F345910

General Info

Members Datasets Scaffolds Average Seq Length
233 183 466 202

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100122743|Ga0068859_1001227433
Length 236
Sequence MGESLALGALFGQSLLIGLSIAAPVGPIGLLTIQRTLQLGSAAGLATGLGAAAADAVYGAVGAYGVTTLIRALTAARLPLAIGGGVFLLWMAWSIWRTPVAQQAAQVSAARPPEGTDAPLRGAANEVSVGAVRSSGSALTRCFAGTFVLTLSNPATILSFIAVFGAMAGRTAVTSPAVMVGGVLLGSAMWWLLLSTVVGRLRERFDAHWRRRVNIVSALVLAAFALWQFAALLPGA

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2547132374 Acidovorax radicis N35 Isolate Unclassified
173 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
174 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
175 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
176 2643221570 Acidovorax sp. Root568 Isolate Unclassified
177 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
178 2643221596 Acidovorax sp. Root70 Isolate Unclassified
179 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
180 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
181 2643221652 Acidovorax sp. Root402 Isolate Unclassified
182 2643221717 Acidovorax sp. Root267 Isolate Unclassified
183 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.32
Nodule 0
Rhizoplane 2.58
Rhizosphere 63.52
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100122743 3300005617 Bacteria 2664
2 JGI25152J39213_1006684 3300002773 Bacteria 3085
3 JGI25151J46595_10000775 3300003187 Bacteria 25895
4 JGI25153J46596_10001927 3300003215 Bacteria 12324
5 JGI25153J46596_10003055 3300003215 Bacteria 9451
6 rootH1_10106955 3300003316 Bacteria 1864
7 rootH2_10306843 3300003320 Bacteria 1845
8 rootL2_10044213 3300003322 Bacteria 4758
9 rootH1_10009467 3300003323 Bacteria 7269
10 Ga0055526_1001234 3300003771 Bacteria 18348
11 Ga0055530_10011037 3300003791 Bacteria 3278
12 Ga0055531_10000154 3300003794 Bacteria 79686
13 Ga0065165_1001001 3300005262 Bacteria 34644
14 Ga0065707_10087932 3300005295 Bacteria 4840
15 Ga0070676_10137361 3300005328 Bacteria 1552
16 Ga0070689_100259774 3300005340 Unclassified 1435
17 Ga0070668_100348862 3300005347 Bacteria 1252
18 Ga0070669_100082895 3300005353 Bacteria 2391
19 Ga0070669_100245496 3300005353 Bacteria 1424
20 Ga0070674_100010769 3300005356 Bacteria 5545
21 Ga0070673_100625910 3300005364 Bacteria 983
22 Ga0070673_100893582 3300005364 Unclassified 823
23 Ga0070667_100113162 3300005367 Unclassified 2355
24 Ga0070710_10151125 3300005437 Bacteria 1432
25 Ga0070678_100109875 3300005456 Bacteria 2155
26 Ga0070662_100002804 3300005457 Bacteria 10796
27 Ga0068867_100003168 3300005459 Bacteria 11602
28 Ga0068867_100699215 3300005459 Bacteria 894
29 Ga0068853_100233545 3300005539 Bacteria 1683
30 Ga0070686_100107253 3300005544 Bacteria 1897
31 Ga0070693_100412369 3300005547 Bacteria 939
32 Ga0068852_100458716 3300005616 Bacteria 1263
33 Ga0068859_100449461 3300005617 Unclassified 1385
34 Ga0068864_100609932 3300005618 Bacteria 1060
35 Ga0068864_101002357 3300005618 Unclassified 828
36 Ga0068866_10251620 3300005718 Bacteria 1081
37 Ga0068861_100002388 3300005719 Bacteria 12231
38 Ga0068863_100419372 3300005841 Bacteria 1311
39 Ga0068858_100120995 3300005842 Bacteria 2448
