F346117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 233 | 161 | 233 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10798048|Ga0157372_107980482 |
| Length | 219 |
| Sequence | MLVEFRRLFLEESKGMADFTRKCLAQVRSNHRRKARGGVNPIATFTIVAATAVLAIVSAVLYAQGQERDKYSLRSPDGIAFSDFRGYEDWAVASSARTDEVQKVIVANPAMIRAYKAGIPRNGQPFPEGSRMVKLQWSQEKNKEATFPVDVPDVFKQAFVMEKDSKRFPKTGGWGYAVFNYDAASHEFTADATAHADCGNTCHVAVKTKDYIFHPYEIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 61 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 62 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 102 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 103 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 110 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 111 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 112 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 155 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 156 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 157 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 158 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 161 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.86 |
| Nodule | 0 |
| Rhizoplane | 0.43 |
| Rhizosphere | 91.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10031662 | 3300003316 | Bacteria | 1458 |
| 2 | Ga0065712_10014346 | 3300005290 | Bacteria | 1865 |
| 3 | Ga0070683_100415052 | 3300005329 | Bacteria | 1284 |
| 4 | Ga0070683_100597197 | 3300005329 | Bacteria | 1056 |
| 5 | Ga0070670_100121138 | 3300005331 | Bacteria | 2257 |
| 6 | Ga0068869_100405934 | 3300005334 | Bacteria | 1121 |
| 7 | Ga0070666_10099877 | 3300005335 | Bacteria | 1999 |
| 8 | Ga0068868_100075391 | 3300005338 | Bacteria | 2696 |
| 9 | Ga0070661_100018540 | 3300005344 | Bacteria | 4949 |
| 10 | Ga0070671_100007607 | 3300005355 | Bacteria | 8665 |
| 11 | Ga0070671_100078601 | 3300005355 | Bacteria | 2757 |
| 12 | Ga0070671_100862129 | 3300005355 | Bacteria | 790 |
| 13 | Ga0070673_100184692 | 3300005364 | Bacteria | 1787 |
| 14 | Ga0070673_100244738 | 3300005364 | Bacteria | 1561 |
| 15 | Ga0070667_100002801 | 3300005367 | Bacteria | 15050 |
| 16 | Ga0070667_100052092 | 3300005367 | Bacteria | 3452 |
| 17 | Ga0070667_100054882 | 3300005367 | Bacteria | 3365 |
| 18 | Ga0070714_101188794 | 3300005435 | Bacteria | 744 |
| 19 | Ga0070713_100122165 | 3300005436 | Bacteria | 2286 |
| 20 | Ga0070713_100252540 | 3300005436 | Bacteria | 1609 |
| 21 | Ga0070710_10319450 | 3300005437 | Bacteria | 1019 |
| 22 | Ga0070711_100254210 | 3300005439 | Bacteria | 1380 |
| 23 | Ga0070663_100734354 | 3300005455 | Bacteria | 842 |
| 24 | Ga0068867_100255031 | 3300005459 | Bacteria | 1428 |
| 25 | Ga0068867_100712032 | 3300005459 | Bacteria | 887 |
| 26 | Ga0070684_100123011 | 3300005535 | Bacteria | 2335 |
| 27 | Ga0068853_100000203 | 3300005539 | Bacteria | 41915 |
| 28 | Ga0068853_100024091 | 3300005539 | Bacteria | 5101 |
| 29 | Ga0068853_100036751 | 3300005539 | Bacteria | 4165 |
| 30 | Ga0068853_100113257 | 3300005539 | Bacteria | 2412 |
| 31 | Ga0068853_100347501 | 3300005539 | Bacteria | 1379 |
| 32 | Ga0070686_100425133 | 3300005544 | Bacteria | 1016 |
| 33 | Ga0070693_100003298 | 3300005547 | Bacteria | 7497 |
| 34 | Ga0070665_100000283 | 3300005548 | Bacteria | 82138 |
| 35 | Ga0070665_100004367 | 3300005548 | Bacteria | 14873 |
| 36 | Ga0068855_100002544 | 3300005563 | Bacteria | 22454 |
| 37 | Ga0068855_100011971 | 3300005563 | Bacteria | 10487 |
| 38 | Ga0068855_100364148 | 3300005563 | Bacteria | 1590 |
| 39 | Ga0070664_100110991 | 3300005564 | Unclassified | 2393 |
| 40 | Ga0068857_100096529 | 3300005577 | Bacteria | 2649 |
| 41 | Ga0068857_100725972 | 3300005577 | Bacteria | 945 |
| 42 | Ga0068854_100073320 | 3300005578 | Bacteria | 2509 |
| 43 | Ga0068854_100137605 | 3300005578 | Bacteria | 1871 |
| 44 | Ga0068854_100325863 | 3300005578 | Bacteria | 1250 |
| 45 | Ga0068856_100003050 | 3300005614 | Bacteria | 17138 |
| 46 | Ga0068852_100000082 | 3300005616 | Bacteria | 67016 |
| 47 | Ga0068859_100031511 | 3300005617 | Bacteria | 5324 |
| 48 | Ga0068851_10065598 | 3300005834 | Unclassified | 1869 |
| 49 | Ga0068851_10167299 | 3300005834 | Bacteria | 1211 |
