F346103

General Info

Members Datasets Scaffolds Average Seq Length
233 150 229 303

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10023782|Ga0157378_100237822
Length 339
Sequence LLITVLGDIEIASGKNSSPSCKIPKLRNHKIKNSMQAASHILMIRPVHFGFNAETAVNNAFQIAGKDSGAQEKALAEFDAMVVLLQQNGVDVTVISDTDEPHTPDSIFPNNWISFHEDGTVVLYPMFAPNRRLERKPDIITRIAAKFDITRTIDLSRYEQESAFLEGTGSMVLDRQNKIAYACLSPRTDYFVLTEYCEKLGYTPVSFDAMDQAGRAIYHTNVMMCVADRYVVICMDAIPAEHEKEMVTETIQKTNKDIIPITLEQMNHFAGNMLQVNNDKGEPLLVMSSQAFNVLSKPQVEKLNSYNKIIHSPLTTIETNGGGSARCMMAELYLPIKKL

Samples

Sample ID Description Type Environment
1 2739367663 Pedobacter sp. YR510 Isolate Unclassified
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
4 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
117 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
118 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 2.58
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 1.72
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10196887 3300003320 Bacteria 1605
2 rootH1_10155535 3300003323 Bacteria 2385
3 Ga0070658_10003226 3300005327 Bacteria 13468
4 Ga0070658_10108503 3300005327 Bacteria 2298
5 Ga0070676_10001251 3300005328 Bacteria 12801
6 Ga0070670_100177302 3300005331 Bacteria 1850
7 Ga0068869_100021417 3300005334 Bacteria 4447
8 Ga0070666_10000913 3300005335 Bacteria 17912
9 Ga0070680_100060914 3300005336 Bacteria 3088
10 Ga0070682_100000306 3300005337 Bacteria 34011
11 Ga0070682_100000460 3300005337 Bacteria 25673
12 Ga0068868_100001760 3300005338 Bacteria 14830
13 Ga0068868_100015825 3300005338 Bacteria 5588
14 Ga0070660_100020708 3300005339 Bacteria 4839
15 Ga0070691_10001224 3300005341 Bacteria 10797
16 Ga0070668_100000036 3300005347 Bacteria 81256
17 Ga0070675_100050901 3300005354 Bacteria 3402
18 Ga0070671_100011552 3300005355 Bacteria 7102
19 Ga0070671_100046359 3300005355 Bacteria 3615
20 Ga0070673_100000556 3300005364 Bacteria 20111
21 Ga0070673_100156313 3300005364 Bacteria 1936
22 Ga0070659_100000854 3300005366 Bacteria 22245
23 Ga0070667_100000151 3300005367 Bacteria 86629
24 Ga0070667_100011374 3300005367 Bacteria 7358
25 Ga0070662_100001152 3300005457 Bacteria 16211
26 Ga0070662_100146278 3300005457 Bacteria 1836
27 Ga0070681_10023004 3300005458 Bacteria 6265
28 Ga0068867_100001821 3300005459 Bacteria 14856
29 Ga0070685_10069653 3300005466 Unclassified 2081
30 Ga0070679_100007747 3300005530 Bacteria 10058
31 Ga0068853_100115996 3300005539 Bacteria 2384
32 Ga0070672_100000471 3300005543 Bacteria 23416
33 Ga0070693_100030784 3300005547 Bacteria 2937
34 Ga0070693_100098019 3300005547 Unclassified 1780
35 Ga0070665_100001215 3300005548 Bacteria 31387
36 Ga0070665_100066825 3300005548 Bacteria 3607
37 Ga0068855_100001248 3300005563 Bacteria 31576
38 Ga0068855_100095976 3300005563 Bacteria 3417
39 Ga0068855_100496380 3300005563 Bacteria 1327
40 Ga0070664_100026009 3300005564 Bacteria 4852
41 Ga0070664_100052244 3300005564 Bacteria 3461
42 Ga0068857_100255757 3300005577 Bacteria 1606
43 Ga0070702_100057982 3300005615 Bacteria 2241
44 Ga0068852_100094095 3300005616 Bacteria 2687
45 Ga0068852_100603038 3300005616 Bacteria 1102
46 Ga0068859_100000026 3300005617 Bacteria 188742
47 Ga0068859_100184709 3300005617 Bacteria 2168
48 Ga0068864_100001161 3300005618 Bacteria 21876
49 Ga0068864_100018308 3300005618 Bacteria 5849
50 Ga0068864_100316386 3300005618 Bacteria 1465
51 Ga0068851_10002501 3300005834 Bacteria 8078