40 Ga0068860_100005415 3300005843 Bacteria 12950
41 Ga0068860_100054615 3300005843 Bacteria 3797
42 Ga0068860_100062184 3300005843 Bacteria 3547
43 Ga0068862_100008720 3300005844 Bacteria 8392
44 Ga0068862_100191268 3300005844 Bacteria 1841
45 Ga0075363_100102453 3300006048 Bacteria 1585
46 Ga0075363_100123762 3300006048 Bacteria 1446
47 Ga0070712_100358729 3300006175 Bacteria 1195
48 Ga0075367_10363336 3300006178 Bacteria 914
49 Ga0075366_10002612 3300006195 Bacteria 9264
50 Ga0075366_10003496 3300006195 Bacteria 8299
51 Ga0075366_10042587 3300006195 Bacteria 2688
52 Ga0075366_10153020 3300006195 Bacteria 1397
53 Ga0075366_10171895 3300006195 Bacteria 1315
54 Ga0075366_10234164 3300006195 Bacteria 1119
55 Ga0097621_100077774 3300006237 Unclassified 2755
56 Ga0075370_10003521 3300006353 Bacteria 7468
57 Ga0075370_10019641 3300006353 Bacteria 3683
58 Ga0075428_100969309 3300006844 Bacteria 901
59 Ga0068865_100014842 3300006881 Bacteria 4957
60 Ga0097620_100122743 3300006931 Bacteria 2664
61 Ga0097620_100449498 3300006931 Unclassified 1385
62 Ga0099795_10004339 3300007788 Bacteria 3646
63 Ga0105244_10199458 3300009036 Bacteria 944
64 Ga0105240_10147072 3300009093 Bacteria 2811
65 Ga0105247_10125672 3300009101 Bacteria 1667
66 Ga0114129_10441686 3300009147 Bacteria 1708
67 Ga0105243_10003682 3300009148 Bacteria 12323
68 Ga0105243_10071941 3300009148 Bacteria 2798
69 Ga0105242_10004100 3300009176 Bacteria 11330
70 Ga0105249_10749005 3300009553 Bacteria 1039
71 Ga0099796_10007797 3300010159 Bacteria 2818
72 Ga0105239_10036075 3300010375 Bacteria 5429
73 Ga0157369_10035033 3300013105 Bacteria 5505
74 Ga0157378_10001679 3300013297 Bacteria 19946
75 Ga0163162_10001712 3300013306 Bacteria 20568
76 Ga0157375_10490967 3300013308 Bacteria 1392
77 Ga0157380_10019392 3300014326 Bacteria 5068
78 Ga0157379_10307725 3300014968 Bacteria 1445
79 Ga0182006_1015893 3300015261 Bacteria 3217
80 Ga0209672_100457 3300025228 Bacteria 23137
81 Ga0207425_1000336 3300025245 Bacteria 32559
82 Ga0209129_1000148 3300025258 Bacteria 114559
83 Ga0209129_1001760 3300025258 Bacteria 11607
84 Ga0209673_1011953 3300025273 Bacteria 3536
85 Ga0209025_1000122 3300025294 Bacteria 206064
86 Ga0209025_1007421 3300025294 Bacteria 8183
87 Ga0209564_1000251 3300025295 Bacteria 114511
88 Ga0209758_1000387 3300025297 Bacteria 76099
89 Ga0209758_1000439 3300025297 Bacteria 69980
90 Ga0209050_1000749 3300025298 Bacteria 46744
91 Ga0209050_1001997 3300025298 Bacteria 19083
92 Ga0209051_1012599 3300025303 Bacteria 4081
93 Ga0209257_1000016 3300025304 Bacteria 908015
94 Ga0207692_10181230 3300025898 Bacteria 1227
95 Ga0207695_10543922 3300025913 Unclassified 1043
96 Ga0207693_10155942 3300025915 Bacteria 1796
97 Ga0207681_10421614 3300025923 Bacteria 1081
98 Ga0207706_10001187 3300025933 Bacteria 26320
99 Ga0207709_10017704 3300025935 Bacteria 3981
100 Ga0207670_10754890 3300025936 Bacteria 808
101 Ga0207691_10057364 3300025940 Bacteria 3544
102 Ga0207689_10544634 3300025942 Bacteria 974
103 Ga0207712_10018508 3300025961 Bacteria 4539
104 Ga0207658_10141619 3300025986 Unclassified 1947
105 Ga0207703_10420425 3300026035 Bacteria 1244