| 50 | Ga0068863_100124479 | 3300005841 | Bacteria | 2459 |
| 51 | Ga0068858_100022861 | 3300005842 | Bacteria | 5832 |
| 52 | Ga0068860_100152467 | 3300005843 | Bacteria | 2226 |
| 53 | Ga0081539_10001162 | 3300005985 | Bacteria | 47608 |
| 54 | Ga0097621_100136900 | 3300006237 | Bacteria | 2089 |
| 55 | Ga0097621_100334626 | 3300006237 | Bacteria | 1343 |
| 56 | Ga0097621_100565148 | 3300006237 | Bacteria | 1036 |
| 57 | Ga0068871_100220383 | 3300006358 | Bacteria | 1643 |
| 58 | Ga0068865_100009655 | 3300006881 | Bacteria | 5985 |
| 59 | Ga0068865_100375304 | 3300006881 | Bacteria | 1158 |
| 60 | Ga0075436_100230477 | 3300006914 | Bacteria | 1316 |
| 61 | Ga0097620_100031515 | 3300006931 | Bacteria | 5324 |
| 62 | Ga0075435_100112981 | 3300007076 | Bacteria | 2260 |
| 63 | Ga0105240_10002743 | 3300009093 | Bacteria | 27862 |
| 64 | Ga0105240_10017353 | 3300009093 | Bacteria | 9704 |
| 65 | Ga0105240_10043401 | 3300009093 | Bacteria | 5721 |
| 66 | Ga0105241_10000382 | 3300009174 | Bacteria | 33682 |
| 67 | Ga0105242_10823487 | 3300009176 | Bacteria | 921 |
| 68 | Ga0105248_10165934 | 3300009177 | Bacteria | 2490 |
| 69 | Ga0105237_10014777 | 3300009545 | Bacteria | 8148 |
| 70 | Ga0105237_10624857 | 3300009545 | Bacteria | 1084 |
| 71 | Ga0105238_10094554 | 3300009551 | Bacteria | 2977 |
| 72 | Ga0105238_10129818 | 3300009551 | Bacteria | 2498 |
| 73 | Ga0105238_10608225 | 3300009551 | Bacteria | 1101 |
| 74 | Ga0105249_10314756 | 3300009553 | Bacteria | 1575 |
| 75 | Ga0105239_10049412 | 3300010375 | Bacteria | 4612 |
| 76 | Ga0105239_11178315 | 3300010375 | Bacteria | 883 |
| 77 | Ga0157370_10058845 | 3300013104 | Bacteria | 3652 |
| 78 | Ga0157369_10027646 | 3300013105 | Bacteria | 6285 |
| 79 | Ga0157369_10108422 | 3300013105 | Bacteria | 2953 |
| 80 | Ga0157369_10118151 | 3300013105 | Unclassified | 2814 |
| 81 | Ga0157369_10259456 | 3300013105 | Bacteria | 1812 |
| 82 | Ga0157374_10261801 | 3300013296 | Bacteria | 1704 |
| 83 | Ga0157374_10340560 | 3300013296 | Bacteria | 1489 |
| 84 | Ga0157378_10005460 | 3300013297 | Bacteria | 11136 |
| 85 | Ga0157378_10101100 | 3300013297 | Unclassified | 2633 |
| 86 | Ga0157378_10171244 | 3300013297 | Bacteria | 2036 |
| 87 | Ga0163162_10008421 | 3300013306 | Bacteria | 10056 |
| 88 | Ga0157372_10011408 | 3300013307 | Bacteria | 9452 |
| 89 | Ga0157372_10247804 | 3300013307 | Bacteria | 2067 |
| 90 | Ga0157372_10798048 | 3300013307 | Bacteria | 1097 |
| 91 | Ga0157375_10784418 | 3300013308 | Bacteria | 1102 |
| 92 | Ga0163163_10082928 | 3300014325 | Bacteria | 3211 |
| 93 | Ga0157379_10067194 | 3300014968 | Bacteria | 3205 |
| 94 | Ga0157379_10337794 | 3300014968 | Bacteria | 1377 |
| 95 | Ga0157379_10869772 | 3300014968 | Bacteria | 854 |
| 96 | Ga0157376_10100817 | 3300014969 | Bacteria | 2522 |
| 97 | Ga0163161_10200236 | 3300017792 | Bacteria | 1539 |
| 98 | Ga0213873_10028453 | 3300021358 | Bacteria | 1371 |
| 99 | Ga0224572_1019115 | 3300024225 | Bacteria | 1317 |
| 100 | Ga0228598_1018674 | 3300024227 | Bacteria | 1368 |
| 101 | Ga0209026_1017087 | 3300025250 | Bacteria | 1165 |
| 102 | Ga0207656_10116710 | 3300025321 | Bacteria | 1239 |
| 103 | Ga0207688_10319610 | 3300025901 | Bacteria | 952 |
| 104 | Ga0207680_10031147 | 3300025903 | Bacteria | 3019 |
| 105 | Ga0207647_10051055 | 3300025904 | Bacteria | 2558 |
| 106 | Ga0207654_10000034 | 3300025911 | Bacteria | 113041 |
| 107 | Ga0207654_10000099 | 3300025911 | Bacteria | 57684 |
| 108 | Ga0207695_10000561 | 3300025913 | Bacteria | 76257 |
| 109 | Ga0207695_10003769 | 3300025913 | Bacteria | 21043 |
| 110 | Ga0207695_10138594 | 3300025913 | Bacteria | 2384 |
| 111 | Ga0207695_10382938 | 3300025913 | Eukaryota | 1292 |
| 112 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 113 | Ga0207671_10077892 | 3300025914 | Bacteria | 2482 |
| 114 | Ga0207663_10507941 | 3300025916 | Bacteria | 937 |
| 115 | Ga0207649_10001279 | 3300025920 | Bacteria | 15025 |
| 116 | Ga0207694_10000112 | 3300025924 | Bacteria | 85385 |
| 117 | Ga0207694_10063891 | 3300025924 | Bacteria | 2868 |
| 118 | Ga0207694_10136017 | 3300025924 | Bacteria | 1974 |
| 119 | Ga0207687_10635706 | 3300025927 | Bacteria | 902 |
| 120 | Ga0207700_10001777 | 3300025928 | Bacteria | 12232 |