52 Ga0068863_100001435 3300005841 Bacteria 23620
53 Ga0068863_100035596 3300005841 Bacteria 4741
54 Ga0068858_100001071 3300005842 Bacteria 28302
55 Ga0068858_100067398 3300005842 Bacteria 3315
56 Ga0068858_100092182 3300005842 Bacteria 2820
57 Ga0068860_100000824 3300005843 Bacteria 34695
58 Ga0068860_100006095 3300005843 Bacteria 12134
59 Ga0068860_100019647 3300005843 Bacteria 6552
60 Ga0068860_100391487 3300005843 Bacteria 1373
61 Ga0081455_10006436 3300005937 Bacteria 12590
62 Ga0075366_10109368 3300006195 Bacteria 1662
63 Ga0097621_100004022 3300006237 Bacteria 10191
64 Ga0097621_100007197 3300006237 Bacteria 7938
65 Ga0097621_100059485 3300006237 Bacteria 3129
66 Ga0068871_100003690 3300006358 Bacteria 10521
67 Ga0068865_100003069 3300006881 Bacteria 9987
68 Ga0097620_100000026 3300006931 Bacteria 188742
69 Ga0097620_100184711 3300006931 Bacteria 2168
70 Ga0105240_10005793 3300009093 Bacteria 18325
71 Ga0105240_10019358 3300009093 Bacteria 9097
72 Ga0105240_10155628 3300009093 Bacteria 2719
73 Ga0105240_10383740 3300009093 Unclassified 1586
74 Ga0105245_10012935 3300009098 Bacteria 7274
75 Ga0105245_10035416 3300009098 Bacteria 4429
76 Ga0105247_10003205 3300009101 Bacteria 10784
77 Ga0105247_10012320 3300009101 Bacteria 5137
78 Ga0105243_10089572 3300009148 Bacteria 2530
79 Ga0105241_10000113 3300009174 Bacteria 58135
80 Ga0105241_10000739 3300009174 Bacteria 24827
81 Ga0105248_10077632 3300009177 Bacteria 3734
82 Ga0105238_10030766 3300009551 Bacteria 5464
83 Ga0105249_10007291 3300009553 Bacteria 9642
84 Ga0105249_10012247 3300009553 Bacteria 7555
85 Ga0105249_10016226 3300009553 Bacteria 6605
86 Ga0105249_10031972 3300009553 Bacteria 4759
87 Ga0105239_10019423 3300010375 Bacteria 7502
88 Ga0105239_10159466 3300010375 Bacteria 2520
89 Ga0105246_10015690 3300011119 Bacteria 4788
90 Ga0157373_10000161 3300013100 Bacteria 54194
91 Ga0157373_10001334 3300013100 Bacteria 18896
92 Ga0157373_10003110 3300013100 Bacteria 12543
93 Ga0157371_10223896 3300013102 Bacteria 1351
94 Ga0157370_10129633 3300013104 Bacteria 2353
95 Ga0157369_10046328 3300013105 Bacteria 4726
96 Ga0157369_10408171 3300013105 Bacteria 1409
97 Ga0157369_10504889 3300013105 Bacteria 1251
98 Ga0157374_10000153 3300013296 Bacteria 63211
99 Ga0157374_10002577 3300013296 Bacteria 15283
100 Ga0157378_10010369 3300013297 Bacteria 8134
101 Ga0157378_10023782 3300013297 Bacteria 5390
102 Ga0157378_10258016 3300013297 Unclassified 1671
103 Ga0163162_10000040 3300013306 Bacteria 133855
104 Ga0163162_10029523 3300013306 Bacteria 5427
105 Ga0157372_10002309 3300013307 Bacteria 20685
106 Ga0157372_10227576 3300013307 Bacteria 2162
107 Ga0157372_10274047 3300013307 Bacteria 1961
108 Ga0157375_10000407 3300013308 Bacteria 39103
109 Ga0157375_10191021 3300013308 Bacteria 2203
110 Ga0163163_10000110 3300014325 Bacteria 87033
111 Ga0163163_10041043 3300014325 Bacteria 4523
112 Ga0163163_10210629 3300014325 Bacteria 1993
113 Ga0157380_10001466 3300014326 Bacteria 15451
114 Ga0157380_10222759 3300014326 Bacteria 1689
115 Ga0157377_10037977 3300014745 Unclassified 2657
116 Ga0157379_10000173 3300014968 Bacteria 48672
117 Ga0157379_10016328 3300014968 Bacteria 6530
118 Ga0157379_10056869 3300014968 Bacteria 3495
119 Ga0157379_10326899 3300014968 Bacteria 1401
120 Ga0157376_10000535 3300014969 Bacteria 24452
121 Ga0157376_10018612 3300014969 Bacteria 5331
122 Ga0157376_10056339 3300014969 Bacteria 3283
123 Ga0163161_10113499 3300017792 Bacteria 2028
