F345883

General Info

Members Datasets Scaffolds Average Seq Length
233 170 466 274

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100019645|Ga0070693_1000196452
Length 324
Sequence MDAFPRSNNSNITKLIVSAVGAISSEAWDFAKGLIKMGNCGVIGSSGKESPMTGQIEKGCVFRKLHERDRAFIIPNPWDIGTARLLANLGFEALATTSAGYAFSIGQRDNTVGRERMIAHVREMTAATDLPVSADLENGFGDDPETAAETIRLGAEAGLVGGSIEDSTTTRDDPIYDIQHAAERVRAAAETAHSLNFKFTLTARAENYLFGRRDLNDTIKRLQAYQEAGADVLYAPGLASKDDIASVISSLDRPVNVLMGLAGVKLTLSELSEIGVKRVSVGSVLSRVALSAFLRAAEEMRDHGTFTFADDIVSFGDISAMFPR

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
167 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
168 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
169 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
170 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0.43
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 9.44
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100019645 3300005547 Bacteria 3547
2 Ga0065704_10103734 3300005289 Unclassified 2163
3 Ga0065715_10369676 3300005293 Unclassified 923
4 Ga0070670_100108824 3300005331 Bacteria 2388
5 Ga0068869_100027492 3300005334 Bacteria 3966
6 Ga0068869_100091656 3300005334 Bacteria 2286
7 Ga0068869_100170258 3300005334 Bacteria 1701
8 Ga0070682_100109194 3300005337 Bacteria 1841
9 Ga0070660_100102305 3300005339 Unclassified 2271
10 Ga0070661_100223418 3300005344 Unclassified 1445
11 Ga0070692_10098353 3300005345 Bacteria 1600
12 Ga0070659_100152728 3300005366 Unclassified 1884
13 Ga0070659_100448251 3300005366 Unclassified 1094
14 Ga0070667_100291245 3300005367 Unclassified 1468
15 Ga0070703_10000985 3300005406 Bacteria 8970
16 Ga0070709_10000145 3300005434 Bacteria 47402
17 Ga0070713_100204778 3300005436 Bacteria 1784
18 Ga0070711_100000372 3300005439 Bacteria 23211
19 Ga0070705_100020985 3300005440 Bacteria 3467
20 Ga0070705_100096716 3300005440 Bacteria 1854
21 Ga0070694_100036921 3300005444 Bacteria 3238
22 Ga0070694_100078215 3300005444 Bacteria 2294
23 Ga0070694_100126772 3300005444 Bacteria 1838
24 Ga0070708_100155141 3300005445 Bacteria 2131
25 Ga0070662_100092663 3300005457 Bacteria 2271
26 Ga0070681_10162847 3300005458 Bacteria 2154
27 Ga0070706_100013182 3300005467 Bacteria 7648
28 Ga0070698_100305113 3300005471 Unclassified 1523
29 Ga0070699_100000135 3300005518 Bacteria 68724
30 Ga0068853_100014855 3300005539 Bacteria 6394
31 Ga0068853_100149206 3300005539 Bacteria 2103
32 Ga0070686_100269556 3300005544 Bacteria 1251
33 Ga0070695_100196575 3300005545 Bacteria 1438
34 Ga0070695_100425312 3300005545 Unclassified 1012
35 Ga0070696_100000042 3300005546 Bacteria 57704
36 Ga0070696_100099387 3300005546 Bacteria 2082
37 Ga0070693_100032671 3300005547 Bacteria 2864
38 Ga0070665_100023169 3300005548 Bacteria 6254
39 Ga0070704_100051619 3300005549 Bacteria 2897
40 Ga0070704_100060669 3300005549 Bacteria 2703
41 Ga0070704_100202194 3300005549 Bacteria 1604
42 Ga0070704_100341452 3300005549 Bacteria 1261
43 Ga0068855_100033088 3300005563 Bacteria 6173
44 Ga0070702_100036825 3300005615 Bacteria 2713
45 Ga0068852_100176234 3300005616 Bacteria 2008
46 Ga0068859_100313680 3300005617 Bacteria 1662
