F346244

General Info

Members Datasets Scaffolds Average Seq Length
233 163 466 170

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100749011|Ga0307409_1007490112
Length 197
Sequence MRAGMRVLIVSGTPPTFSRSTTLETTPLASPHVVDDLIRSRRTHKAYGPDPVPRETLLELFELARWAPNHHLTNPWRFRVIGPEALETLKAAAERHKPGSATKLDRAPTLVAVTAKQTGDPEQDHEDVLATAVAAYIVLLGAHARGLAAYWRTVPVLGALDLPADELPIGLLYLGTPRQEQRVPERASVEEIAFFLD

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 16.31
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100749011 3300031995 Bacteria 980
2 JGI25407J50210_10049124 3300003373 Bacteria 1071
3 Ga0070658_10052051 3300005327 Bacteria 3320
4 Ga0070683_100000628 3300005329 Bacteria 25410
5 Ga0070690_100244332 3300005330 Bacteria 1267
6 Ga0070690_100852666 3300005330 Bacteria 710
7 Ga0068869_100336834 3300005334 Bacteria 1227
8 Ga0070682_100785976 3300005337 Bacteria 772
9 Ga0068868_100275308 3300005338 Bacteria 1423
10 Ga0070661_100052406 3300005344 Bacteria 2987
11 Ga0070661_100264965 3300005344 Bacteria 1329
12 Ga0070669_100546795 3300005353 Bacteria 965
13 Ga0070673_101121505 3300005364 Bacteria 735
14 Ga0070688_100536928 3300005365 Bacteria 887
15 Ga0070714_100012541 3300005435 Bacteria 6772
16 Ga0070701_10114746 3300005438 Bacteria 1510
17 Ga0070711_100079714 3300005439 Bacteria 2329
18 Ga0070711_100108408 3300005439 Bacteria 2034
19 Ga0070711_100213169 3300005439 Bacteria 1497
20 Ga0070711_100301676 3300005439 Bacteria 1274
21 Ga0070663_100359956 3300005455 Bacteria 1180
22 Ga0070663_101150707 3300005455 Bacteria 680
23 Ga0070678_100043499 3300005456 Bacteria 3200
24 Ga0070678_100639694 3300005456 Bacteria 953
25 Ga0070678_100832176 3300005456 Bacteria 840
26 Ga0070662_100673372 3300005457 Bacteria 874
27 Ga0070679_100242271 3300005530 Unclassified 1760
28 Ga0070684_100030764 3300005535 Bacteria 4565
29 Ga0070686_100356775 3300005544 Bacteria 1100
30 Ga0070696_100806958 3300005546 Bacteria 773
31 Ga0070704_100157141 3300005549 Bacteria 1795
32 Ga0070664_100323871 3300005564 Bacteria 1397
33 Ga0070664_100502939 3300005564 Bacteria 1117
34 Ga0068857_100008539 3300005577 Bacteria 8857
35 Ga0068854_100278777 3300005578 Bacteria 1345
36 Ga0068856_100124076 3300005614 Bacteria 2585
37 Ga0068852_100728444 3300005616 Bacteria 1003
38 Ga0068859_100185893 3300005617 Bacteria 2162
39 Ga0068866_10217687 3300005718 Bacteria 1150
40 Ga0068866_10525580 3300005718 Bacteria 787
41 Ga0068860_100808272 3300005843 Bacteria 951
42 Ga0068862_100749095 3300005844 Bacteria 950
43 Ga0081538_10000696 3300005981 Bacteria 36915
44 Ga0081538_10020455 3300005981 Bacteria 4868
45 Ga0081540_1132295 3300005983 Bacteria 1016
46 Ga0075365_10401006 3300006038 Bacteria 968
47 Ga0070712_100005121 3300006175 Bacteria 8113
48 Ga0068865_100000034 3300006881 Bacteria 84043
49 Ga0068865_100190348 3300006881 Bacteria 1586
50 Ga0075436_100450504 3300006914 Bacteria 937
51 Ga0097620_100185893 3300006931 Bacteria 2162
52 Ga0111539_10091359 3300009094 Bacteria 3577
53 Ga0105245_10088170 3300009098 Bacteria 2849
54 Ga0105243_10208753 3300009148 Bacteria 1718