106 Ga0207703_10437012 3300026035 Bacteria 1220
107 Ga0207648_10008152 3300026089 Bacteria 10184
108 Ga0207648_10029231 3300026089 Bacteria 4887
109 Ga0207648_10690201 3300026089 Bacteria 946
110 Ga0207675_100293070 3300026118 Bacteria 1583
111 Ga0207683_10041050 3300026121 Bacteria 4039
112 Ga0209813_10030639 3300027866 Bacteria 1582
113 Ga0268265_10003999 3300028380 Bacteria 10378
114 Ga0268264_10019004 3300028381 Bacteria 5618
115 Ga0268264_10045970 3300028381 Bacteria 3626
116 Ga0307517_10214016 3300028786 Bacteria 1182
117 Ga0307515_10000062 3300028794 Bacteria 247284
118 Ga0307515_10001570 3300028794 Bacteria 51012
119 Ga0307509_10052497 3300031507 Bacteria 4352
120 Ga0307514_10000348 3300031649 Bacteria 107998
121 Ga0307516_10000128 3300031730 Bacteria 90057
122 Ga0307516_10206499 3300031730 Bacteria 1681
123 Ga0307416_100075640 3300032002 Bacteria 2819
124 Ga0373944_0079812 3300035089 Bacteria 1079
125 Ga0373954_0029673 3300035118 Bacteria 2520
126 Ga0373933_0049770 3300035724 Bacteria 2499
127 Ga0373947_0424242 3300035725 Bacteria 899
128 Ga0373937_0023548 3300036401 Bacteria 5545
129 Ga0395899_0000007 3300037312 Bacteria 629129
130 Ga0395900_0000026 3300037418 Bacteria 313470
131 Ga0395898_0000085 3300037466 Bacteria 240992
132 Ga0395898_0865758 3300037466 Bacteria 842
133 Ga0395905_0029124 3300037471 Bacteria 5204
134 Ga0395905_0030338 3300037471 Bacteria 5095
135 Ga0395905_0754543 3300037471 Bacteria 875
136 Ga0436365_1603191 3300039437 Bacteria 1873
137 Ga0451793_0276483 3300041452 Bacteria 1075
138 Ga0439449_0094060 3300042007 Bacteria 1107
139 Ga0439446_0108927 3300042156 Bacteria 882
140 Ga0451577_0000058 3300042876 Bacteria 272673
141 Ga0451577_0003102 3300042876 Bacteria 18737
142 Ga0466969_0008766 3300044656 Bacteria 5361
143 Ga0466972_0009978 3300044658 Bacteria 4768
144 Ga0466965_0013184 3300044683 Bacteria 3896
145 Ga0466965_0063359 3300044683 Bacteria 1850
146 Ga0466961_0025446 3300044693 Bacteria 3805
147 Ga0453684_0000279 3300044712 Bacteria 220016
148 Ga0453684_0010373 3300044712 Bacteria 15944
149 Ga0453684_0077993 3300044712 Bacteria 4148
150 Ga0453684_0078883 3300044712 Bacteria 4119
151 Ga0453684_0125878 3300044712 Bacteria 3084
152 Ga0466971_0054008 3300044719 Bacteria 1810
153 Ga0466957_0324244 3300044842 Bacteria 1040
154 Ga0466960_0112275 3300044901 Bacteria 1417
155 Ga0466960_0256328 3300044901 Bacteria 973
156 Ga0466959_0010973 3300045049 Bacteria 6501
157 Ga0451576_1073108 3300045051 Bacteria 843
158 Ga0466958_0440098 3300045836 Bacteria 844
159 Ga0495629_0009889 3300046459 Bacteria 6962
160 Ga0495653_0006421 3300046463 Bacteria 9640
161 Ga0495662_0088031 3300046476 Bacteria 1513
162 Ga0495664_0028671 3300046477 Bacteria 3251
163 Ga0495664_0307506 3300046477 Unclassified 957
164 Ga0495628_0008969 3300046516 Bacteria 8553
165 Ga0495630_0006541 3300046517 Bacteria 8299
166 Ga0495630_0161568 3300046517 Bacteria 1705
167 Ga0495637_0128058 3300046520 Bacteria 971
168 Ga0495666_0249957 3300046526 Unclassified 808
169 Ga0495652_0034921 3300046529 Bacteria 4379
170 Ga0495665_0000554 3300046531 Bacteria 18998
171 Ga0495586_0113475 3300046535 Unclassified 1509