47 Ga0068859_100373960 3300005617 Bacteria 1520
48 Ga0068851_10000263 3300005834 Bacteria 24713
49 Ga0068863_100004796 3300005841 Bacteria 13321
50 Ga0068863_100014808 3300005841 Bacteria 7499
51 Ga0068858_100398066 3300005842 Bacteria 1323
52 Ga0068858_100657980 3300005842 Bacteria 1018
53 Ga0081455_10199973 3300005937 Bacteria 1497
54 Ga0081540_1084665 3300005983 Unclassified 1414
55 Ga0070717_10213152 3300006028 Bacteria 1695
56 Ga0068871_100258986 3300006358 Unclassified 1517
57 Ga0075428_100001615 3300006844 Bacteria 24100
58 Ga0075428_100033998 3300006844 Bacteria 5624
59 Ga0075428_100337613 3300006844 Bacteria 1618
60 Ga0075430_100066128 3300006846 Bacteria 3036
61 Ga0075431_100192477 3300006847 Bacteria 2089
62 Ga0075433_10001869 3300006852 Bacteria 15820
63 Ga0075433_10028393 3300006852 Bacteria 4756
64 Ga0075434_100009175 3300006871 Bacteria 9217
65 Ga0075434_100048131 3300006871 Bacteria 4231
66 Ga0075436_100000560 3300006914 Bacteria 24223
67 Ga0075436_100073156 3300006914 Bacteria 2372
68 Ga0097620_100313660 3300006931 Bacteria 1662
69 Ga0097620_100373975 3300006931 Bacteria 1520
70 Ga0075435_100030042 3300007076 Bacteria 4270
71 Ga0075435_100081911 3300007076 Unclassified 2652
72 Ga0105251_10008284 3300009011 Bacteria 6280
73 Ga0111539_10075303 3300009094 Unclassified 3976
74 Ga0111539_10216673 3300009094 Bacteria 2230
75 Ga0111539_10514970 3300009094 Unclassified 1394
76 Ga0114129_10245465 3300009147 Bacteria 2406
77 Ga0114129_10256132 3300009147 Bacteria 2347
78 Ga0114129_10631563 3300009147 Bacteria 1384
79 Ga0105241_10069469 3300009174 Bacteria 2731
80 Ga0105248_10260739 3300009177 Bacteria 1951
81 Ga0105248_10394800 3300009177 Bacteria 1558
82 Ga0105248_10787058 3300009177 Bacteria 1073
83 Ga0105237_10454042 3300009545 Bacteria 1287
84 Ga0105238_10046942 3300009551 Bacteria 4355
85 Ga0105239_10321886 3300010375 Unclassified 1744
86 Ga0105246_10375982 3300011119 Bacteria 1172
87 Ga0157369_10013643 3300013105 Bacteria 9189
88 Ga0157374_10113419 3300013296 Unclassified 2609
89 Ga0157378_10059928 3300013297 Bacteria 3396
90 Ga0157375_10220823 3300013308 Bacteria 2053
91 Ga0163163_10508641 3300014325 Bacteria 1266
92 Ga0157377_10000078 3300014745 Bacteria 74509
93 Ga0157379_10048918 3300014968 Bacteria 3775
94 Ga0157376_10021826 3300014969 Bacteria 4977
95 Ga0157376_10082481 3300014969 Bacteria 2763
96 Ga0182006_1117815 3300015261 Bacteria 926
97 Ga0182007_10011221 3300015262 Bacteria 3495
98 Ga0183361_10005 3300016635 Bacteria 413599
99 Ga0207713_1062851 3300025735 Bacteria 1405
100 Ga0207653_10000036 3300025885 Bacteria 101828
101 Ga0207680_10154088 3300025903 Bacteria 1535
102 Ga0207699_10000031 3300025906 Bacteria 137708
103 Ga0207684_10001227 3300025910 Bacteria 28467
104 Ga0207671_10587285 3300025914 Bacteria 888
105 Ga0207663_10000450 3300025916 Bacteria 17866
106 Ga0207663_10218468 3300025916 Unclassified 1385
107 Ga0207660_10378260 3300025917 Bacteria 1138
108 Ga0207657_10009805 3300025919 Bacteria 9598
109 Ga0207649_10144443 3300025920 Bacteria 1632
110 Ga0207694_10456210 3300025924 Bacteria 1067