55 Ga0105242_10127781 3300009176 Bacteria 2190
56 Ga0105242_11214573 3300009176 Bacteria 774
57 Ga0105238_10000126 3300009551 Bacteria 83957
58 Ga0105249_10157443 3300009553 Bacteria 2192
59 Ga0105239_10341045 3300010375 Bacteria 1691
60 Ga0105239_10450693 3300010375 Bacteria 1460
61 Ga0105246_10078118 3300011119 Bacteria 2350
62 Ga0157374_10013379 3300013296 Bacteria 7162
63 Ga0157374_10151426 3300013296 Bacteria 2255
64 Ga0157378_10723207 3300013297 Unclassified 1016
65 Ga0157377_10032446 3300014745 Bacteria 2843
66 Ga0157377_10691923 3300014745 Bacteria 739
67 Ga0207692_10165594 3300025898 Bacteria 1277
68 Ga0207643_10367015 3300025908 Bacteria 906
69 Ga0207693_10211810 3300025915 Bacteria 1523
70 Ga0207693_10378299 3300025915 Unclassified 1107
71 Ga0207663_10096026 3300025916 Bacteria 1979
72 Ga0207663_10206247 3300025916 Bacteria 1421
73 Ga0207663_10364164 3300025916 Bacteria 1098
74 Ga0207649_10186549 3300025920 Bacteria 1455
75 Ga0207694_10000004 3300025924 Bacteria 967075
76 Ga0207687_10020177 3300025927 Bacteria 4420
77 Ga0207664_10660000 3300025929 Bacteria 940
78 Ga0207670_10248943 3300025936 Bacteria 1372
79 Ga0207704_10134485 3300025938 Bacteria 1718
80 Ga0207665_10052620 3300025939 Bacteria 2744
81 Ga0207691_10686876 3300025940 Bacteria 864
82 Ga0207661_10393073 3300025944 Bacteria 1256
83 Ga0207679_10140825 3300025945 Bacteria 1949
84 Ga0207679_10157349 3300025945 Bacteria 1857
85 Ga0207640_10357434 3300025981 Bacteria 1176
86 Ga0207702_10174328 3300026078 Bacteria 1975
87 Ga0207675_100735027 3300026118 Bacteria 997
88 Ga0207683_10619231 3300026121 Bacteria 1002
89 Ga0207698_10527535 3300026142 Bacteria 1153
90 Ga0268266_10878563 3300028379 Bacteria 867
91 Ga0265334_10150923 3300028573 Bacteria 820
92 Ga0265338_10154753 3300028800 Bacteria 1777
93 Ga0265338_10196560 3300028800 Bacteria 1524
94 Ga0265324_10023176 3300029957 Bacteria 2213
95 Ga0307408_100385229 3300031548 Bacteria 1200
96 Ga0307408_100557264 3300031548 Bacteria 1012
97 Ga0307413_10086968 3300031824 Bacteria 2023
98 Ga0307410_10624339 3300031852 Bacteria 901
99 Ga0307409_100347338 3300031995 Unclassified 1398
100 Ga0307409_101145446 3300031995 Bacteria 800
101 Ga0307416_100109743 3300032002 Bacteria 2427
102 Ga0307416_100173443 3300032002 Bacteria 2011
103 Ga0307416_102289654 3300032002 Bacteria 641
104 Ga0307411_10328386 3300032005 Bacteria 1238
105 Ga0307415_100363021 3300032126 Bacteria 1223
106 Ga0373926_0018466 3300035083 Bacteria 2399
107 Ga0373944_0008391 3300035089 Bacteria 2791
108 Ga0373936_0057984 3300035113 Bacteria 1576
109 Ga0373945_0005475 3300035116 Bacteria 4064
110 Ga0373943_0002911 3300035170 Bacteria 7770
111 Ga0373943_0655843 3300035170 Bacteria 620
112 Ga0373946_0011323 3300035171 Bacteria 3325
113 Ga0373961_0158119 3300035241 Bacteria 777
114 Ga0373935_0150758 3300035692 Bacteria 1577
115 Ga0373935_0553648 3300035692 Bacteria 838
116 Ga0373947_0003662 3300035725 Bacteria 9066
117 Ga0373947_0319839 3300035725 Bacteria 1037
118 Ga0373925_0021493 3300037068 Bacteria 4701
