145 190
190 3300005445 Ga0070708_100035685 Ga0070708_1000356854 190
191 3300005445 Ga0070708_100288551 Ga0070708_1002885512 190
192 3300005445 Ga0070708_100964380 Ga0070708_1009643801 190
193 3300005458 Ga0070681_10000009 Ga0070681_10000009103 190
194 3300005467 Ga0070706_100005832 Ga0070706_10000583212 190
195 3300005468 Ga0070707_100014536 Ga0070707_1000145363 190
196 3300005471 Ga0070698_100165878 Ga0070698_1001658782 190
197 3300005530 Ga0070679_100000107 Ga0070679_10000010731 190
198 3300005536 Ga0070697_100598308 Ga0070697_1005983082 190
199 3300006028 Ga0070717_10981712 Ga0070717_109817121 190
200 3300006871 Ga0075434_100238186 Ga0075434_1002381862 190
201 3300006871 Ga0075434_101636890 Ga0075434_1016368901 190
202 3300009147 Ga0114129_10856751 Ga0114129_108567512 190
203 3300013104 Ga0157370_10080927 Ga0157370_100809272 190
204 3300021377 Ga0213874_10016733 Ga0213874_100167333 190
205 3300025910 Ga0207684_10008038 Ga0207684_100080382 190
206 3300025912 Ga0207707_10000396 Ga0207707_1000039615 190
207 3300025917 Ga0207660_10000105 Ga0207660_1000010533 190
208 3300025921 Ga0207652_10000118 Ga0207652_1000011848 190
209 3300025922 Ga0207646_10016218 Ga0207646_100162184 190
210 3300025944 Ga0207661_10238922 Ga0207661_102389222 190
211 3300039438 Ga0436360_0330241 Ga0436360_0330241_20_592 190
212 3300039450 Ga0436363_1203956 Ga0436363_1203956_502_1080 190
213 3300044693 Ga0466961_0036656 Ga0466961_0036656_1021_1596 190
214 3300044693 Ga0466961_0130671 Ga0466961_0130671_808_1380 190
215 3300044706 Ga0466964_0100661 Ga0466964_0100661_472_1044 190
216 3300044719 Ga0466971_0029414 Ga0466971_0029414_571_1146 190
217 3300044842 Ga0466957_0002722 Ga0466957_0002722_368_943 190
218 3300045836 Ga0466958_0012305 Ga0466958_0012305_1235_1810 190
219 3300049568 Ga0501031_0090492 Ga0501031_0090492_164_739 190
220 3300049575 Ga0501039_0175488 Ga0501039_0175488_1068_1643 190
221 3300049577 Ga0501041_0015065 Ga0501041_0015065_3790_4365 190
222 3300049587 Ga0501071_0620523 Ga0501071_0620523_130_705 190
223 3300049588 Ga0501072_0226621 Ga0501072_0226621_668_1243 190
224 3300049592 Ga0501076_0085792 Ga0501076_0085792_875_1450 190
225 3300049592 Ga0501076_0615785 Ga0501076_0615785_198_773 190
226 3300049824 Ga0501045_0076087 Ga0501045_0076087_1450_2025 190
227 3300050514 nmdc:mga08x19_77992_c1 nmdc:mga08x19_77992_c1_1246_1821 190
228 3300050515 nmdc:mga0a205_728191_c1 nmdc:mga0a205_728191_c1_68_640 190
229 3300060353 Ga0501082_0635081 Ga0501082_0635081_29_604 190
230 3300060353 Ga0501082_0879363 Ga0501082_0879363_147_722 190
231 3300061719 Ga0466962_0010516 Ga0466962_0010516_1985_2560 190
232 3300061734 Ga0530510_0341655 Ga0530510_0341655_348_923 190

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9134 57 140
4qma-assembly1.cif.gz_A crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076 0.8924 4 161
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.891 49 142
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8878 49 142
6v7l-assembly1.cif.gz_C the structure of the p212121 crystal form of canavalin at 173 k 0.8874 57 141
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9474 48 139 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9384 48 140 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 48 140 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8977 48 140 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8962 47 146 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3N5KMR7-F1-model_v4 Cysteine dioxygenase 0.9851 1 179
AF-A0A451BLV3-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9814 1 175
AF-A0A6L7TRV1-F1-model_v4 Cysteine dioxygenase 0.9794 1 182
AF-A0A1G7C9S7-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.9752 3 180
AF-A0A450RWB1-F1-model_v4 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily 0.975 1 177

Feature Viewer

pLDDT pTM Quality
94.41 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map