124 Ga0197907_10213375 3300020069 Unclassified 997
125 Ga0206355_1202739 3300020076 Unclassified 1129
126 Ga0206355_1209081 3300020076 Bacteria 1131
127 Ga0206351_10014417 3300020077 Bacteria 1211
128 Ga0206350_10159956 3300020080 Bacteria 1054
129 Ga0206350_10401402 3300020080 Unclassified 1101
130 Ga0209026_1000351 3300025250 Bacteria 43657
131 Ga0207710_10001464 3300025900 Bacteria 11721
132 Ga0207710_10010484 3300025900 Bacteria 3904
133 Ga0207680_10001727 3300025903 Bacteria 10295
134 Ga0207705_10003028 3300025909 Bacteria 12813
135 Ga0207654_10003203 3300025911 Bacteria 8272
136 Ga0207707_10000189 3300025912 Bacteria 65118
137 Ga0207695_10002088 3300025913 Bacteria 30409
138 Ga0207671_10073266 3300025914 Bacteria 2558
139 Ga0207660_10001432 3300025917 Bacteria 16013
140 Ga0207662_10211728 3300025918 Bacteria 1258
141 Ga0207657_10020350 3300025919 Bacteria 6272
142 Ga0207657_10484012 3300025919 Bacteria 970
143 Ga0207652_10000488 3300025921 Bacteria 40566
144 Ga0207681_10068595 3300025923 Unclassified 2464
145 Ga0207694_10226276 3300025924 Bacteria 1527
146 Ga0207650_10104098 3300025925 Bacteria 2189
147 Ga0207659_10049001 3300025926 Bacteria 2994
148 Ga0207687_10011776 3300025927 Bacteria 5724
149 Ga0207690_10011362 3300025932 Bacteria 5325
150 Ga0207706_10002485 3300025933 Bacteria 17975
151 Ga0207704_10001601 3300025938 Bacteria 10176
152 Ga0207691_10000504 3300025940 Bacteria 38867
153 Ga0207691_10198653 3300025940 Bacteria 1746
154 Ga0207689_10029042 3300025942 Bacteria 4622
155 Ga0207689_10058561 3300025942 Bacteria 3169
156 Ga0207667_10005017 3300025949 Bacteria 16181
157 Ga0207667_10186787 3300025949 Bacteria 2127
158 Ga0207667_10410945 3300025949 Bacteria 1377
159 Ga0207651_10000164 3300025960 Bacteria 28660
160 Ga0207712_10028628 3300025961 Bacteria 3728
161 Ga0207712_10191814 3300025961 Bacteria 1613
162 Ga0207668_10000568 3300025972 Bacteria 23189
163 Ga0207658_10000225 3300025986 Bacteria 59285
164 Ga0207658_10096055 3300025986 Bacteria 2310
165 Ga0207658_10124532 3300025986 Bacteria 2060
166 Ga0207658_10220125 3300025986 Unclassified 1596
167 Ga0207677_10003499 3300026023 Bacteria 8323
168 Ga0207677_10013233 3300026023 Bacteria 4773
169 Ga0207677_10050302 3300026023 Bacteria 2818
170 Ga0207703_10001012 3300026035 Bacteria 27015
171 Ga0207703_10021902 3300026035 Bacteria 5004
172 Ga0207703_10128359 3300026035 Bacteria 2186
173 Ga0207639_10083279 3300026041 Bacteria 2538
174 Ga0207639_10143031 3300026041 Bacteria 1995
175 Ga0207641_10000155 3300026088 Bacteria 97385
176 Ga0207641_10006442 3300026088 Bacteria 9897
177 Ga0207641_10008788 3300026088 Bacteria 8344
178 Ga0207648_10013539 3300026089 Bacteria 7583
179 Ga0207676_10006768 3300026095 Bacteria 8114
180 Ga0207676_10013345 3300026095 Bacteria 5902
181 Ga0207676_10112939 3300026095 Bacteria 2277
182 Ga0207683_10326389 3300026121 Bacteria 1406
183 Ga0207698_10706678 3300026142 Bacteria 1003
184 Ga0268266_10001023 3300028379 Bacteria 35230
185 Ga0268264_10001646 3300028381 Bacteria 20632
186 Ga0268264_10059000 3300028381 Bacteria 3215
187 Ga0307515_10000363 3300028794 Bacteria 111302
188 Ga0316183_1096868 3300030742 Bacteria 33618
189 Ga0316181_1101548 3300030744 Bacteria 29976
190 Ga0316182_1019572 3300030745 Bacteria 2361
191 Ga0265327_10011303 3300031251 Bacteria 6168
192 Ga0395899_0145332 3300037312 Bacteria 1684
193 Ga0451807_1031808 3300041486 Bacteria 978