119 Ga0373925_0069929 3300037068 Bacteria 2652
120 Ga0395898_0690122 3300037466 Bacteria 963
121 Ga0436365_0823988 3300039437 Bacteria 1148
122 Ga0451789_0737843 3300041443 Bacteria 961
123 Ga0451853_3018741 3300041512 Bacteria 1694
124 Ga0466965_0059422 3300044683 Bacteria 1908
125 Ga0466971_0003922 3300044719 Bacteria 6383
126 Ga0466957_0005852 3300044842 Bacteria 6924
127 Ga0466957_0021342 3300044842 Bacteria 3815
128 Ga0466960_0071765 3300044901 Bacteria 1725
129 Ga0466958_0390679 3300045836 Bacteria 898
130 Ga0466967_0023185 3300045976 Bacteria 5083
131 Ga0495629_0133797 3300046459 Bacteria 1726
132 Ga0495629_0268603 3300046459 Bacteria 1172
133 Ga0495641_0055213 3300046461 Bacteria 1803
134 Ga0495653_0050785 3300046463 Bacteria 3187
135 Ga0495650_0000049 3300046471 Bacteria 325092
136 Ga0495580_0318514 3300046472 Bacteria 1057
137 Ga0495582_0000004 3300046473 Bacteria 168322
138 Ga0495582_0052925 3300046473 Bacteria 2238
139 Ga0495639_0000678 3300046475 Bacteria 15664
140 Ga0495662_0054847 3300046476 Bacteria 1925
141 Ga0495664_0130615 3300046477 Bacteria 1521
142 Ga0495584_0308505 3300046491 Unclassified 804
143 Ga0495608_0049244 3300046511 Bacteria 2797
144 Ga0495618_0046822 3300046514 Bacteria 2729
145 Ga0495618_0177489 3300046514 Bacteria 1354
146 Ga0495628_0466570 3300046516 Bacteria 915
147 Ga0495630_0070315 3300046517 Bacteria 2633
148 Ga0495666_0004420 3300046526 Bacteria 7105
149 Ga0495652_0548147 3300046529 Bacteria 795
150 Ga0495652_0574505 3300046529 Bacteria 772
151 Ga0495640_0060097 3300046533 Bacteria 2586
152 Ga0495586_0069786 3300046535 Bacteria 1918
153 Ga0495587_0090727 3300046536 Bacteria 1765
154 Ga0495645_0345852 3300046543 Bacteria 959
155 Ga0495667_0038906 3300046559 Bacteria 3166
156 Ga0495634_0004636 3300046642 Bacteria 10716
157 Ga0495635_0163299 3300046663 Bacteria 1515
158 Ga0495588_0000244 3300046674 Bacteria 45880
159 Ga0495657_0050120 3300046675 Bacteria 2808
160 Ga0495599_0105555 3300046678 Bacteria 1755
161 Ga0495623_0110569 3300046679 Bacteria 1665
162 Ga0495646_0217353 3300046680 Unclassified 1035
163 Ga0495647_0009644 3300046681 Bacteria 3275
164 Ga0495647_0030357 3300046681 Bacteria 2005
165 Ga0495658_0000004 3300046683 Bacteria 173598
166 Ga0495658_0004064 3300046683 Bacteria 7206
167 Ga0495658_0017930 3300046683 Bacteria 3670
168 Ga0495658_0685382 3300046683 Bacteria 656
169 Ga0495669_0000030 3300046684 Bacteria 102988
170 Ga0495613_0438494 3300046689 Bacteria 886
171 Ga0495624_0025276 3300046690 Bacteria 3900
172 Ga0495600_0027865 3300046809 Bacteria 3653
173 Ga0495600_0046351 3300046809 Bacteria 2836
174 Ga0495581_0006834 3300047315 Bacteria 6617
175 Ga0495581_0022833 3300047315 Bacteria 3624
176 Ga0495604_0000126 3300047317 Bacteria 63992
177 Ga0495604_0067605 3300047317 Bacteria 2714
178 Ga0495674_0047129 3300047319 Bacteria 3823
179 Ga0495674_0100658 3300047319 Bacteria 2459
180 Ga0495676_0037031 3300047321 Bacteria 4066
181 Ga0495676_0039156 3300047321 Bacteria 3929
182 Ga0495676_0178889 3300047321 Bacteria 1488