172 Ga0495609_0120870 3300046538 Bacteria 1126
173 Ga0495634_0657783 3300046642 Bacteria 605
174 Ga0495599_0068190 3300046678 Bacteria 2221
175 Ga0495599_0129046 3300046678 Bacteria 1570
176 Ga0495623_0003786 3300046679 Bacteria 9964
177 Ga0495646_0029347 3300046680 Bacteria 3438
178 Ga0495647_0173248 3300046681 Bacteria 935
179 Ga0495624_0002014 3300046690 Bacteria 15476
180 Ga0495600_0133518 3300046809 Unclassified 1613
181 Ga0495604_0001015 3300047317 Bacteria 23389
182 Ga0495674_0651672 3300047319 Unclassified 830
183 Ga0495680_0016383 3300047322 Bacteria 6371
184 Ga0495686_0002783 3300047472 Bacteria 15942
185 Ga0495593_0113353 3300047673 Unclassified 1383
186 Ga0495602_0005184 3300048088 Bacteria 13655
187 Ga0495602_0059650 3300048088 Bacteria 3329
188 Ga0496101_0234378 3300048904 Bacteria 1427
189 Ga0496102_0940653 3300048905 Unclassified 785
190 Ga0496105_0085344 3300048908 Bacteria 2608
191 Ga0496113_0050832 3300048916 Bacteria 3092
192 Ga0496114_0666314 3300048917 Unclassified 914
193 Ga0496119_0418573 3300048922 Unclassified 636
194 Ga0496122_0000531 3300048925 Bacteria 79144
195 Ga0496123_0000108 3300048926 Bacteria 166102
196 Ga0496124_0044117 3300048927 Bacteria 3828
197 Ga0496124_0133826 3300048927 Bacteria 1966
198 Ga0496126_0121190 3300048929 Bacteria 2268
199 Ga0496126_0140401 3300048929 Bacteria 2080
200 Ga0501035_0053563 3300049822 Bacteria 3607
201 Ga0501044_0000485 3300049823 Bacteria 48260
202 nmdc:mga03683_24395_c1 3300050489 Bacteria 2365
203 nmdc:mga0k408_136886_c1 3300050493 Bacteria 1455
204 nmdc:mga0k408_143583_c1 3300050493 Bacteria 1420
205 nmdc:mga0k408_21694_c1 3300050493 Bacteria 3610
206 nmdc:mga0k408_41159_c1 3300050493 Bacteria 2660
207 nmdc:mga0k408_47862_c1 3300050493 Bacteria 2472
208 nmdc:mga0k408_5029_c1 3300050493 Bacteria 7000
209 nmdc:mga0k408_908_c1 3300050493 Bacteria 16172
210 nmdc:mga04h51_98403_c1 3300050495 Bacteria 1063
211 nmdc:mga07m45_6716_c1 3300050496 Bacteria 5838
212 nmdc:mga05p37_768863_c1 3300050507 Bacteria 1059
213 Ga0500610_0021660 3300053079 Bacteria 3158
214 Ga0500635_0255098 3300053080 Bacteria 688
215 Ga0500578_0000013 3300053086 Bacteria 185921
216 Ga0500646_0001973 3300053090 Bacteria 5368
217 Ga0500651_0388596 3300053093 Bacteria 785
218 Ga0500623_039654 3300053127 Bacteria 2413
219 Ga0500652_000606 3300053131 Bacteria 12361
220 Ga0500622_0000374 3300053156 Bacteria 43119
221 Ga0466962_0096246 3300061719 Bacteria 1419
222 2548501735 2547132374 Bacteria 5530232
223 2587729635 2585428057 Bacteria 6737412
224 2587734273 2585428058 Bacteria 6853932
225 2588293674 2588253510 Bacteria 6901809
226 2643864143 2643221570 Bacteria 5103772
227 2643969117 2643221592 Bacteria 6608788
228 2643992443 2643221596 Bacteria 5006805
229 2644141133 2643221625 Bacteria 6512927
230 2644274464 2643221648 Bacteria 6521465
231 2644292154 2643221652 Bacteria 5140275
232 2644646537 2643221717 Bacteria 5676132
233 2990714756 2990710928 Bacteria 5002431
234 Ga0068859_100122743
235 JGI25152J39213_1006684
236 JGI25151J46595_10000775
237 JGI25153J46596_10001927
238 JGI25153J46596_10003055
239 rootH1_10106955