111 Ga0207700_10077641 3300025928 Bacteria 2580
112 Ga0207706_10019838 3300025933 Bacteria 6043
113 Ga0207689_10011994 3300025942 Bacteria 7427
114 Ga0207689_10040294 3300025942 Bacteria 3867
115 Ga0207689_10173294 3300025942 Bacteria 1779
116 Ga0207667_10520849 3300025949 Bacteria 1204
117 Ga0207703_10554679 3300026035 Bacteria 1084
118 Ga0207703_10751470 3300026035 Unclassified 929
119 Ga0207708_10087188 3300026075 Bacteria 2403
120 Ga0207702_10475389 3300026078 Bacteria 1215
121 Ga0207641_10041911 3300026088 Bacteria 3839
122 Ga0207641_10094167 3300026088 Bacteria 2626
123 Ga0207676_10165536 3300026095 Unclassified 1921
124 Ga0265762_1000107 3300030760 Bacteria 12140
125 Ga0307513_10234638 3300031456 Bacteria 1645
126 Ga0373929_0000001 3300035085 Bacteria 956023
127 Ga0395905_0311896 3300037471 Bacteria 1462
128 Ga0453683_0013191 3300044673 Bacteria 5401
129 Ga0453683_0194101 3300044673 Bacteria 1289
130 Ga0466961_0084350 3300044693 Unclassified 2009
131 Ga0451576_0012331 3300045051 Bacteria 9609
132 Ga0466967_0027079 3300045976 Unclassified 4763
133 Ga0495627_019602 3300046453 Bacteria 2265
134 Ga0495591_026217 3300046458 Bacteria 1815
135 Ga0495650_0004093 3300046471 Bacteria 10182
136 Ga0495580_0014167 3300046472 Bacteria 6055
137 Ga0495605_0000362 3300046474 Bacteria 43622
138 Ga0495594_0000506 3300046499 Bacteria 19879
139 Ga0495607_0000485 3300046501 Bacteria 39753
140 Ga0495607_0121157 3300046501 Bacteria 1373
141 Ga0495583_0000701 3300046506 Bacteria 43155
142 Ga0495583_0016276 3300046506 Bacteria 4007
143 Ga0495610_0020152 3300046512 Bacteria 3709
144 Ga0495616_0000492 3300046513 Bacteria 30078
145 Ga0495616_0072368 3300046513 Bacteria 1665
146 Ga0495620_0000219 3300046515 Bacteria 43161
147 Ga0495631_0010055 3300046518 Bacteria 4701
148 Ga0495648_0021570 3300046524 Bacteria 4456
149 Ga0495587_0079708 3300046536 Bacteria 1898
150 Ga0495609_0000019 3300046538 Bacteria 297777
151 Ga0495609_0000317 3300046538 Bacteria 43158
152 Ga0495597_0002162 3300046542 Bacteria 12921
153 Ga0495645_0056299 3300046543 Bacteria 2855
154 Ga0495633_0000476 3300046558 Bacteria 40643
155 Ga0495656_0002469 3300046615 Bacteria 6152
156 Ga0495611_0002449 3300046648 Bacteria 8479
157 Ga0495661_0000012 3300046665 Bacteria 276804
158 Ga0495661_0000232 3300046665 Bacteria 64230
159 Ga0495646_0035904 3300046680 Bacteria 3072
160 Ga0495646_0162182 3300046680 Bacteria 1237
161 Ga0495670_0006038 3300046691 Bacteria 5933
162 Ga0495671_0011966 3300046692 Bacteria 4753
163 Ga0495649_0060073 3300046694 Bacteria 2045
164 Ga0495589_0000007 3300046794 Bacteria 276444
165 Ga0495589_0001312 3300046794 Bacteria 14600
166 Ga0495660_0013923 3300046810 Bacteria 4662
167 Ga0495636_0104728 3300047318 Bacteria 1240
168 Ga0495674_0004135 3300047319 Bacteria 14014
169 Ga0495672_0137027 3300047320 Bacteria 1282
170 Ga0495683_0000289 3300047323 Bacteria 43297
171 Ga0495683_0054369 3300047323 Bacteria 1995
172 Ga0495687_000003 3300047443 Bacteria 859509
173 Ga0495677_0000005 3300047445 Bacteria 243336
174 Ga0495679_000958 3300047446 Bacteria 17892
175 Ga0495673_0003042 3300047469 Bacteria 11288