| 121 | Ga0207704_10110487 | 3300025938 | Bacteria | 1857 |
| 122 | Ga0207711_10102870 | 3300025941 | Bacteria | 2529 |
| 123 | Ga0207689_10000935 | 3300025942 | Bacteria | 28042 |
| 124 | Ga0207689_10091734 | 3300025942 | Bacteria | 2496 |
| 125 | Ga0207661_10541120 | 3300025944 | Bacteria | 1066 |
| 126 | Ga0207667_10005686 | 3300025949 | Bacteria | 15203 |
| 127 | Ga0207667_10071320 | 3300025949 | Bacteria | 3612 |
| 128 | Ga0207667_10077646 | 3300025949 | Bacteria | 3443 |
| 129 | Ga0207667_10251205 | 3300025949 | Bacteria | 1809 |
| 130 | Ga0207640_10017197 | 3300025981 | Bacteria | 4225 |
| 131 | Ga0207640_10280761 | 3300025981 | Bacteria | 1308 |
| 132 | Ga0207658_10043862 | 3300025986 | Bacteria | 3254 |
| 133 | Ga0207658_10174471 | 3300025986 | Unclassified | 1774 |
| 134 | Ga0207658_10550717 | 3300025986 | Bacteria | 1032 |
| 135 | Ga0207677_10062334 | 3300026023 | Bacteria | 2586 |
| 136 | Ga0207677_11130101 | 3300026023 | Bacteria | 715 |
| 137 | Ga0207703_10010946 | 3300026035 | Bacteria | 7070 |
| 138 | Ga0207703_10193382 | 3300026035 | Bacteria | 1804 |
| 139 | Ga0207639_10000233 | 3300026041 | Bacteria | 41490 |
| 140 | Ga0207639_10034663 | 3300026041 | Unclassified | 3731 |
| 141 | Ga0207639_10345814 | 3300026041 | Bacteria | 1327 |
| 142 | Ga0207678_10100211 | 3300026067 | Bacteria | 2474 |
| 143 | Ga0207702_10011105 | 3300026078 | Bacteria | 7518 |
| 144 | Ga0207641_10059405 | 3300026088 | Bacteria | 3256 |
| 145 | Ga0207648_10357979 | 3300026089 | Bacteria | 1316 |
| 146 | Ga0207676_10074148 | 3300026095 | Bacteria | 2741 |
| 147 | Ga0207674_10008197 | 3300026116 | Bacteria | 12107 |
| 148 | Ga0207698_10000066 | 3300026142 | Bacteria | 70450 |
| 149 | Ga0265357_1002061 | 3300028023 | Bacteria | 1590 |
| 150 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 151 | Ga0268264_11006458 | 3300028381 | Bacteria | 840 |
| 152 | Ga0265336_10001257 | 3300028666 | Bacteria | 12007 |
| 153 | Ga0265338_10005180 | 3300028800 | Bacteria | 17115 |
| 154 | Ga0265338_10310707 | 3300028800 | Bacteria | 1143 |
| 155 | Ga0307511_10007737 | 3300030521 | Bacteria | 10800 |
| 156 | Ga0265760_10000042 | 3300031090 | Bacteria | 38544 |
| 157 | Ga0265760_10000566 | 3300031090 | Bacteria | 10521 |
| 158 | Ga0265330_10001393 | 3300031235 | Bacteria | 14131 |
| 159 | Ga0265328_10089665 | 3300031239 | Bacteria | 1136 |
| 160 | Ga0265325_10001858 | 3300031241 | Bacteria | 14582 |
| 161 | Ga0265339_10017161 | 3300031249 | Bacteria | 4292 |
| 162 | Ga0265339_10040028 | 3300031249 | Bacteria | 2606 |
| 163 | Ga0265331_10016838 | 3300031250 | Bacteria | 3827 |
| 164 | Ga0265316_10005953 | 3300031344 | Bacteria | 11743 |
| 165 | Ga0265316_10011855 | 3300031344 | Bacteria | 7840 |
| 166 | Ga0265316_10045610 | 3300031344 | Bacteria | 3479 |
| 167 | Ga0307508_10318182 | 3300031616 | Bacteria | 1148 |
| 168 | Ga0307508_10360806 | 3300031616 | Bacteria | 1044 |
| 169 | Ga0265314_10199774 | 3300031711 | Bacteria | 1183 |
| 170 | Ga0265342_10012649 | 3300031712 | Bacteria | 5708 |
| 171 | Ga0307411_10132568 | 3300032005 | Bacteria | 1824 |
| 172 | Ga0307507_10521061 | 3300033179 | Bacteria | 635 |
| 173 | Ga0316215_1007110 | 3300033544 | Bacteria | 1089 |
| 174 | Ga0373956_0014190 | 3300035119 | Bacteria | 3325 |
| 175 | Ga0373957_0095765 | 3300035120 | Bacteria | 1184 |
| 176 | Ga0373955_0060988 | 3300035172 | Bacteria | 2082 |
| 177 | Ga0373955_0091848 | 3300035172 | Bacteria | 1731 |
| 178 | Ga0373933_0001098 | 3300035724 | Bacteria | 16126 |
| 179 | Ga0373937_0000048 | 3300036401 | Bacteria | 106296 |
| 180 | Ga0373937_0042290 | 3300036401 | Bacteria | 4156 |
| 181 | Ga0373937_0086443 | 3300036401 | Bacteria | 2902 |
| 182 | Ga0373937_0603151 | 3300036401 | Bacteria | 1042 |
| 183 | Ga0373925_0258305 | 3300037068 | Bacteria | 1399 |
| 184 | Ga0395905_0351093 | 3300037471 | Bacteria | 1367 |
| 185 | Ga0436363_0507950 | 3300039450 | Bacteria | 1019 |
| 186 | Ga0436363_1083683 | 3300039450 | Bacteria | 708 |
| 187 | Ga0495638_0010345 | 3300046460 | Bacteria | 6488 |
| 188 | Ga0495641_0190957 | 3300046461 | Bacteria | 918 |
| 189 | Ga0495651_0033404 | 3300046462 | Bacteria | 4013 |
| 190 | Ga0495651_0068375 | 3300046462 | Bacteria | 2708 |