240 rootH2_10306843
241 rootL2_10044213
242 rootH1_10009467
243 Ga0055526_1001234
244 Ga0055530_10011037
245 Ga0055531_10000154
246 Ga0065165_1001001
247 Ga0065707_10087932
248 Ga0070676_10137361
249 Ga0070689_100259774
250 Ga0070668_100348862
251 Ga0070669_100082895
252 Ga0070669_100245496
253 Ga0070674_100010769
254 Ga0070673_100625910
255 Ga0070673_100893582
256 Ga0070667_100113162
257 Ga0070710_10151125
258 Ga0070678_100109875
259 Ga0070662_100002804
260 Ga0068867_100003168
261 Ga0068867_100699215
262 Ga0068853_100233545
263 Ga0070686_100107253
264 Ga0070693_100412369
265 Ga0068852_100458716
266 Ga0068859_100449461
267 Ga0068864_100609932
268 Ga0068864_101002357
269 Ga0068866_10251620
270 Ga0068861_100002388
271 Ga0068863_100419372
272 Ga0068858_100120995
273 Ga0068860_100005415
274 Ga0068860_100054615
275 Ga0068860_100062184
276 Ga0068862_100008720
277 Ga0068862_100191268
278 Ga0075363_100102453
279 Ga0075363_100123762
280 Ga0070712_100358729
281 Ga0075367_10363336
282 Ga0075366_10002612
283 Ga0075366_10003496
284 Ga0075366_10042587
285 Ga0075366_10153020
286 Ga0075366_10171895
287 Ga0075366_10234164
288 Ga0097621_100077774
289 Ga0075370_10003521
290 Ga0075370_10019641
291 Ga0075428_100969309
292 Ga0068865_100014842
293 Ga0097620_100122743
294 Ga0097620_100449498
295 Ga0099795_10004339
296 Ga0105244_10199458
297 Ga0105240_10147072
298 Ga0105247_10125672
299 Ga0114129_10441686
300 Ga0105243_10003682
301 Ga0105243_10071941
302 Ga0105242_10004100
303 Ga0105249_10749005
304 Ga0099796_10007797
305 Ga0105239_10036075
306 Ga0157369_10035033
307 Ga0157378_10001679
308 Ga0163162_10001712
309 Ga0157375_10490967
310 Ga0157380_10019392
311 Ga0157379_10307725
312 Ga0182006_1015893
313 Ga0209672_100457
314 Ga0207425_1000336
315 Ga0209129_1000148
316 Ga0209129_1001760
317 Ga0209673_1011953
318 Ga0209025_1000122
319 Ga0209025_1007421
320 Ga0209564_1000251
321 Ga0209758_1000387
322 Ga0209758_1000439
323 Ga0209050_1000749
324 Ga0209050_1001997
325 Ga0209051_1012599
326 Ga0209257_1000016
327 Ga0207692_10181230
328 Ga0207695_10543922
329 Ga0207693_10155942
330 Ga0207681_10421614
331 Ga0207706_10001187
332 Ga0207709_10017704
333 Ga0207670_10754890
334 Ga0207691_10057364
335 Ga0207689_10544634
336 Ga0207712_10018508
337 Ga0207658_10141619
338 Ga0207703_10420425
339 Ga0207703_10437012
340 Ga0207648_10008152
341 Ga0207648_10029231
342 Ga0207648_10690201
343 Ga0207675_100293070
344 Ga0207683_10041050
345 Ga0209813_10030639
346 Ga0268265_10003999
347 Ga0268264_10019004
348 Ga0268264_10045970
349 Ga0307517_10214016
350 Ga0307515_10000062
351 Ga0307515_10001570
352 Ga0307509_10052497
353 Ga0307514_10000348
354 Ga0307516_10000128
355 Ga0307516_10206499
356 Ga0307416_100075640
357 Ga0373944_0079812
358 Ga0373954_0029673
359 Ga0373933_0049770
360 Ga0373947_0424242
361 Ga0373937_0023548
362 Ga0395899_0000007
363 Ga0395900_0000026
364 Ga0395898_0000085
365 Ga0395898_0865758
366 Ga0395905_0029124
367 Ga0395905_0030338
368 Ga0395905_0754543
369 Ga0436365_1603191
370 Ga0451793_0276483
371 Ga0439449_0094060
372 Ga0439446_0108927
373 Ga0451577_0000058
374 Ga0451577_0003102
375 Ga0466969_0008766
376 Ga0466972_0009978