176 Ga0495681_0045934 3300047470 Bacteria 2086
177 Ga0495626_0121855 3300048091 Bacteria 1120
178 Ga0496100_0000122 3300048903 Bacteria 44143
179 Ga0496100_0130354 3300048903 Bacteria 1770
180 Ga0496101_0000064 3300048904 Bacteria 124993
181 Ga0496101_0078226 3300048904 Bacteria 2439
182 Ga0496103_0000153 3300048906 Bacteria 72323
183 Ga0496103_0181285 3300048906 Bacteria 1354
184 Ga0496103_0221427 3300048906 Bacteria 1217
185 Ga0496104_0116154 3300048907 Bacteria 2568
186 Ga0496104_0553190 3300048907 Bacteria 1061
187 Ga0496105_0015923 3300048908 Bacteria 5998
188 Ga0496105_0076735 3300048908 Bacteria 2759
189 Ga0496106_0060843 3300048909 Bacteria 2863
190 Ga0496108_0022713 3300048911 Bacteria 5160
191 Ga0496108_0047467 3300048911 Bacteria 3589
192 Ga0496109_0251811 3300048912 Bacteria 1663
193 Ga0496109_0677101 3300048912 Bacteria 969
194 Ga0496112_0016416 3300048915 Bacteria 6936
195 Ga0496112_0059190 3300048915 Bacteria 3774
196 Ga0496112_0317492 3300048915 Bacteria 1502
197 Ga0496113_0039549 3300048916 Bacteria 3471
198 Ga0496113_0090428 3300048916 Bacteria 2358
199 Ga0496113_0141796 3300048916 Bacteria 1891
200 Ga0496117_0000134 3300048920 Bacteria 161270
201 Ga0496118_0000139 3300048921 Bacteria 128723
202 Ga0496119_0032325 3300048922 Bacteria 3489
203 Ga0496121_0000202 3300048924 Bacteria 131089
204 Ga0496121_0007948 3300048924 Bacteria 12675
205 Ga0496121_0012741 3300048924 Bacteria 9112
206 Ga0496124_0171271 3300048927 Bacteria 1681
207 Ga0495678_000412 3300049459 Bacteria 43250
208 Ga0495682_0114675 3300049460 Bacteria 965
209 Ga0501072_0015425 3300049588 Bacteria 5857
210 Ga0501075_0000426 3300049591 Bacteria 24768
211 Ga0501077_0001439 3300049593 Bacteria 14309
212 Ga0501080_0005680 3300049742 Bacteria 11152
213 Ga0501080_0304416 3300049742 Bacteria 1445
214 nmdc:mga05p37_322162_c1 3300050507 Unclassified 1829
215 nmdc:mga05p37_555148_c1 3300050507 Bacteria 1306
216 nmdc:mga09592_151710_c1 3300050508 Bacteria 1999
217 nmdc:mga0qj67_183847_c1 3300050509 Bacteria 1698
218 nmdc:mga08y16_407518_c1 3300050511 Unclassified 1391
219 nmdc:mga08y16_51978_c1 3300050511 Unclassified 4287
220 nmdc:mga0n895_102957_c1 3300050512 Bacteria 2866
221 nmdc:mga0n895_379050_c1 3300050512 Bacteria 1431
222 nmdc:mga0rr50_109969_c1 3300050513 Bacteria 2179
223 nmdc:mga08x19_33_c1 3300050514 Bacteria 203200
224 nmdc:mga08x19_34028_c1 3300050514 Bacteria 3219
225 Ga0500618_024039 3300053125 Bacteria 1470
226 Ga0500627_0015034 3300053158 Bacteria 2981
227 Ga0501082_0000444 3300060353 Bacteria 36630
228 Ga0530510_0221327 3300061734 Bacteria 1407
229 2563057815 2562617112 Bacteria 10918404
230 2713473485 2711768613 Bacteria 11048459
231 2792837894 2791355137 Bacteria 9654227
232 2844535223 2844533157 Bacteria 7517899
233 2904622489 2904615490 Bacteria 10047340
234 Ga0070693_100019645
235 Ga0065704_10103734
236 Ga0065715_10369676
237 Ga0070670_100108824
238 Ga0068869_100027492
239 Ga0068869_100091656
240 Ga0068869_100170258
241 Ga0070682_100109194
242 Ga0070660_100102305
243 Ga0070661_100223418
244 Ga0070692_10098353
245 Ga0070659_100152728
246 Ga0070659_100448251
247 Ga0070667_100291245