194 Ga0451577_0009739 3300042876 Bacteria 9212
195 Ga0451577_0013930 3300042876 Bacteria 7505
196 Ga0451577_0157238 3300042876 Bacteria 2046
197 Ga0466972_0000422 3300044658 Bacteria 21982
198 Ga0453684_0006335 3300044712 Bacteria 22591
199 Ga0453684_0457641 3300044712 Bacteria 1419
200 Ga0466970_0001701 3300044765 Bacteria 10578
201 Ga0466960_0024051 3300044901 Bacteria 2744
202 Ga0451576_0060223 3300045051 Unclassified 3961
203 Ga0451576_0255567 3300045051 Bacteria 1831
204 Ga0495638_0119991 3300046460 Bacteria 1555
205 Ga0495594_0167424 3300046499 Bacteria 1250
206 Ga0495668_0001611 3300046616 Bacteria 21126
207 Ga0495672_0037754 3300047320 Bacteria 2953
208 Ga0495686_0012134 3300047472 Bacteria 6045
209 Ga0496108_0495320 3300048911 Bacteria 1067
210 Ga0496109_0031918 3300048912 Bacteria 4731
211 Ga0496114_0001392 3300048917 Bacteria 18351
212 Ga0501038_0080968 3300049574 Bacteria 2736
213 Ga0501038_0312234 3300049574 Bacteria 1232
214 Ga0501043_0178880 3300049579 Unclassified 1653
215 Ga0501046_0254170 3300049580 Bacteria 1293
216 Ga0501047_0128865 3300049581 Bacteria 2411
217 Ga0501068_0290898 3300049584 Bacteria 1045
218 Ga0501071_0248380 3300049587 Bacteria 1343
219 Ga0501247_001902 3300049677 Bacteria 2106
220 Ga0501079_0447072 3300049741 Bacteria 1015
221 Ga0501083_0071386 3300049744 Bacteria 2308
222 Ga0501044_0075924 3300049823 Unclassified 3412
223 Ga0501044_0162257 3300049823 Bacteria 2211
224 Ga0501044_0216523 3300049823 Bacteria 1867
225 Ga0500562_005204 3300053108 Bacteria 3268
226 Ga0500642_0183066 3300053130 Bacteria 979
227 Ga0500568_0000407 3300053139 Bacteria 32843
228 Ga0500622_0000013 3300053156 Bacteria 371650
229 Ga0501084_0038969 3300054114 Bacteria 3974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025250 Ga0209026_1000351 Ga0209026_100035120 284
2 3300009093 Ga0105240_10383740 Ga0105240_103837402 289
3 3300005563 Ga0068855_100496380 Ga0068855_1004963802 290
4 3300025911 Ga0207654_10003203 Ga0207654_100032033 290
5 3300025949 Ga0207667_10410945 Ga0207667_104109452 290
6 3300005577 Ga0068857_100255757 Ga0068857_1002557572 291
7 3300005616 Ga0068852_100094095 Ga0068852_1000940952 291
8 3300020080 Ga0206350_10159956 Ga0206350_101599561 291
9 3300025914 Ga0207671_10073266 Ga0207671_100732662 291
10 3300026142 Ga0207698_10706678 Ga0207698_107066781 291
11 3300005327 Ga0070658_10003226 Ga0070658_100032265 292
12 3300005328 Ga0070676_10001251 Ga0070676_100012516 292
13 3300005334 Ga0068869_100021417 Ga0068869_1000214173 292
14 3300005335 Ga0070666_10000913 Ga0070666_100009138 292
15 3300005338 Ga0068868_100001760 Ga0068868_1000017602 292
16 3300005354 Ga0070675_100050901 Ga0070675_1000509012 292
17 3300005367 Ga0070667_100000151 Ga0070667_1000001519 292
18 3300005457 Ga0070662_100001152 Ga0070662_1000011528 292
19 3300005539 Ga0068853_100115996 Ga0068853_1001159962 292
20 3300005543 Ga0070672_100000471 Ga0070672_1000004719 292
21 3300005548 Ga0070665_100001215 Ga0070665_10000121520 292
22 3300005563 Ga0068855_100095976 Ga0068855_1000959762 292
23 3300005564 Ga0070664_100052244 Ga0070664_1000522442 292
24 3300005834 Ga0068851_10002501 Ga0068851_100025012 292
25 3300005841 Ga0068863_100001435 Ga0068863_10000143513 292
26 3300005842 Ga0068858_100001071 Ga0068858_10000107111 292
27 3300005843 Ga0068860_100000824 Ga0068860_10000082428 292
28 3300006237 Ga0097621_100004022 Ga0097621_1000040228 292
29 3300006358 Ga0068871_100003690 Ga0068871_1000036906 292