| 191 | Ga0495651_0404004 | 3300046462 | Bacteria | 891 |
| 192 | Ga0495653_0142862 | 3300046463 | Bacteria | 1681 |
| 193 | Ga0495650_0033212 | 3300046471 | Bacteria | 2299 |
| 194 | Ga0495582_0024273 | 3300046473 | Bacteria | 3316 |
| 195 | Ga0495664_0015309 | 3300046477 | Bacteria | 4358 |
| 196 | Ga0495618_0306062 | 3300046514 | Bacteria | 987 |
| 197 | Ga0495630_0053331 | 3300046517 | Bacteria | 3028 |
| 198 | Ga0495643_0133308 | 3300046522 | Bacteria | 1245 |
| 199 | Ga0495652_0026792 | 3300046529 | Bacteria | 5087 |
| 200 | Ga0495652_0116621 | 3300046529 | Bacteria | 2137 |
| 201 | Ga0495587_0000866 | 3300046536 | Bacteria | 20006 |
| 202 | Ga0495667_0481391 | 3300046559 | Bacteria | 778 |
| 203 | Ga0495656_0196111 | 3300046615 | Bacteria | 1000 |
| 204 | Ga0495656_0461085 | 3300046615 | Bacteria | 670 |
| 205 | Ga0495625_0002562 | 3300046660 | Bacteria | 19523 |
| 206 | Ga0495635_0253068 | 3300046663 | Bacteria | 1187 |
| 207 | Ga0495599_0175151 | 3300046678 | Bacteria | 1323 |
| 208 | Ga0495646_0087214 | 3300046680 | Bacteria | 1809 |
| 209 | Ga0495600_0132208 | 3300046809 | Bacteria | 1622 |
| 210 | Ga0495604_0052990 | 3300047317 | Bacteria | 3139 |
| 211 | Ga0495636_0000021 | 3300047318 | Bacteria | 72964 |
| 212 | Ga0495674_0034178 | 3300047319 | Bacteria | 4599 |
| 213 | Ga0495680_0090108 | 3300047322 | Bacteria | 2301 |
| 214 | Ga0495675_0005469 | 3300047444 | Bacteria | 7750 |
| 215 | Ga0495686_0201986 | 3300047472 | Bacteria | 1140 |
| 216 | Ga0495602_0000442 | 3300048088 | Bacteria | 38967 |
| 217 | Ga0496105_0421641 | 3300048908 | Bacteria | 1056 |
| 218 | Ga0495682_0123519 | 3300049460 | Bacteria | 927 |
| 219 | nmdc:mga0rr50_618392_c1 | 3300050513 | Bacteria | 924 |
| 220 | nmdc:mga08x19_375183_c1 | 3300050514 | Bacteria | 996 |
| 221 | nmdc:mga0a205_323959_c1 | 3300050515 | Bacteria | 1411 |
| 222 | Ga0495612_0059112 | 3300053078 | Bacteria | 1585 |
| 223 | Ga0495595_0038799 | 3300053084 | Bacteria | 2171 |
| 224 | Ga0495619_0106786 | 3300053085 | Bacteria | 1909 |
| 225 | Ga0500643_004142 | 3300053087 | Bacteria | 6660 |
| 226 | Ga0500583_0001325 | 3300053092 | Bacteria | 7068 |
| 227 | Ga0500651_0086958 | 3300053093 | Bacteria | 1930 |
| 228 | Ga0500595_000007 | 3300053119 | Bacteria | 289461 |
| 229 | Ga0500597_000023 | 3300053120 | Bacteria | 33502 |
| 230 | Ga0500568_0000179 | 3300053139 | Bacteria | 55301 |
| 231 | Ga0500568_0007262 | 3300053139 | Bacteria | 5457 |
| 232 | Ga0500622_0197970 | 3300053156 | Bacteria | 916 |
| 233 | Ga0500637_0005747 | 3300053178 | Bacteria | 6038 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031235 | Ga0265330_10001393 | Ga0265330_1000139317 | 156 |
| 2 | 3300031241 | Ga0265325_10001858 | Ga0265325_100018583 | 156 |
| 3 | 3300031249 | Ga0265339_10017161 | Ga0265339_100171613 | 156 |
| 4 | 3300031344 | Ga0265316_10011855 | Ga0265316_100118554 | 156 |
| 5 | 3300031712 | Ga0265342_10012649 | Ga0265342_100126494 | 156 |
| 6 | 3300028800 | Ga0265338_10005180 | Ga0265338_1000518013 | 159 |
| 7 | 3300031239 | Ga0265328_10089665 | Ga0265328_100896651 | 159 |
| 8 | 3300031249 | Ga0265339_10040028 | Ga0265339_100400284 | 159 |
| 9 | 3300031344 | Ga0265316_10045610 | Ga0265316_100456101 | 159 |
| 10 | 3300033544 | Ga0316215_1007110 | Ga0316215_10071101 | 159 |
| 11 | 3300024227 | Ga0228598_1018674 | Ga0228598_10186741 | 160 |
| 12 | 3300024225 | Ga0224572_1019115 | Ga0224572_10191151 | 163 |
| 13 | 3300031090 | Ga0265760_10000042 | Ga0265760_1000004222 | 163 |
| 14 | 3300005367 | Ga0070667_100002801 | Ga0070667_10000280113 | 164 |
| 15 | 3300005548 | Ga0070665_100000283 | Ga0070665_10000028355 | 164 |
| 16 | 3300009545 | Ga0105237_10624857 | Ga0105237_106248571 | 164 |
| 17 | 3300009551 | Ga0105238_10608225 | Ga0105238_106082252 | 164 |
| 18 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012316 | 164 |
| 19 | 3300005290 | Ga0065712_10014346 | Ga0065712_100143463 | 166 |
| 20 | 3300005355 | Ga0070671_100007607 | Ga0070671_1000076078 | 166 |
| 21 | 3300005364 | Ga0070673_100244738 | Ga0070673_1002447381 | 166 |
| 22 | 3300005455 | Ga0070663_100734354 | Ga0070663_1007343541 | 166 |
| 23 | 3300005459 | Ga0068867_100255031 | Ga0068867_1002550312 | 166 |