248 Ga0070703_10000985
249 Ga0070709_10000145
250 Ga0070713_100204778
251 Ga0070711_100000372
252 Ga0070705_100020985
253 Ga0070705_100096716
254 Ga0070694_100036921
255 Ga0070694_100078215
256 Ga0070694_100126772
257 Ga0070708_100155141
258 Ga0070662_100092663
259 Ga0070681_10162847
260 Ga0070706_100013182
261 Ga0070698_100305113
262 Ga0070699_100000135
263 Ga0068853_100014855
264 Ga0068853_100149206
265 Ga0070686_100269556
266 Ga0070695_100196575
267 Ga0070695_100425312
268 Ga0070696_100000042
269 Ga0070696_100099387
270 Ga0070693_100032671
271 Ga0070665_100023169
272 Ga0070704_100051619
273 Ga0070704_100060669
274 Ga0070704_100202194
275 Ga0070704_100341452
276 Ga0068855_100033088
277 Ga0070702_100036825
278 Ga0068852_100176234
279 Ga0068859_100313680
280 Ga0068859_100373960
281 Ga0068851_10000263
282 Ga0068863_100004796
283 Ga0068863_100014808
284 Ga0068858_100398066
285 Ga0068858_100657980
286 Ga0081455_10199973
287 Ga0081540_1084665
288 Ga0070717_10213152
289 Ga0068871_100258986
290 Ga0075428_100001615
291 Ga0075428_100033998
292 Ga0075428_100337613
293 Ga0075430_100066128
294 Ga0075431_100192477
295 Ga0075433_10001869
296 Ga0075433_10028393
297 Ga0075434_100009175
298 Ga0075434_100048131
299 Ga0075436_100000560
300 Ga0075436_100073156
301 Ga0097620_100313660
302 Ga0097620_100373975
303 Ga0075435_100030042
304 Ga0075435_100081911
305 Ga0105251_10008284
306 Ga0111539_10075303
307 Ga0111539_10216673
308 Ga0111539_10514970
309 Ga0114129_10245465
310 Ga0114129_10256132
311 Ga0114129_10631563
312 Ga0105241_10069469
313 Ga0105248_10260739
314 Ga0105248_10394800
315 Ga0105248_10787058
316 Ga0105237_10454042
317 Ga0105238_10046942
318 Ga0105239_10321886
319 Ga0105246_10375982
320 Ga0157369_10013643
321 Ga0157374_10113419
322 Ga0157378_10059928
323 Ga0157375_10220823
324 Ga0163163_10508641
325 Ga0157377_10000078
326 Ga0157379_10048918
327 Ga0157376_10021826
328 Ga0157376_10082481
329 Ga0182006_1117815
330 Ga0182007_10011221
331 Ga0183361_10005
332 Ga0207713_1062851
333 Ga0207653_10000036
334 Ga0207680_10154088
335 Ga0207699_10000031
336 Ga0207684_10001227
337 Ga0207671_10587285
338 Ga0207663_10000450
339 Ga0207663_10218468
340 Ga0207660_10378260
341 Ga0207657_10009805
342 Ga0207649_10144443
343 Ga0207694_10456210
344 Ga0207700_10077641
345 Ga0207706_10019838
346 Ga0207689_10011994
347 Ga0207689_10040294
348 Ga0207689_10173294
349 Ga0207667_10520849
350 Ga0207703_10554679
351 Ga0207703_10751470
352 Ga0207708_10087188
353 Ga0207702_10475389
354 Ga0207641_10041911
355 Ga0207641_10094167
356 Ga0207676_10165536
357 Ga0265762_1000107
358 Ga0307513_10234638
359 Ga0373929_0000001
360 Ga0395905_0311896
361 Ga0453683_0013191
362 Ga0453683_0194101
363 Ga0466961_0084350
364 Ga0451576_0012331
365 Ga0466967_0027079
366 Ga0495627_019602
367 Ga0495591_026217
368 Ga0495650_0004093
369 Ga0495580_0014167
370 Ga0495605_0000362
371 Ga0495594_0000506
372 Ga0495607_0000485
373 Ga0495607_0121157
374 Ga0495583_0000701
375 Ga0495583_0016276
376 Ga0495610_0020152
377 Ga0495616_0000492
378 Ga0495616_0072368
379 Ga0495620_0000219
380 Ga0495631_0010055
381 Ga0495648_0021570
382 Ga0495587_0079708