30 3300006881 Ga0068865_100003069 Ga0068865_1000030695 292
31 3300025903 Ga0207680_10001727 Ga0207680_100017274 292
32 3300025909 Ga0207705_10003028 Ga0207705_100030285 292
33 3300025926 Ga0207659_10049001 Ga0207659_100490013 292
34 3300025933 Ga0207706_10002485 Ga0207706_1000248510 292
35 3300025938 Ga0207704_10001601 Ga0207704_100016015 292
36 3300025940 Ga0207691_10000504 Ga0207691_1000050416 292
37 3300025942 Ga0207689_10029042 Ga0207689_100290423 292
38 3300025949 Ga0207667_10186787 Ga0207667_101867872 292
39 3300025961 Ga0207712_10191814 Ga0207712_101918142 292
40 3300025972 Ga0207668_10000568 Ga0207668_100005689 292
41 3300026023 Ga0207677_10003499 Ga0207677_100034998 292
42 3300026035 Ga0207703_10001012 Ga0207703_1000101217 292
43 3300026088 Ga0207641_10006442 Ga0207641_100064426 292
44 3300026089 Ga0207648_10013539 Ga0207648_100135393 292
45 3300026095 Ga0207676_10013345 Ga0207676_100133455 292
46 3300028379 Ga0268266_10001023 Ga0268266_1000102323 292
47 3300028381 Ga0268264_10001646 Ga0268264_100016469 292
48 3300014326 Ga0157380_10001466 Ga0157380_1000146611 294
49 3300031251 Ga0265327_10011303 Ga0265327_100113035 294
50 3300047320 Ga0495672_0037754 Ga0495672_0037754_497_1381 294
51 3300005617 Ga0068859_100000026 Ga0068859_10000002699 295
52 3300006931 Ga0097620_100000026 Ga0097620_10000002699 295
53 3300009093 Ga0105240_10155628 Ga0105240_101556282 295
54 3300009098 Ga0105245_10035416 Ga0105245_100354164 295
55 3300009101 Ga0105247_10012320 Ga0105247_100123201 295
56 3300009148 Ga0105243_10089572 Ga0105243_100895722 295
57 3300009174 Ga0105241_10000739 Ga0105241_100007396 295
58 3300009553 Ga0105249_10031972 Ga0105249_100319724 295
59 3300010375 Ga0105239_10019423 Ga0105239_100194238 295
60 3300011119 Ga0105246_10015690 Ga0105246_100156901 295
61 3300013306 Ga0163162_10029523 Ga0163162_100295231 295
62 3300014968 Ga0157379_10056869 Ga0157379_100568693 295
63 3300014968 Ga0157379_10326899 Ga0157379_103268991 295
64 3300017792 Ga0163161_10113499 Ga0163161_101134992 295
65 3300026088 Ga0207641_10000155 Ga0207641_1000015540 295
66 3300044712 Ga0453684_0457641 Ga0453684_0457641_447_1337 295
67 3300046616 Ga0495668_0001611 Ga0495668_0001611_16118_17005 295
68 3300049574 Ga0501038_0312234 Ga0501038_0312234_238_1143 295
69 3300049580 Ga0501046_0254170 Ga0501046_0254170_235_1140 295
70 3300049581 Ga0501047_0128865 Ga0501047_0128865_931_1836 295
71 3300049584 Ga0501068_0290898 Ga0501068_0290898_13_918 295
72 3300009101 Ga0105247_10003205 Ga0105247_1000320511 296
73 3300009553 Ga0105249_10012247 Ga0105249_100122477 296
74 3300014325 Ga0163163_10210629 Ga0163163_102106292 296
75 3300014326 Ga0157380_10222759 Ga0157380_102227592 296
76 3300026121 Ga0207683_10326389 Ga0207683_103263892 296
77 3300041486 Ga0451807_1031808 Ga0451807_1031808_53_943 296
78 3300046460 Ga0495638_0119991 Ga0495638_0119991_180_1070 296
79 3300047472 Ga0495686_0012134 Ga0495686_0012134_85_975 296
80 3300053130 Ga0500642_0183066 Ga0500642_0183066_15_905 296
81 3300053139 Ga0500568_0000407 Ga0500568_0000407_16658_17548 296
82 3300005547 Ga0070693_100098019 Ga0070693_1000980192 297
83 3300005337 Ga0070682_100000460 Ga0070682_10000046014 298
84 3300005341 Ga0070691_10001224 Ga0070691_1000122411 298
85 3300005458 Ga0070681_10023004 Ga0070681_100230045 298
86 3300005530 Ga0070679_100007747 Ga0070679_1000077475 298
87 3300005547 Ga0070693_100030784 Ga0070693_1000307841 298
88 3300009093 Ga0105240_10019358 Ga0105240_100193584 298