| 24 | 3300005617 | Ga0068859_100031511 | Ga0068859_1000315113 | 166 |
| 25 | 3300005841 | Ga0068863_100124479 | Ga0068863_1001244792 | 166 |
| 26 | 3300005842 | Ga0068858_100022861 | Ga0068858_1000228615 | 166 |
| 27 | 3300006237 | Ga0097621_100136900 | Ga0097621_1001369001 | 166 |
| 28 | 3300006881 | Ga0068865_100375304 | Ga0068865_1003753042 | 166 |
| 29 | 3300006931 | Ga0097620_100031515 | Ga0097620_1000315153 | 166 |
| 30 | 3300009177 | Ga0105248_10165934 | Ga0105248_101659344 | 166 |
| 31 | 3300009553 | Ga0105249_10314756 | Ga0105249_103147561 | 166 |
| 32 | 3300010375 | Ga0105239_11178315 | Ga0105239_111783151 | 166 |
| 33 | 3300013297 | Ga0157378_10005460 | Ga0157378_1000546010 | 166 |
| 34 | 3300013297 | Ga0157378_10171244 | Ga0157378_101712442 | 166 |
| 35 | 3300013306 | Ga0163162_10008421 | Ga0163162_100084213 | 166 |
| 36 | 3300014968 | Ga0157379_10067194 | Ga0157379_100671943 | 166 |
| 37 | 3300014968 | Ga0157379_10337794 | Ga0157379_103377942 | 166 |
| 38 | 3300014969 | Ga0157376_10100817 | Ga0157376_101008174 | 166 |
| 39 | 3300025901 | Ga0207688_10319610 | Ga0207688_103196102 | 166 |
| 40 | 3300025904 | Ga0207647_10051055 | Ga0207647_100510553 | 166 |
| 41 | 3300025927 | Ga0207687_10635706 | Ga0207687_106357061 | 166 |
| 42 | 3300025938 | Ga0207704_10110487 | Ga0207704_101104872 | 166 |
| 43 | 3300025941 | Ga0207711_10102870 | Ga0207711_101028704 | 166 |
| 44 | 3300025942 | Ga0207689_10000935 | Ga0207689_1000093519 | 166 |
| 45 | 3300026023 | Ga0207677_10062334 | Ga0207677_100623342 | 166 |
| 46 | 3300026035 | Ga0207703_10010946 | Ga0207703_100109462 | 166 |
| 47 | 3300026088 | Ga0207641_10059405 | Ga0207641_100594054 | 166 |
| 48 | 3300026089 | Ga0207648_10357979 | Ga0207648_103579792 | 166 |
| 49 | 3300035120 | Ga0373957_0095765 | Ga0373957_0095765_292_825 | 166 |
| 50 | 3300035172 | Ga0373955_0060988 | Ga0373955_0060988_574_1107 | 166 |
| 51 | 3300036401 | Ga0373937_0042290 | Ga0373937_0042290_3191_3724 | 166 |
| 52 | 3300036401 | Ga0373937_0603151 | Ga0373937_0603151_316_849 | 166 |
| 53 | 3300039450 | Ga0436363_1083683 | Ga0436363_1083683_82_681 | 166 |
| 54 | 3300046462 | Ga0495651_0068375 | Ga0495651_0068375_1507_2037 | 166 |
| 55 | 3300046462 | Ga0495651_0404004 | Ga0495651_0404004_191_724 | 166 |
| 56 | 3300046477 | Ga0495664_0015309 | Ga0495664_0015309_1217_1747 | 166 |
| 57 | 3300046529 | Ga0495652_0116621 | Ga0495652_0116621_556_1086 | 166 |
| 58 | 3300046559 | Ga0495667_0481391 | Ga0495667_0481391_230_760 | 166 |
| 59 | 3300046663 | Ga0495635_0253068 | Ga0495635_0253068_304_834 | 166 |
| 60 | 3300046809 | Ga0495600_0132208 | Ga0495600_0132208_463_993 | 166 |
| 61 | 3300047317 | Ga0495604_0052990 | Ga0495604_0052990_2467_2997 | 166 |
| 62 | 3300047322 | Ga0495680_0090108 | Ga0495680_0090108_1245_1778 | 166 |
| 63 | 3300048908 | Ga0496105_0421641 | Ga0496105_0421641_208_738 | 166 |
| 64 | 3300053078 | Ga0495612_0059112 | Ga0495612_0059112_454_987 | 166 |
| 65 | 3300053084 | Ga0495595_0038799 | Ga0495595_0038799_462_995 | 166 |
| 66 | 3300053085 | Ga0495619_0106786 | Ga0495619_0106786_570_1103 | 166 |
| 67 | 3300053119 | Ga0500595_000007 | Ga0500595_000007_240230_240763 | 166 |
| 68 | 3300005329 | Ga0070683_100415052 | Ga0070683_1004150522 | 167 |
| 69 | 3300005331 | Ga0070670_100121138 | Ga0070670_1001211381 | 167 |
| 70 | 3300005335 | Ga0070666_10099877 | Ga0070666_100998773 | 167 |
| 71 | 3300005338 | Ga0068868_100075391 | Ga0068868_1000753912 | 167 |
| 72 | 3300005355 | Ga0070671_100078601 | Ga0070671_1000786012 | 167 |
| 73 | 3300005355 | Ga0070671_100862129 | Ga0070671_1008621292 | 167 |
| 74 | 3300005364 | Ga0070673_100184692 | Ga0070673_1001846922 | 167 |
| 75 | 3300005367 | Ga0070667_100052092 | Ga0070667_1000520922 | 167 |
| 76 | 3300005367 | Ga0070667_100054882 | Ga0070667_1000548826 | 167 |
| 77 | 3300005437 | Ga0070710_10319450 | Ga0070710_103194502 | 167 |
| 78 | 3300005439 | Ga0070711_100254210 | Ga0070711_1002542102 | 167 |
| 79 | 3300005539 | Ga0068853_100024091 | Ga0068853_1000240914 | 167 |
| 80 | 3300005539 | Ga0068853_100113257 | Ga0068853_1001132572 | 167 |
| 81 | 3300005539 | Ga0068853_100347501 | Ga0068853_1003475011 | 167 |
| 82 | 3300005547 | Ga0070693_100003298 | Ga0070693_10000329811 | 167 |