183 Ga0495676_0982414 3300047321 Bacteria 539
184 Ga0495680_0307664 3300047322 Bacteria 1111
185 Ga0495675_0061693 3300047444 Bacteria 2375
186 Ga0495684_0051830 3300047471 Bacteria 3131
187 Ga0495686_0074887 3300047472 Unclassified 2076
188 Ga0495602_0205469 3300048088 Bacteria 1499
189 Ga0495614_0004529 3300048089 Bacteria 6267
190 Ga0496100_0008989 3300048903 Bacteria 5593
191 Ga0496100_0259170 3300048903 Bacteria 1289
192 Ga0496101_0012691 3300048904 Bacteria 5630
193 Ga0496101_0112001 3300048904 Bacteria 2055
194 Ga0496101_0603935 3300048904 Bacteria 867
195 Ga0496102_0061142 3300048905 Bacteria 3446
196 Ga0496102_0908052 3300048905 Unclassified 802
197 Ga0496104_0025703 3300048907 Bacteria 5431
198 Ga0496104_0279314 3300048907 Bacteria 1583
199 Ga0496105_0231174 3300048908 Bacteria 1503
200 Ga0496105_0289225 3300048908 Bacteria 1320
201 Ga0496106_0030297 3300048909 Bacteria 4035
202 Ga0496107_0512441 3300048910 Bacteria 889
203 Ga0496108_0245508 3300048911 Bacteria 1557
204 Ga0496108_0402507 3300048911 Bacteria 1195
205 Ga0496108_1128313 3300048911 Unclassified 665
206 Ga0496109_0008817 3300048912 Bacteria 8589
207 Ga0496109_0111836 3300048912 Bacteria 2539
208 Ga0496109_0126504 3300048912 Bacteria 2383
209 Ga0496109_0380895 3300048912 Bacteria 1333
210 Ga0496109_0414029 3300048912 Bacteria 1273
211 Ga0496109_0603244 3300048912 Unclassified 1034
212 Ga0496110_0006898 3300048913 Bacteria 9029
213 Ga0496110_0356976 3300048913 Bacteria 1332
214 Ga0496111_0004191 3300048914 Bacteria 9073
215 Ga0496112_0040216 3300048915 Bacteria 4571
216 Ga0496112_0291863 3300048915 Bacteria 1577
217 Ga0496112_0873708 3300048915 Unclassified 822
218 Ga0496112_1606992 3300048915 Bacteria 563
219 Ga0496113_0122351 3300048916 Bacteria 2035
220 Ga0496114_0014926 3300048917 Bacteria 6244
221 Ga0496114_0065567 3300048917 Bacteria 3043
222 Ga0496114_0143986 3300048917 Bacteria 2065
223 Ga0496114_0388770 3300048917 Bacteria 1235
224 Ga0496114_0597055 3300048917 Bacteria 974
225 Ga0496115_0109593 3300048918 Bacteria 2267
226 Ga0496115_0493526 3300048918 Bacteria 985
227 Ga0496119_0262212 3300048922 Bacteria 866
228 Ga0496121_0432727 3300048924 Unclassified 853
229 Ga0495601_0005948 3300053077 Bacteria 7116
230 Ga0495601_0178986 3300053077 Bacteria 1386
231 Ga0495619_0012173 3300053085 Bacteria 5415
232 Ga0495619_0390563 3300053085 Bacteria 961
233 Ga0500616_0165420 3300053153 Bacteria 1010
234 Ga0307409_100749011
235 JGI25407J50210_10049124
236 Ga0070658_10052051
237 Ga0070683_100000628
238 Ga0070690_100244332
239 Ga0070690_100852666
240 Ga0068869_100336834
241 Ga0070682_100785976
242 Ga0068868_100275308
243 Ga0070661_100052406
244 Ga0070661_100264965
245 Ga0070669_100546795
246 Ga0070673_101121505
247 Ga0070688_100536928
248 Ga0070714_100012541
249 Ga0070701_10114746
250 Ga0070711_100079714
251 Ga0070711_100108408
252 Ga0070711_100213169
253 Ga0070711_100301676
254 Ga0070663_100359956
255 Ga0070663_101150707
256 Ga0070678_100043499
257 Ga0070678_100639694
258 Ga0070678_100832176
259 Ga0070662_100673372