89 3300009174 Ga0105241_10000113 Ga0105241_100001138 298
90 3300025912 Ga0207707_10000189 Ga0207707_1000018958 298
91 3300025917 Ga0207660_10001432 Ga0207660_100014324 298
92 3300025919 Ga0207657_10484012 Ga0207657_104840121 298
93 3300025921 Ga0207652_10000488 Ga0207652_100004884 298
94 3300025940 Ga0207691_10198653 Ga0207691_101986532 298
95 3300028794 Ga0307515_10000363 Ga0307515_1000036386 298
96 3300030742 Ga0316183_1096868 Ga0316183_109686812 298
97 3300030744 Ga0316181_1101548 Ga0316181_110154825 298
98 3300030745 Ga0316182_1019572 Ga0316182_10195722 298
99 3300005327 Ga0070658_10108503 Ga0070658_101085032 299
100 3300005336 Ga0070680_100060914 Ga0070680_1000609142 299
101 3300013102 Ga0157371_10223896 Ga0157371_102238962 299
102 3300013307 Ga0157372_10002309 Ga0157372_1000230913 299
103 3300013307 Ga0157372_10227576 Ga0157372_102275762 299
104 3300037312 Ga0395899_0145332 Ga0395899_0145332_479_1420 299
105 iso_pu_bacteria 2739367663 2739644797 299
106 3300005347 Ga0070668_100000036 Ga0070668_10000003625 300
107 3300005364 Ga0070673_100000556 Ga0070673_10000055612 300
108 3300005459 Ga0068867_100001821 Ga0068867_1000018212 300
109 3300005616 Ga0068852_100603038 Ga0068852_1006030381 300
110 3300005618 Ga0068864_100001161 Ga0068864_1000011615 300
111 3300009551 Ga0105238_10030766 Ga0105238_100307662 300
112 3300009553 Ga0105249_10007291 Ga0105249_100072912 300
113 3300013104 Ga0157370_10129633 Ga0157370_101296332 300
114 3300013105 Ga0157369_10408171 Ga0157369_104081712 300
115 3300013105 Ga0157369_10504889 Ga0157369_105048892 300
116 3300013296 Ga0157374_10000153 Ga0157374_100001539 300
117 3300013297 Ga0157378_10010369 Ga0157378_100103695 300
118 3300013306 Ga0163162_10000040 Ga0163162_1000004081 300
119 3300013307 Ga0157372_10274047 Ga0157372_102740472 300
120 3300013308 Ga0157375_10000407 Ga0157375_1000040731 300
121 3300014325 Ga0163163_10000110 Ga0163163_1000011060 300
122 3300014968 Ga0157379_10000173 Ga0157379_1000017320 300
123 3300014969 Ga0157376_10000535 Ga0157376_1000053514 300
124 3300025924 Ga0207694_10226276 Ga0207694_102262762 300
125 3300025960 Ga0207651_10000164 Ga0207651_1000016422 300
126 3300025986 Ga0207658_10000225 Ga0207658_1000022550 300
127 3300026041 Ga0207639_10083279 Ga0207639_100832792 300
128 3300044658 Ga0466972_0000422 Ga0466972_0000422_9966_10868 300
129 3300044765 Ga0466970_0001701 Ga0466970_0001701_1911_2813 300
130 iso_pu_bacteria 2902048731 2902049988 300
131 iso_pu_bacteria 2945997725 2946000246 300
132 3300005355 Ga0070671_100011552 Ga0070671_1000115522 302
133 3300005367 Ga0070667_100011374 Ga0070667_1000113746 302
134 3300005457 Ga0070662_100146278 Ga0070662_1001462782 302
135 3300005466 Ga0070685_10069653 Ga0070685_100696532 302
136 3300005548 Ga0070665_100066825 Ga0070665_1000668252 302
137 3300005564 Ga0070664_100026009 Ga0070664_1000260094 302
138 3300005615 Ga0070702_100057982 Ga0070702_1000579821 302
139 3300005618 Ga0068864_100018308 Ga0068864_1000183082 302
140 3300005841 Ga0068863_100035596 Ga0068863_1000355962 302
141 3300005843 Ga0068860_100006095 Ga0068860_1000060953 302
142 3300005843 Ga0068860_100391487 Ga0068860_1003914872 302
143 3300005937 Ga0081455_10006436 Ga0081455_1000643613 302
144 3300006237 Ga0097621_100007197 Ga0097621_1000071974 302
145 3300009093 Ga0105240_10005793 Ga0105240_1000579316 302
146 3300009098 Ga0105245_10012935 Ga0105245_100129353 302
147 3300009177 Ga0105248_10077632 Ga0105248_100776323 302
148 3300009553 Ga0105249_10016226 Ga0105249_100162264 302
149 3300010375 Ga0105239_10159466 Ga0105239_101594663 302
150 3300013296 Ga0157374_10002577 Ga0157374_100025776 302
151 3300014325 Ga0163163_10041043 Ga0163163_100410434 302
152 3300014745 Ga0157377_10037977 Ga0157377_100379772 302
153 3300014968 Ga0157379_10016328 Ga0157379_100163286 302
154 3300014969 Ga0157376_10018612 Ga0157376_100186123 302
155 3300020077 Ga0206351_10014417 Ga0206351_100144171 302
156 3300025900 Ga0207710_10010484 Ga0207710_100104843 302
157 3300025918 Ga0207662_10211728 Ga0207662_102117281 302
158 3300025923 Ga0207681_10068595 Ga0207681_100685952 302
159 3300025927 Ga0207687_10011776 Ga0207687_100117764 302
160 3300025986 Ga0207658_10096055 Ga0207658_100960553 302
161 3300026023 Ga0207677_10013233 Ga0207677_100132332 302
162 3300026035 Ga0207703_10021902 Ga0207703_100219024 302
163 3300026041 Ga0207639_10143031 Ga0207639_101430313 302
164 3300026088 Ga0207641_10008788 Ga0207641_100087886 302
165 3300026095 Ga0207676_10006768 Ga0207676_100067683 302
166 3300045051 Ga0451576_0255567 Ga0451576_0255567_707_1654 302
167 3300046499 Ga0495594_0167424 Ga0495594_0167424_134_1072 302
168 3300048911 Ga0496108_0495320 Ga0496108_0495320_40_978 302
169 3300048912 Ga0496109_0031918 Ga0496109_0031918_1543_2490 302
170 3300053108 Ga0500562_005204 Ga0500562_005204_508_1428 302
171 3300053156 Ga0500622_0000013 Ga0500622_0000013_244024_244944 302
172 iso_pu_bacteria 2842903701 2842906901 302
173 3300005339 Ga0070660_100020708 Ga0070660_1000207082 303
174 3300005366 Ga0070659_100000854 Ga0070659_10000085411 303
175 3300005842 Ga0068858_100067398 Ga0068858_1000673982 303
176 3300006195 Ga0075366_10109368 Ga0075366_101093682 303
177 3300006237 Ga0097621_100059485 Ga0097621_1000594851 303
178 3300013100 Ga0157373_10001334 Ga0157373_100013346 303
179 3300013100 Ga0157373_10003110 Ga0157373_1000311011 303
180 3300014969 Ga0157376_10056339 Ga0157376_100563393 303
181 3300025919 Ga0207657_10020350 Ga0207657_100203505 303
182 3300025932 Ga0207690_10011362 Ga0207690_100113623 303
183 3300025942 Ga0207689_10058561 Ga0207689_100585612 303
184 3300025986 Ga0207658_10124532 Ga0207658_101245322 303
185 3300026035 Ga0207703_10128359 Ga0207703_101283591 303
186 3300042876 Ga0451577_0157238 Ga0451577_0157238_382_1365 303
187 3300049587 Ga0501071_0248380 Ga0501071_0248380_234_1163 303
188 3300049677 Ga0501247_001902 Ga0501247_001902_500_1414 303
189 3300049741 Ga0501079_0447072 Ga0501079_0447072_57_986 303
190 3300049744 Ga0501083_0071386 Ga0501083_0071386_843_1772 303
191 3300049823 Ga0501044_0162257 Ga0501044_0162257_865_1794 303
192 3300054114 Ga0501084_0038969 Ga0501084_0038969_2679_3608 303
193 3300005842 Ga0068858_100092182 Ga0068858_1000921822 304
194 3300025900 Ga0207710_10001464 Ga0207710_1000146411 304
195 3300025961 Ga0207712_10028628 Ga0207712_100286283 304
196 3300042876 Ga0451577_0013930 Ga0451577_0013930_3921_4856 304
197 3300044712 Ga0453684_0006335 Ga0453684_0006335_8341_9276 304
198 3300045051 Ga0451576_0060223 Ga0451576_0060223_1839_2774 304
199 3300048917 Ga0496114_0001392 Ga0496114_0001392_7756_8706 304
200 3300049823 Ga0501044_0216523 Ga0501044_0216523_279_1202 304
201 3300005331 Ga0070670_100177302 Ga0070670_1001773022 305
202 3300005337 Ga0070682_100000306 Ga0070682_10000030617 305
203 3300005338 Ga0068868_100015825 Ga0068868_1000158255 305
204 3300005355 Ga0070671_100046359 Ga0070671_1000463593 305
205 3300005364 Ga0070673_100156313 Ga0070673_1001563132 305
206 3300005618 Ga0068864_100316386 Ga0068864_1003163862 305
207 3300013297 Ga0157378_10023782 Ga0157378_100237822 305
208 3300013308 Ga0157375_10191021 Ga0157375_101910211 305
209 3300025925 Ga0207650_10104098 Ga0207650_101040982 305
210 3300026023 Ga0207677_10050302 Ga0207677_100503022 305
211 3300026095 Ga0207676_10112939 Ga0207676_101129392 305
212 3300005563 Ga0068855_100001248 Ga0068855_1000012484 306
213 3300005617 Ga0068859_100184709 Ga0068859_1001847092 306
214 3300005843 Ga0068860_100019647 Ga0068860_1000196472 306
215 3300006931 Ga0097620_100184711 Ga0097620_1001847112 306
216 3300013105 Ga0157369_10046328 Ga0157369_100463285 306
217 3300013297 Ga0157378_10258016 Ga0157378_102580162 306
218 3300025913 Ga0207695_10002088 Ga0207695_1000208820 306
219 3300025949 Ga0207667_10005017 Ga0207667_100050179 306
220 3300025986 Ga0207658_10220125 Ga0207658_102201252 306
221 3300028381 Ga0268264_10059000 Ga0268264_100590002 306
222 3300044901 Ga0466960_0024051 Ga0466960_0024051_1409_2335 306
223 3300049574 Ga0501038_0080968 Ga0501038_0080968_1191_2111 306
224 3300049579 Ga0501043_0178880 Ga0501043_0178880_711_1631 306
225 3300049823 Ga0501044_0075924 Ga0501044_0075924_1825_2745 306
226 3300042876 Ga0451577_0009739 Ga0451577_0009739_4279_5202 307
227 3300020069 Ga0197907_10213375 Ga0197907_102133751 308
228 3300020076 Ga0206355_1202739 Ga0206355_12027391 308
229 3300020076 Ga0206355_1209081 Ga0206355_12090811 308
230 3300020080 Ga0206350_10401402 Ga0206350_104014021 308
231 3300003320 rootH2_10196887 rootH2_101968871 310
232 3300003323 rootH1_10155535 rootH1_101555353 310
233 3300013100 Ga0157373_10000161 Ga0157373_1000016113 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19420

DDAH_eukar

N,N dimethylarginine dimethylhydrolase, eukaryotic

49

333

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8666 7 305
6jv0-assembly1.cif.gz_A crystal structure of n-terminal domain of argz, bound to product, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8635 7 305
6jv1-assembly1.cif.gz_A crystal structure of n-terminal domain of argz, c264s mutant, bound to substrate, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8592 7 305
6juz-assembly1.cif.gz_A crystal structure of n-terminal domain of argz(n71s) covalently bond to a reaction intermediate 0.8588 7 305
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.8535 7 308
ID Description Score Start End Superfamily
af_Q86KZ6_15_316_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9541 15 298 3.75.10.10
af_Q8C5H8_56_229_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8964 39 66 3.40.50.10330
af_Q86KZ6_15_316_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.895 15 298 3.75.10.10
af_Q4D5L9_1_215_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8805 124 295 3.75.10.10
af_A0A7I9BCB0_10_272_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8652 6 301 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A519X4V2-F1-model_v4 Amidinotransferase 0.9988 187 304 GO:0016740
AF-A0A520DLR0-F1-model_v4 Amidinotransferase 0.9976 58 307 GO:0016740
AF-A0A7W1KSV6-F1-model_v4 Amidinotransferase 0.9948 64 307 GO:0016740
AF-A0A348VB39-F1-model_v4 Amidinotransferase 0.9947 133 301 GO:0016740
AF-A0A0B7I5I5-F1-model_v4 deleted 0.9945 193 302

Feature Viewer

pLDDT pTM Quality
92.01 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map