| 83 | 3300005548 | Ga0070665_100004367 | Ga0070665_10000436710 | 167 |
| 84 | 3300005563 | Ga0068855_100011971 | Ga0068855_1000119712 | 167 |
| 85 | 3300005563 | Ga0068855_100364148 | Ga0068855_1003641482 | 167 |
| 86 | 3300005564 | Ga0070664_100110991 | Ga0070664_1001109915 | 167 |
| 87 | 3300005577 | Ga0068857_100725972 | Ga0068857_1007259722 | 167 |
| 88 | 3300005578 | Ga0068854_100137605 | Ga0068854_1001376052 | 167 |
| 89 | 3300005834 | Ga0068851_10065598 | Ga0068851_100655981 | 167 |
| 90 | 3300005843 | Ga0068860_100152467 | Ga0068860_1001524673 | 167 |
| 91 | 3300006237 | Ga0097621_100565148 | Ga0097621_1005651482 | 167 |
| 92 | 3300006358 | Ga0068871_100220383 | Ga0068871_1002203832 | 167 |
| 93 | 3300006881 | Ga0068865_100009655 | Ga0068865_1000096555 | 167 |
| 94 | 3300006914 | Ga0075436_100230477 | Ga0075436_1002304772 | 167 |
| 95 | 3300009093 | Ga0105240_10043401 | Ga0105240_100434012 | 167 |
| 96 | 3300009176 | Ga0105242_10823487 | Ga0105242_108234871 | 167 |
| 97 | 3300009551 | Ga0105238_10129818 | Ga0105238_101298182 | 167 |
| 98 | 3300010375 | Ga0105239_10049412 | Ga0105239_100494124 | 167 |
| 99 | 3300013105 | Ga0157369_10027646 | Ga0157369_100276462 | 167 |
| 100 | 3300013296 | Ga0157374_10340560 | Ga0157374_103405602 | 167 |
| 101 | 3300013308 | Ga0157375_10784418 | Ga0157375_107844181 | 167 |
| 102 | 3300014325 | Ga0163163_10082928 | Ga0163163_100829284 | 167 |
| 103 | 3300014968 | Ga0157379_10869772 | Ga0157379_108697721 | 167 |
| 104 | 3300025903 | Ga0207680_10031147 | Ga0207680_100311471 | 167 |
| 105 | 3300025913 | Ga0207695_10138594 | Ga0207695_101385941 | 167 |
| 106 | 3300025913 | Ga0207695_10382938 | Ga0207695_103829382 | 167 |
| 107 | 3300025916 | Ga0207663_10507941 | Ga0207663_105079412 | 167 |
| 108 | 3300025924 | Ga0207694_10136017 | Ga0207694_101360172 | 167 |
| 109 | 3300025949 | Ga0207667_10005686 | Ga0207667_100056863 | 167 |
| 110 | 3300025949 | Ga0207667_10077646 | Ga0207667_100776463 | 167 |
| 111 | 3300025986 | Ga0207658_10043862 | Ga0207658_100438625 | 167 |
| 112 | 3300025986 | Ga0207658_10174471 | Ga0207658_101744713 | 167 |
| 113 | 3300025986 | Ga0207658_10550717 | Ga0207658_105507172 | 167 |
| 114 | 3300026023 | Ga0207677_11130101 | Ga0207677_111301011 | 167 |
| 115 | 3300026035 | Ga0207703_10193382 | Ga0207703_101933822 | 167 |
| 116 | 3300026041 | Ga0207639_10345814 | Ga0207639_103458142 | 167 |
| 117 | 3300026095 | Ga0207676_10074148 | Ga0207676_100741482 | 167 |
| 118 | 3300026116 | Ga0207674_10008197 | Ga0207674_1000819711 | 167 |
| 119 | 3300028381 | Ga0268264_11006458 | Ga0268264_110064581 | 167 |
| 120 | 3300028666 | Ga0265336_10001257 | Ga0265336_100012573 | 167 |
| 121 | 3300031616 | Ga0307508_10318182 | Ga0307508_103181822 | 167 |
| 122 | 3300031616 | Ga0307508_10360806 | Ga0307508_103608061 | 167 |
| 123 | 3300033179 | Ga0307507_10521061 | Ga0307507_105210611 | 167 |
| 124 | 3300035119 | Ga0373956_0014190 | Ga0373956_0014190_381_986 | 167 |
| 125 | 3300035172 | Ga0373955_0091848 | Ga0373955_0091848_1049_1654 | 167 |
| 126 | 3300035724 | Ga0373933_0001098 | Ga0373933_0001098_1289_1894 | 167 |
| 127 | 3300036401 | Ga0373937_0000048 | Ga0373937_0000048_58001_58606 | 167 |
| 128 | 3300036401 | Ga0373937_0086443 | Ga0373937_0086443_289_825 | 167 |
| 129 | 3300037068 | Ga0373925_0258305 | Ga0373925_0258305_404_940 | 167 |
| 130 | 3300037471 | Ga0395905_0351093 | Ga0395905_0351093_209_745 | 167 |
| 131 | 3300046462 | Ga0495651_0033404 | Ga0495651_0033404_286_891 | 167 |
| 132 | 3300046463 | Ga0495653_0142862 | Ga0495653_0142862_646_1251 | 167 |
| 133 | 3300046514 | Ga0495618_0306062 | Ga0495618_0306062_96_704 | 167 |
| 134 | 3300046517 | Ga0495630_0053331 | Ga0495630_0053331_315_923 | 167 |
| 135 | 3300046529 | Ga0495652_0026792 | Ga0495652_0026792_2151_2756 | 167 |
| 136 | 3300046536 | Ga0495587_0000866 | Ga0495587_0000866_18062_18667 | 167 |
| 137 | 3300047319 | Ga0495674_0034178 | Ga0495674_0034178_2778_3386 | 167 |
| 138 | 3300047444 | Ga0495675_0005469 | Ga0495675_0005469_6366_6971 | 167 |
| 139 | 3300048088 | Ga0495602_0000442 | Ga0495602_0000442_3119_3724 | 167 |
| 140 | 3300049460 | Ga0495682_0123519 | Ga0495682_0123519_72_608 | 167 |