377 Ga0466965_0013184
378 Ga0466965_0063359
379 Ga0466961_0025446
380 Ga0453684_0000279
381 Ga0453684_0010373
382 Ga0453684_0077993
383 Ga0453684_0078883
384 Ga0453684_0125878
385 Ga0466971_0054008
386 Ga0466957_0324244
387 Ga0466960_0112275
388 Ga0466960_0256328
389 Ga0466959_0010973
390 Ga0451576_1073108
391 Ga0466958_0440098
392 Ga0495629_0009889
393 Ga0495653_0006421
394 Ga0495662_0088031
395 Ga0495664_0028671
396 Ga0495664_0307506
397 Ga0495628_0008969
398 Ga0495630_0006541
399 Ga0495630_0161568
400 Ga0495637_0128058
401 Ga0495666_0249957
402 Ga0495652_0034921
403 Ga0495665_0000554
404 Ga0495586_0113475
405 Ga0495609_0120870
406 Ga0495634_0657783
407 Ga0495599_0068190
408 Ga0495599_0129046
409 Ga0495623_0003786
410 Ga0495646_0029347
411 Ga0495647_0173248
412 Ga0495624_0002014
413 Ga0495600_0133518
414 Ga0495604_0001015
415 Ga0495674_0651672
416 Ga0495680_0016383
417 Ga0495686_0002783
418 Ga0495593_0113353
419 Ga0495602_0005184
420 Ga0495602_0059650
421 Ga0496101_0234378
422 Ga0496102_0940653
423 Ga0496105_0085344
424 Ga0496113_0050832
425 Ga0496114_0666314
426 Ga0496119_0418573
427 Ga0496122_0000531
428 Ga0496123_0000108
429 Ga0496124_0044117
430 Ga0496124_0133826
431 Ga0496126_0121190
432 Ga0496126_0140401
433 Ga0501035_0053563
434 Ga0501044_0000485
435 nmdc:mga03683_24395_c1
436 nmdc:mga0k408_136886_c1
437 nmdc:mga0k408_143583_c1
438 nmdc:mga0k408_21694_c1
439 nmdc:mga0k408_41159_c1
440 nmdc:mga0k408_47862_c1
441 nmdc:mga0k408_5029_c1
442 nmdc:mga0k408_908_c1
443 nmdc:mga04h51_98403_c1
444 nmdc:mga07m45_6716_c1
445 nmdc:mga05p37_768863_c1
446 Ga0500610_0021660
447 Ga0500635_0255098
448 Ga0500578_0000013
449 Ga0500646_0001973
450 Ga0500651_0388596
451 Ga0500623_039654
452 Ga0500652_000606
453 Ga0500622_0000374
454 Ga0466962_0096246
455 2548501735
456 2587729635
457 2587734273
458 2588293674
459 2643864143
460 2643969117
461 2643992443
462 2644141133
463 2644274464
464 2644292154
465 2644646537
466 2990714756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

19

230

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.6042 1 197
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.5815 4 197
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.5717 1 197
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.5442 4 197
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5065 9 205
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6329 12 202 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6164 12 202 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.542 10 203 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5101 10 203 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4958 40 202 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A848JPM0-F1-model_v4 deleted 0.9612 1 209
AF-A0A535SMS7-F1-model_v4 LysE family translocator 0.9498 9 202 GO:0005886
GO:0015171
AF-A0A4R3I8X2-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9464 9 207 GO:0005886
GO:0015171
AF-A0A7J9P189-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9396 5 208 GO:0005886
GO:0015171
AF-A0A353WIQ7-F1-model_v4 Lysine transporter LysE 0.9343 5 202 GO:0005886
GO:0015171

Map