383 Ga0495609_0000019
384 Ga0495609_0000317
385 Ga0495597_0002162
386 Ga0495645_0056299
387 Ga0495633_0000476
388 Ga0495656_0002469
389 Ga0495611_0002449
390 Ga0495661_0000012
391 Ga0495661_0000232
392 Ga0495646_0035904
393 Ga0495646_0162182
394 Ga0495670_0006038
395 Ga0495671_0011966
396 Ga0495649_0060073
397 Ga0495589_0000007
398 Ga0495589_0001312
399 Ga0495660_0013923
400 Ga0495636_0104728
401 Ga0495674_0004135
402 Ga0495672_0137027
403 Ga0495683_0000289
404 Ga0495683_0054369
405 Ga0495687_000003
406 Ga0495677_0000005
407 Ga0495679_000958
408 Ga0495673_0003042
409 Ga0495681_0045934
410 Ga0495626_0121855
411 Ga0496100_0000122
412 Ga0496100_0130354
413 Ga0496101_0000064
414 Ga0496101_0078226
415 Ga0496103_0000153
416 Ga0496103_0181285
417 Ga0496103_0221427
418 Ga0496104_0116154
419 Ga0496104_0553190
420 Ga0496105_0015923
421 Ga0496105_0076735
422 Ga0496106_0060843
423 Ga0496108_0022713
424 Ga0496108_0047467
425 Ga0496109_0251811
426 Ga0496109_0677101
427 Ga0496112_0016416
428 Ga0496112_0059190
429 Ga0496112_0317492
430 Ga0496113_0039549
431 Ga0496113_0090428
432 Ga0496113_0141796
433 Ga0496117_0000134
434 Ga0496118_0000139
435 Ga0496119_0032325
436 Ga0496121_0000202
437 Ga0496121_0007948
438 Ga0496121_0012741
439 Ga0496124_0171271
440 Ga0495678_000412
441 Ga0495682_0114675
442 Ga0501072_0015425
443 Ga0501075_0000426
444 Ga0501077_0001439
445 Ga0501080_0005680
446 Ga0501080_0304416
447 nmdc:mga05p37_322162_c1
448 nmdc:mga05p37_555148_c1
449 nmdc:mga09592_151710_c1
450 nmdc:mga0qj67_183847_c1
451 nmdc:mga08y16_407518_c1
452 nmdc:mga08y16_51978_c1
453 nmdc:mga0n895_102957_c1
454 nmdc:mga0n895_379050_c1
455 nmdc:mga0rr50_109969_c1
456 nmdc:mga08x19_33_c1
457 nmdc:mga08x19_34028_c1
458 Ga0500618_024039
459 Ga0500627_0015034
460 Ga0501082_0000444
461 Ga0530510_0221327
462 2563057815
463 2713473485
464 2792837894
465 2844535223
466 2904622489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

62

301

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9838 4 273
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.981 4 273
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9668 4 273
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.966 4 273
4mg4-assembly2.cif.gz_F crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9242 5 248
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9887 4 231 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9717 4 231 3.20.20.60
4lsbB02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9586 233 273 6.10.250.2750
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9248 2 231 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9133 2 231 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A5R2MZN5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9948 77 205 GO:0016829
AF-A0A7Y7Y737-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9945 97 205 GO:0016829
AF-A0A524Q9N9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9925 1 192 GO:0016829
AF-A0A2V9J6C0-F1-model_v4 2-methylisocitrate lyase 0.9908 2 176 GO:0016829
AF-A0A538P0J9-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9895 3 272 GO:0016829

Map