| 141 | 3300053087 | Ga0500643_004142 | Ga0500643_004142_4287_4838 | 167 |
| 142 | 3300053093 | Ga0500651_0086958 | Ga0500651_0086958_118_654 | 167 |
| 143 | 3300053120 | Ga0500597_000023 | Ga0500597_000023_28430_28981 | 167 |
| 144 | 3300053139 | Ga0500568_0000179 | Ga0500568_0000179_19477_20028 | 167 |
| 145 | 3300007076 | Ga0075435_100112981 | Ga0075435_1001129813 | 168 |
| 146 | 3300046615 | Ga0495656_0196111 | Ga0495656_0196111_399_965 | 168 |
| 147 | 3300047472 | Ga0495686_0201986 | Ga0495686_0201986_326_865 | 168 |
| 148 | 3300050513 | nmdc:mga0rr50_618392_c1 | nmdc:mga0rr50_618392_c1_227_766 | 168 |
| 149 | 3300050514 | nmdc:mga08x19_375183_c1 | nmdc:mga08x19_375183_c1_123_692 | 168 |
| 150 | 3300050515 | nmdc:mga0a205_323959_c1 | nmdc:mga0a205_323959_c1_101_640 | 168 |
| 151 | 3300005329 | Ga0070683_100597197 | Ga0070683_1005971971 | 169 |
| 152 | 3300005344 | Ga0070661_100018540 | Ga0070661_1000185403 | 169 |
| 153 | 3300005436 | Ga0070713_100252540 | Ga0070713_1002525402 | 169 |
| 154 | 3300005459 | Ga0068867_100712032 | Ga0068867_1007120322 | 169 |
| 155 | 3300005535 | Ga0070684_100123011 | Ga0070684_1001230112 | 169 |
| 156 | 3300005539 | Ga0068853_100000203 | Ga0068853_10000020338 | 169 |
| 157 | 3300005563 | Ga0068855_100002544 | Ga0068855_1000025449 | 169 |
| 158 | 3300005577 | Ga0068857_100096529 | Ga0068857_1000965293 | 169 |
| 159 | 3300005578 | Ga0068854_100073320 | Ga0068854_1000733201 | 169 |
| 160 | 3300005614 | Ga0068856_100003050 | Ga0068856_10000305016 | 169 |
| 161 | 3300005616 | Ga0068852_100000082 | Ga0068852_10000008252 | 169 |
| 162 | 3300005834 | Ga0068851_10167299 | Ga0068851_101672992 | 169 |
| 163 | 3300009174 | Ga0105241_10000382 | Ga0105241_1000038218 | 169 |
| 164 | 3300013105 | Ga0157369_10118151 | Ga0157369_101181512 | 169 |
| 165 | 3300025321 | Ga0207656_10116710 | Ga0207656_101167102 | 169 |
| 166 | 3300025911 | Ga0207654_10000034 | Ga0207654_1000003427 | 169 |
| 167 | 3300025911 | Ga0207654_10000099 | Ga0207654_1000009916 | 169 |
| 168 | 3300025913 | Ga0207695_10000561 | Ga0207695_1000056145 | 169 |
| 169 | 3300025914 | Ga0207671_10000123 | Ga0207671_100001237 | 169 |
| 170 | 3300025920 | Ga0207649_10001279 | Ga0207649_1000127910 | 169 |
| 171 | 3300025924 | Ga0207694_10000112 | Ga0207694_1000011214 | 169 |
| 172 | 3300025944 | Ga0207661_10541120 | Ga0207661_105411201 | 169 |
| 173 | 3300025949 | Ga0207667_10071320 | Ga0207667_100713204 | 169 |
| 174 | 3300025981 | Ga0207640_10017197 | Ga0207640_100171974 | 169 |
| 175 | 3300026041 | Ga0207639_10000233 | Ga0207639_1000023332 | 169 |
| 176 | 3300026078 | Ga0207702_10011105 | Ga0207702_100111057 | 169 |
| 177 | 3300026142 | Ga0207698_10000066 | Ga0207698_100000667 | 169 |
| 178 | 3300030521 | Ga0307511_10007737 | Ga0307511_100077378 | 169 |
| 179 | 3300032005 | Ga0307411_10132568 | Ga0307411_101325682 | 169 |
| 180 | 3300046460 | Ga0495638_0010345 | Ga0495638_0010345_299_835 | 169 |
| 181 | 3300046461 | Ga0495641_0190957 | Ga0495641_0190957_185_727 | 169 |
| 182 | 3300046471 | Ga0495650_0033212 | Ga0495650_0033212_447_983 | 169 |
| 183 | 3300046522 | Ga0495643_0133308 | Ga0495643_0133308_666_1208 | 169 |
| 184 | 3300046660 | Ga0495625_0002562 | Ga0495625_0002562_5540_6076 | 169 |
| 185 | 3300053156 | Ga0500622_0197970 | Ga0500622_0197970_351_893 | 169 |
| 186 | 3300005334 | Ga0068869_100405934 | Ga0068869_1004059342 | 170 |
| 187 | 3300005544 | Ga0070686_100425133 | Ga0070686_1004251331 | 170 |
| 188 | 3300005578 | Ga0068854_100325863 | Ga0068854_1003258632 | 170 |
| 189 | 3300005985 | Ga0081539_10001162 | Ga0081539_1000116224 | 170 |
| 190 | 3300006237 | Ga0097621_100334626 | Ga0097621_1003346262 | 170 |
| 191 | 3300009093 | Ga0105240_10002743 | Ga0105240_1000274317 | 170 |
| 192 | 3300013307 | Ga0157372_10798048 | Ga0157372_107980482 | 170 |
| 193 | 3300017792 | Ga0163161_10200236 | Ga0163161_102002363 | 170 |
| 194 | 3300025942 | Ga0207689_10091734 | Ga0207689_100917342 | 170 |
| 195 | 3300025981 | Ga0207640_10280761 | Ga0207640_102807611 | 170 |
| 196 | 3300026067 | Ga0207678_10100211 | Ga0207678_101002114 | 170 |
| 197 | 3300028023 | Ga0265357_1002061 | Ga0265357_10020613 | 170 |
| 198 | 3300046615 | Ga0495656_0461085 | Ga0495656_0461085_87_626 | 170 |