260 Ga0070679_100242271
261 Ga0070684_100030764
262 Ga0070686_100356775
263 Ga0070696_100806958
264 Ga0070704_100157141
265 Ga0070664_100323871
266 Ga0070664_100502939
267 Ga0068857_100008539
268 Ga0068854_100278777
269 Ga0068856_100124076
270 Ga0068852_100728444
271 Ga0068859_100185893
272 Ga0068866_10217687
273 Ga0068866_10525580
274 Ga0068860_100808272
275 Ga0068862_100749095
276 Ga0081538_10000696
277 Ga0081538_10020455
278 Ga0081540_1132295
279 Ga0075365_10401006
280 Ga0070712_100005121
281 Ga0068865_100000034
282 Ga0068865_100190348
283 Ga0075436_100450504
284 Ga0097620_100185893
285 Ga0111539_10091359
286 Ga0105245_10088170
287 Ga0105243_10208753
288 Ga0105242_10127781
289 Ga0105242_11214573
290 Ga0105238_10000126
291 Ga0105249_10157443
292 Ga0105239_10341045
293 Ga0105239_10450693
294 Ga0105246_10078118
295 Ga0157374_10013379
296 Ga0157374_10151426
297 Ga0157378_10723207
298 Ga0157377_10032446
299 Ga0157377_10691923
300 Ga0207692_10165594
301 Ga0207643_10367015
302 Ga0207693_10211810
303 Ga0207693_10378299
304 Ga0207663_10096026
305 Ga0207663_10206247
306 Ga0207663_10364164
307 Ga0207649_10186549
308 Ga0207694_10000004
309 Ga0207687_10020177
310 Ga0207664_10660000
311 Ga0207670_10248943
312 Ga0207704_10134485
313 Ga0207665_10052620
314 Ga0207691_10686876
315 Ga0207661_10393073
316 Ga0207679_10140825
317 Ga0207679_10157349
318 Ga0207640_10357434
319 Ga0207702_10174328
320 Ga0207675_100735027
321 Ga0207683_10619231
322 Ga0207698_10527535
323 Ga0268266_10878563
324 Ga0265334_10150923
325 Ga0265338_10154753
326 Ga0265338_10196560
327 Ga0265324_10023176
328 Ga0307408_100385229
329 Ga0307408_100557264
330 Ga0307413_10086968
331 Ga0307410_10624339
332 Ga0307409_100347338
333 Ga0307409_101145446
334 Ga0307416_100109743
335 Ga0307416_100173443
336 Ga0307416_102289654
337 Ga0307411_10328386
338 Ga0307415_100363021
339 Ga0373926_0018466
340 Ga0373944_0008391
341 Ga0373936_0057984
342 Ga0373945_0005475
343 Ga0373943_0002911
344 Ga0373943_0655843
345 Ga0373946_0011323
346 Ga0373961_0158119
347 Ga0373935_0150758
348 Ga0373935_0553648
349 Ga0373947_0003662
350 Ga0373947_0319839
351 Ga0373925_0021493
352 Ga0373925_0069929
353 Ga0395898_0690122
354 Ga0436365_0823988
355 Ga0451789_0737843
356 Ga0451853_3018741
357 Ga0466965_0059422
358 Ga0466971_0003922
359 Ga0466957_0005852
360 Ga0466957_0021342
361 Ga0466960_0071765
362 Ga0466958_0390679
363 Ga0466967_0023185
364 Ga0495629_0133797
365 Ga0495629_0268603
366 Ga0495641_0055213
367 Ga0495653_0050785
368 Ga0495650_0000049
369 Ga0495580_0318514
370 Ga0495582_0000004
371 Ga0495582_0052925
372 Ga0495639_0000678
373 Ga0495662_0054847
374 Ga0495664_0130615
375 Ga0495584_0308505
376 Ga0495608_0049244
377 Ga0495618_0046822
378 Ga0495618_0177489
379 Ga0495628_0466570
380 Ga0495630_0070315
381 Ga0495666_0004420
382 Ga0495652_0548147
383 Ga0495652_0574505
384 Ga0495640_0060097
385 Ga0495586_0069786
386 Ga0495587_0090727
387 Ga0495645_0345852
388 Ga0495667_0038906
389 Ga0495634_0004636
390 Ga0495635_0163299
391 Ga0495588_0000244
392 Ga0495657_0050120
393 Ga0495599_0105555
394 Ga0495623_0110569
395 Ga0495646_0217353
396 Ga0495647_0009644
397 Ga0495647_0030357
398 Ga0495658_0000004
399 Ga0495658_0004064
400 Ga0495658_0017930
401 Ga0495658_0685382
402 Ga0495669_0000030
403 Ga0495613_0438494
404 Ga0495624_0025276
405 Ga0495600_0027865
406 Ga0495600_0046351
407 Ga0495581_0006834
408 Ga0495581_0022833
409 Ga0495604_0000126
410 Ga0495604_0067605
411 Ga0495674_0047129
412 Ga0495674_0100658
413 Ga0495676_0037031
414 Ga0495676_0039156
415 Ga0495676_0178889
416 Ga0495676_0982414
417 Ga0495680_0307664
418 Ga0495675_0061693
419 Ga0495684_0051830
420 Ga0495686_0074887
421 Ga0495602_0205469
422 Ga0495614_0004529
423 Ga0496100_0008989
424 Ga0496100_0259170
425 Ga0496101_0012691
426 Ga0496101_0112001
427 Ga0496101_0603935
428 Ga0496102_0061142
429 Ga0496102_0908052
430 Ga0496104_0025703
431 Ga0496104_0279314
432 Ga0496105_0231174
433 Ga0496105_0289225
434 Ga0496106_0030297
435 Ga0496107_0512441
436 Ga0496108_0245508
437 Ga0496108_0402507
438 Ga0496108_1128313
439 Ga0496109_0008817
440 Ga0496109_0111836
441 Ga0496109_0126504
442 Ga0496109_0380895
443 Ga0496109_0414029
444 Ga0496109_0603244
445 Ga0496110_0006898
446 Ga0496110_0356976
447 Ga0496111_0004191
448 Ga0496112_0040216
449 Ga0496112_0291863
450 Ga0496112_0873708
451 Ga0496112_1606992
452 Ga0496113_0122351
453 Ga0496114_0014926
454 Ga0496114_0065567
455 Ga0496114_0143986
456 Ga0496114_0388770
457 Ga0496114_0597055
458 Ga0496115_0109593
459 Ga0496115_0493526
460 Ga0496119_0262212
461 Ga0496121_0432727
462 Ga0495601_0005948
463 Ga0495601_0178986
464 Ga0495619_0012173
465 Ga0495619_0390563
466 Ga0500616_0165420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

38

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eof-assembly1.cif.gz_B crystal structure of putative oxidoreductase (yp_213212.1) from bacteroides fragilis nctc 9343 at 1.99 a resolution 0.8727 22 186
3k6h-assembly1.cif.gz_B crystal structure of a nitroreductase family protein from agrobacterium tumefaciens str. c58 0.8609 22 186
7z0w-assembly4.cif.gz_G e. coli nfsa bound to nadp+ 0.8598 19 186
5hei-assembly3.cif.gz_E structure of b. megaterium nfra2 0.8567 20 186
7z0w-assembly3.cif.gz_F e. coli nfsa bound to nadp+ 0.856 19 186
ID Description Score Start End Superfamily
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8663 17 185 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.857 22 166 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8518 20 186 3.40.109.10
5heiD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8491 20 186 3.40.109.10
af_O50397_6_212_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8432 21 185 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A6I3BTA6-F1-model_v4 Nitroreductase 0.9807 19 186 GO:0016491
AF-A0A7W1N8R8-F1-model_v4 Nitroreductase 0.9752 19 162 GO:0016491
AF-A0A6I3BTA6-F1-model_v4 Nitroreductase 0.9693 19 186 GO:0016491
AF-A0A7W1N8R8-F1-model_v4 Nitroreductase 0.9557 19 162 GO:0016491
AF-A0A538IB46-F1-model_v4 Nitroreductase domain-containing protein 0.942 1 186 GO:0016491

Map