| 199 | 3300047318 | Ga0495636_0000021 | Ga0495636_0000021_45534_46073 | 170 |
| 200 | 3300053092 | Ga0500583_0001325 | Ga0500583_0001325_1314_1859 | 170 |
| 201 | 3300053139 | Ga0500568_0007262 | Ga0500568_0007262_4394_4939 | 170 |
| 202 | 3300053178 | Ga0500637_0005747 | Ga0500637_0005747_524_1069 | 170 |
| 203 | 3300005435 | Ga0070714_101188794 | Ga0070714_1011887941 | 171 |
| 204 | 3300005436 | Ga0070713_100122165 | Ga0070713_1001221651 | 171 |
| 205 | 3300005539 | Ga0068853_100036751 | Ga0068853_1000367515 | 171 |
| 206 | 3300009093 | Ga0105240_10017353 | Ga0105240_100173535 | 171 |
| 207 | 3300009545 | Ga0105237_10014777 | Ga0105237_100147774 | 171 |
| 208 | 3300009551 | Ga0105238_10094554 | Ga0105238_100945542 | 171 |
| 209 | 3300013104 | Ga0157370_10058845 | Ga0157370_100588454 | 171 |
| 210 | 3300013105 | Ga0157369_10108422 | Ga0157369_101084223 | 171 |
| 211 | 3300013105 | Ga0157369_10259456 | Ga0157369_102594562 | 171 |
| 212 | 3300013296 | Ga0157374_10261801 | Ga0157374_102618012 | 171 |
| 213 | 3300013297 | Ga0157378_10101100 | Ga0157378_101011002 | 171 |
| 214 | 3300013307 | Ga0157372_10011408 | Ga0157372_100114087 | 171 |
| 215 | 3300013307 | Ga0157372_10247804 | Ga0157372_102478043 | 171 |
| 216 | 3300021358 | Ga0213873_10028453 | Ga0213873_100284532 | 171 |
| 217 | 3300025913 | Ga0207695_10003769 | Ga0207695_1000376922 | 171 |
| 218 | 3300025914 | Ga0207671_10077892 | Ga0207671_100778922 | 171 |
| 219 | 3300025924 | Ga0207694_10063891 | Ga0207694_100638913 | 171 |
| 220 | 3300025928 | Ga0207700_10001777 | Ga0207700_100017773 | 171 |
| 221 | 3300025949 | Ga0207667_10251205 | Ga0207667_102512053 | 171 |
| 222 | 3300026041 | Ga0207639_10034663 | Ga0207639_100346632 | 171 |
| 223 | 3300028800 | Ga0265338_10310707 | Ga0265338_103107073 | 171 |
| 224 | 3300031090 | Ga0265760_10000566 | Ga0265760_100005663 | 171 |
| 225 | 3300031250 | Ga0265331_10016838 | Ga0265331_100168386 | 171 |
| 226 | 3300031344 | Ga0265316_10005953 | Ga0265316_1000595310 | 171 |
| 227 | 3300031711 | Ga0265314_10199774 | Ga0265314_101997742 | 171 |
| 228 | 3300039450 | Ga0436363_0507950 | Ga0436363_0507950_208_813 | 171 |
| 229 | 3300046473 | Ga0495582_0024273 | Ga0495582_0024273_2551_3174 | 171 |
| 230 | 3300046678 | Ga0495599_0175151 | Ga0495599_0175151_380_997 | 171 |
| 231 | 3300046680 | Ga0495646_0087214 | Ga0495646_0087214_1176_1793 | 171 |
| 232 | 3300003316 | rootH1_10031662 | rootH1_100316622 | 177 |
| 233 | 3300025250 | Ga0209026_1017087 | Ga0209026_10170871 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2je2-assembly1.cif.gz_A | cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form | 0.8198 | 43 | 148 |
| 6hiu-assembly1.cif.gz_A | cytochrome p460 from methylococcus capsulatus (bath) | 0.7774 | 31 | 172 |
| 6hiu-assembly1.cif.gz_A | cytochrome p460 from methylococcus capsulatus (bath) | 0.739 | 31 | 172 |
| 8gar-assembly1.cif.gz_A | nitrosomonas europaea cytochrome p460 arg44ala | 0.7324 | 43 | 168 |
| 7zs4-assembly1.cif.gz_A | f32v cytochrome c prime beta from methylococcus capsulatus (bath) | 0.71 | 41 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2je3A00 | Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 | 0.8137 | 43 | 149 | 3.50.70.20 |
| af_A0A1D6JUA0_124_347_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.7234 | 46 | 67 | 3.60.10.10 |
| af_K7LWA0_1_126_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.6704 | 46 | 67 | 3.60.10.10 |
| af_Q4V7A8_16_457_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.5956 | 49 | 101 | 3.40.50.1820 |
| af_Q8IQI5_15_479_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.5928 | 49 | 102 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7VEB2-F1-model_v4 | Cytochrome P460 | 0.8959 | 12 | 133 |
|
| AF-A0A852VCN9-F1-model_v4 | Mono/diheme cytochrome c family protein | 0.8841 | 25 | 171 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A6B9YVF0-F1-model_v4 | C-type cytochrome | 0.8803 | 20 | 171 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2V7MFV7-F1-model_v4 | Cytochrome P460 | 0.86 | 27 | 177 |
|
| AF-A0A1Q6X022-F1-model_v4 | Cytochrome P460 | 0.8564 | 12 | 177 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar