F346255

General Info

Members Datasets Scaffolds Average Seq Length
233 112 466 420

Family's Representative Sequence

Representative Sequence 3300033541|Ga0316596_1017665|Ga0316596_10176652
Length 450
Sequence MDSALIPKGVKRCPAWQFYMGLGPVQLVLAWGTLAMILVYFKGLNQSNMNNAYGFALWIWADLAIIALGGGAFFTGLLRYIIGKDELKNIVNFAVLVGFYCYVSALMILGFDIGQPLRGWFIFWHANVHSMLTEVAFCLTCYLGVLTIEYIPLILENRQIDKVPFFHNMSHNMHEIMAVFAATGAFLSFFHQGSLGGVPGVMYARPFGFREGIFVWPWTFFLFTWSAAACGPCFTILITKITETITHKKLVKDNVIELLAKISGWMIATYIIAKIIDTFYWATVTAPSKGFTLMDFYSNNPGSAYGLWILILEIGCGIIPAAILITNRGRKNQGTLWLAVILAVLGVCINRWVMVLQVLAAPVLTFEGWATYFPSWQEFATTLLPVALGITMVSLSYRYLPIFPQEQELNPIEPQSVVGEAEDDQQPPTAKTEAVMEEQTEAAGGEPEPA

Samples

Sample ID Description Type Environment
1 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
14 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
24 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
50 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
51 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
56 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
57 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
60 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
70 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
73 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
74 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
75 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 3.86
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 82.83
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316596_1017665 3300033541 Bacteria 1796
2 Ga0070683_100000309 3300005329 Bacteria 33553
3 Ga0070683_100093303 3300005329 Bacteria 2828
4 Ga0070673_100278707 3300005364 Unclassified 1466
5 Ga0070714_100000074 3300005435 Bacteria 86593
6 Ga0070714_100051830 3300005435 Unclassified 3500
7 Ga0070714_100154660 3300005435 Bacteria 2069
8 Ga0070713_100103931 3300005436 Unclassified 2465
9 Ga0070711_100002539 3300005439 Bacteria 10444
10 Ga0070711_100011292 3300005439 Bacteria 5542
11 Ga0070684_100000035 3300005535 Bacteria 100109
12 Ga0070684_100087208 3300005535 Bacteria 2771
13 Ga0068856_100000072 3300005614 Bacteria 95094
14 Ga0068852_100212549 3300005616 Unclassified 1836
15 Ga0068864_100208437 3300005618 Unclassified 1799
16 Ga0068863_100167718 3300005841 Bacteria 2106
17 Ga0070717_10004289 3300006028 Bacteria 10278
18 Ga0070717_10068590 3300006028 Bacteria 2952
19 Ga0070715_10048081 3300006163 Unclassified 1821
20 Ga0070716_100013491 3300006173 Bacteria 4165
21 Ga0070712_100031271 3300006175 Bacteria 3584
22 Ga0097621_100079869 3300006237 Bacteria 2720
23 Ga0105240_10006122 3300009093 Bacteria 17748
24 Ga0105240_10195482 3300009093 Bacteria 2375
25 Ga0105245_10410689 3300009098 Bacteria 1355
26 Ga0105248_10024010 3300009177 Bacteria 6777
27 Ga0105248_10026281 3300009177 Bacteria 6476
28 Ga0105248_10234046 3300009177 Bacteria 2068
29 Ga0105248_10250479 3300009177 Unclassified 1994
30 Ga0105248_10272184 3300009177 Bacteria 1907
31 Ga0105248_10329919 3300009177 Bacteria 1718
32 Ga0157369_10004100 3300013105 Bacteria 17261
33 Ga0157369_10051470 3300013105 Bacteria 4457
34 Ga0157372_10024853 3300013307 Bacteria 6511
35 Ga0163163_10219704 3300014325 Bacteria 1949
36 Ga0182005_1022318 3300015265 Unclassified 1735
37 Ga0207685_10059090 3300025905 Unclassified 1511
38 Ga0207707_10007332 3300025912 Bacteria 9607
39 Ga0207695_10013092 3300025913 Bacteria 9903
40 Ga0207695_10141409 3300025913 Bacteria 2354
41 Ga0207693_10000219 3300025915 Bacteria 52439
42 Ga0207663_10008082 3300025916 Bacteria 5482
43 Ga0207700_10008254 3300025928 Bacteria 6436
44 Ga0207700_10010110 3300025928 Bacteria 5932
45 Ga0207664_10000582 3300025929 Bacteria 25512
46 Ga0207664_10055979 3300025929 Bacteria 3131
47 Ga0207664_10113162 3300025929 Bacteria 2260
48 Ga0207664_10215666 3300025929 Unclassified 1662
49 Ga0207665_10040385 3300025939 Bacteria 3113
50 Ga0207711_10018174 3300025941 Bacteria 5844
51 Ga0207711_10045459 3300025941 Bacteria 3753
52 Ga0207711_10104812 3300025941 Bacteria 2507
53 Ga0207711_10152386 3300025941 Bacteria 2087
54 Ga0207661_10000010 3300025944 Bacteria 375338
55 Ga0207661_10007154 3300025944 Bacteria 7927
56 Ga0207702_10001398 3300026078 Bacteria 24069
57 Ga0207641_10032901 3300026088 Unclassified 4307
58 Ga0207683_10205711 3300026121 Bacteria 1790
59 Ga0265323_10000718 3300028653 Bacteria 17925
60 Ga0265338_10027046 3300028800 Bacteria 5766
61 Ga0265338_10079993 3300028800 Bacteria 2747
62 Ga0265338_10086774 3300028800 Bacteria 2602
63 Ga0265338_10184066 3300028800 Bacteria 1590
64 Ga0265330_10004415 3300031235 Bacteria 7139
65 Ga0265330_10038096 3300031235 Bacteria 2138
66 Ga0265325_10004188 3300031241 Bacteria 9168
67 Ga0265339_10018974 3300031249 Unclassified 4044
68 Ga0265316_10048985 3300031344 Bacteria 3330
69 Ga0265316_10068940 3300031344 Unclassified 2730
70 Ga0265316_10103377 3300031344 Bacteria 2163
71 Ga0316575_10000162 3300031665 Bacteria 17016
72 Ga0316575_10012312 3300031665 Bacteria 3179
73 Ga0316575_10025887 3300031665 Bacteria 2278
74 Ga0316579_10000683 3300031691 Bacteria 11529
75 Ga0316579_10001947 3300031691 Bacteria 7693
76 Ga0316579_10007974 3300031691 Bacteria 4396
77 Ga0316579_10019947 3300031691 Bacteria 2966
78 Ga0265314_10037692 3300031711 Unclassified 3501
79 Ga0316576_10000615 3300031727 Bacteria 17155
80 Ga0316576_10004628 3300031727 Bacteria 8280
81 Ga0316576_10007139 3300031727 Bacteria 7005
82 Ga0316576_10007718 3300031727 Bacteria 6789
83 Ga0316576_10021951 3300031727 Bacteria 4424
84 Ga0316576_10025836 3300031727 Bacteria 4114
85 Ga0316576_10068280 3300031727 Bacteria 2618
86 Ga0316576_10069633 3300031727 Bacteria 2594
87 Ga0316576_10081233 3300031727 Bacteria 2405
88 Ga0316578_10008144 3300031728 Bacteria 5312
89 Ga0316578_10023159 3300031728 Bacteria 3474
90 Ga0316578_10037668 3300031728 Bacteria 2786
91 Ga0316578_10040655 3300031728 Bacteria 2689
92 Ga0316577_10000296 3300031733 Bacteria 18129
93 Ga0316577_10002528 3300031733 Bacteria 9083
94 Ga0316577_10037964 3300031733 Bacteria 2693
95 Ga0316577_10044654 3300031733 Bacteria 2479
96 Ga0316577_10063081 3300031733 Bacteria 2069
97 Ga0316577_10130117 3300031733 Bacteria 1416
98 Ga0316583_10021807 3300032133 Bacteria 2296
99 Ga0316585_10001425 3300032137 Bacteria 6310
100 Ga0316585_10007849 3300032137 Bacteria 3086
101 Ga0316593_10023224 3300032168 Bacteria 1955
102 Ga0316592_1007249 3300033524 Bacteria 2162
103 Ga0316588_1007527 3300033528 Bacteria 2213
104 Ga0316588_1021553 3300033528 Bacteria 1467
105 Ga0316596_1000908 3300033541 Bacteria 5604
106 Ga0316596_1009172 3300033541 Bacteria 2372
107 Ga0316596_1013517 3300033541 Bacteria 2017
108 Ga0316596_1013929 3300033541 Bacteria 1988
109 Ga0373923_0005367 3300035111 Bacteria 4350
110 Ga0373923_0029445 3300035111 Bacteria 2202
111 Ga0373936_0003437 3300035113 Bacteria 5939
112 Ga0373936_0004211 3300035113 Bacteria 5426
113 Ga0373945_0008811 3300035116 Bacteria 3295
114 Ga0373953_0010282 3300035117 Bacteria 3251
115 Ga0373943_0000046 3300035170 Bacteria 41661
116 Ga0373946_0001284 3300035171 Bacteria 8682
117 Ga0373946_0019296 3300035171 Bacteria 2627
118 Ga0373955_0073012 3300035172 Bacteria 1923
119 Ga0316574_0000930 3300035398 Bacteria 13045
120 Ga0316574_0028422 3300035398 Bacteria 3373
121 Ga0316574_0065727 3300035398 Unclassified 2283
122 Ga0316574_0129032 3300035398 Bacteria 1626
123 Ga0316574_0133665 3300035398 Bacteria 1597
124 Ga0316574_0143037 3300035398 Bacteria 1541
125 Ga0373935_0006051 3300035692 Bacteria 7189
126 Ga0373935_0016465 3300035692 Bacteria 4473
127 Ga0373927_0000292 3300035695 Bacteria 39594
128 Ga0373947_0001257 3300035725 Bacteria 15596
129 Ga0373947_0103491 3300035725 Bacteria 1792
130 Ga0373937_0053551 3300036401 Bacteria 3701
131 Ga0316582_0000252 3300036647 Bacteria 17895
132 Ga0316582_0008771 3300036647 Bacteria 5450
133 Ga0316582_0022153 3300036647 Bacteria 3768
134 Ga0316582_0113145 3300036647 Bacteria 1809
135 Ga0316582_0154861 3300036647 Bacteria 1550
136 Ga0316584_0015634 3300036712 Bacteria 5430
137 Ga0316584_0024135 3300036712 Bacteria 4448
138 Ga0316584_0039044 3300036712 Bacteria 3533
139 Ga0316584_0064850 3300036712 Bacteria 2735
140 Ga0373925_0001535 3300037068 Bacteria 19685
141 Ga0316581_0033942 3300037588 Bacteria 1543
142 Ga0400484_13483 3300038725 Bacteria 3985
143 Ga0400484_33703 3300038725 Bacteria 2778
144 Ga0400484_39952 3300038725 Bacteria 10471
145 Ga0400490_43326 3300038726 Bacteria 3572
146 Ga0400490_49886 3300038726 Bacteria 96748
147 Ga0400490_57520 3300038726 Bacteria 9791
148 Ga0400491_13299 3300038727 Bacteria 2612
149 Ga0400491_14422 3300038727 Bacteria 4928
150 Ga0400491_20042 3300038727 Bacteria 6172
151 Ga0400485_14508 3300038735 Bacteria 18030
152 Ga0400485_21204 3300038735 Bacteria 44972
153 Ga0400485_22079 3300038735 Bacteria 23408
154 Ga0400485_22435 3300038735 Bacteria 51084
155 Ga0400488_02223 3300038741 Bacteria 2986
156 Ga0400488_04900 3300038741 Bacteria 8422
157 Ga0400488_13737 3300038741 Bacteria 9787
158 Ga0400488_46530 3300038741 Bacteria 1858
159 Ga0400486_09586 3300038742 Bacteria 31486
160 Ga0400486_09921 3300038742 Bacteria 3896
161 Ga0400486_22472 3300038742 Bacteria 67513
162 Ga0400486_29159 3300038742 Bacteria 37789
163 Ga0400486_32414 3300038742 Bacteria 97031
164 Ga0400483_186335 3300039062 Bacteria 5315
165 Ga0400483_187020 3300039062 Bacteria 6150
166 Ga0400483_191910 3300039062 Bacteria 4922
167 Ga0400483_236509 3300039062 Bacteria 85469
168 Ga0400483_266845 3300039062 Bacteria 22459
169 Ga0400489_02763 3300039093 Bacteria 2403
170 Ga0400489_25544 3300039093 Bacteria 15791
171 Ga0400489_85059 3300039093 Bacteria 46511
172 Ga0400489_86044 3300039093 Bacteria 6448
173 Ga0400487_11212 3300039110 Bacteria 45326
174 Ga0400487_12326 3300039110 Bacteria 5622
175 Ga0400487_20367 3300039110 Bacteria 1788
176 Ga0400487_42781 3300039110 Bacteria 3683
177 Ga0451577_0001362 3300042876 Bacteria 32891
178 Ga0451577_0016745 3300042876 Bacteria 6780
179 Ga0451577_0045123 3300042876 Bacteria 3946
180 Ga0451577_0078984 3300042876 Bacteria 2933
181 Ga0453684_0000004 3300044712 Bacteria 1469893
182 Ga0453684_0000147 3300044712 Bacteria 308490
183 Ga0453684_0001355 3300044712 Bacteria 71485
184 Ga0453684_0024384 3300044712 Bacteria 8843
185 Ga0453684_0231304 3300044712 Bacteria 2134
186 Ga0453684_0288471 3300044712 Bacteria 1869
187 Ga0453684_0448436 3300044712 Unclassified 1437
188 Ga0495651_0053778 3300046462 Unclassified 3098
189 Ga0495580_0000012 3300046472 Bacteria 97735
190 Ga0495580_0000955 3300046472 Bacteria 25312
191 Ga0495582_0004912 3300046473 Bacteria 7492
192 Ga0495664_0086173 3300046477 Bacteria 1887
193 Ga0495628_0066463 3300046516 Unclassified 2819
194 Ga0495628_0134863 3300046516 Unclassified 1887
195 Ga0495630_0039865 3300046517 Bacteria 3511
196 Ga0495630_0145796 3300046517 Bacteria 1800
197 Ga0495630_0195172 3300046517 Bacteria 1545
198 Ga0495665_0055940 3300046531 Bacteria 2083
199 Ga0495665_0059169 3300046531 Bacteria 2023
200 Ga0495645_0138073 3300046543 Unclassified 1703
201 Ga0495667_0002274 3300046559 Bacteria 12866
202 Ga0495667_0080610 3300046559 Unclassified 2116
203 Ga0495657_0084532 3300046675 Bacteria 2047
204 Ga0495599_0044693 3300046678 Bacteria 2778
205 Ga0495623_0028277 3300046679 Unclassified 3607
206 Ga0495623_0033910 3300046679 Bacteria 3275
207 Ga0495623_0052464 3300046679 Archaea 2577
208 Ga0495624_0012392 3300046690 Bacteria 5832
209 Ga0495581_0174204 3300047315 Unclassified 1258
210 Ga0495674_0007196 3300047319 Bacteria 10642
211 Ga0495674_0010647 3300047319 Bacteria 8701
212 Ga0495674_0060159 3300047319 Bacteria 3315
213 Ga0495674_0113911 3300047319 Bacteria 2290
214 Ga0495680_0044612 3300047322 Unclassified 3505
215 Ga0495675_0018331 3300047444 Bacteria 4444
216 Ga0495675_0050399 3300047444 Bacteria 2646
217 Ga0495684_0007449 3300047471 Bacteria 8477
218 Ga0495684_0183401 3300047471 Bacteria 1550
219 Ga0495602_0022147 3300048088 Bacteria 6227
220 Ga0496100_0099647 3300048903 Unclassified 2000
221 Ga0496114_0215973 3300048917 Bacteria 1683
222 Ga0496115_0016854 3300048918 Bacteria 5572
223 Ga0496115_0207335 3300048918 Unclassified 1619
224 Ga0501036_0111087 3300049572 Bacteria 2316
225 Ga0501048_0015912 3300049582 Bacteria 5550
226 Ga0501071_0091218 3300049587 Bacteria 2238
227 Ga0501075_0156634 3300049591 Unclassified 1737
228 Ga0501076_0036436 3300049592 Bacteria 3854
229 Ga0501080_0154629 3300049742 Bacteria 2119
230 Ga0501045_0013963 3300049824 Bacteria 5685
231 Ga0501084_0056271 3300054114 Bacteria 3291
232 Ga0501082_0003009 3300060353 Bacteria 14728
233 2740993976 2740891818 Bacteria 6711283
234 Ga0316596_1017665
235 Ga0070683_100000309
236 Ga0070683_100093303
237 Ga0070673_100278707
238 Ga0070714_100000074
239 Ga0070714_100051830
240 Ga0070714_100154660
241 Ga0070713_100103931
242 Ga0070711_100002539
243 Ga0070711_100011292
244 Ga0070684_100000035
245 Ga0070684_100087208
246 Ga0068856_100000072
247 Ga0068852_100212549
248 Ga0068864_100208437
249 Ga0068863_100167718
250 Ga0070717_10004289
251 Ga0070717_10068590
252 Ga0070715_10048081
253 Ga0070716_100013491
254 Ga0070712_100031271
255 Ga0097621_100079869
256 Ga0105240_10006122
257 Ga0105240_10195482
258 Ga0105245_10410689
259 Ga0105248_10024010
260 Ga0105248_10026281
261 Ga0105248_10234046
262 Ga0105248_10250479
263 Ga0105248_10272184
264 Ga0105248_10329919
265 Ga0157369_10004100
266 Ga0157369_10051470
267 Ga0157372_10024853
268 Ga0163163_10219704
269 Ga0182005_1022318
270 Ga0207685_10059090
271 Ga0207707_10007332
272 Ga0207695_10013092
273 Ga0207695_10141409
274 Ga0207693_10000219
275 Ga0207663_10008082
276 Ga0207700_10008254
277 Ga0207700_10010110
278 Ga0207664_10000582
279 Ga0207664_10055979
280 Ga0207664_10113162
281 Ga0207664_10215666
282 Ga0207665_10040385
283 Ga0207711_10018174
284 Ga0207711_10045459
285 Ga0207711_10104812
286 Ga0207711_10152386
287 Ga0207661_10000010
288 Ga0207661_10007154
289 Ga0207702_10001398
290 Ga0207641_10032901
291 Ga0207683_10205711
292 Ga0265323_10000718
293 Ga0265338_10027046
294 Ga0265338_10079993
295 Ga0265338_10086774
296 Ga0265338_10184066
297 Ga0265330_10004415
298 Ga0265330_10038096
299 Ga0265325_10004188
300 Ga0265339_10018974
301 Ga0265316_10048985
302 Ga0265316_10068940
303 Ga0265316_10103377
304 Ga0316575_10000162
305 Ga0316575_10012312
306 Ga0316575_10025887
307 Ga0316579_10000683
308 Ga0316579_10001947
309 Ga0316579_10007974
310 Ga0316579_10019947
311 Ga0265314_10037692
312 Ga0316576_10000615
313 Ga0316576_10004628
314 Ga0316576_10007139
315 Ga0316576_10007718
316 Ga0316576_10021951
317 Ga0316576_10025836
318 Ga0316576_10068280
319 Ga0316576_10069633
320 Ga0316576_10081233
321 Ga0316578_10008144
322 Ga0316578_10023159
323 Ga0316578_10037668
324 Ga0316578_10040655
325 Ga0316577_10000296
326 Ga0316577_10002528
327 Ga0316577_10037964
328 Ga0316577_10044654
329 Ga0316577_10063081
330 Ga0316577_10130117
331 Ga0316583_10021807
332 Ga0316585_10001425
333 Ga0316585_10007849
334 Ga0316593_10023224
335 Ga0316592_1007249
336 Ga0316588_1007527
337 Ga0316588_1021553
338 Ga0316596_1000908
339 Ga0316596_1009172
340 Ga0316596_1013517
341 Ga0316596_1013929
342 Ga0373923_0005367
343 Ga0373923_0029445
344 Ga0373936_0003437
345 Ga0373936_0004211
346 Ga0373945_0008811
347 Ga0373953_0010282
348 Ga0373943_0000046
349 Ga0373946_0001284
350 Ga0373946_0019296
351 Ga0373955_0073012
352 Ga0316574_0000930
353 Ga0316574_0028422
354 Ga0316574_0065727
355 Ga0316574_0129032
356 Ga0316574_0133665
357 Ga0316574_0143037
358 Ga0373935_0006051
359 Ga0373935_0016465
360 Ga0373927_0000292
361 Ga0373947_0001257
362 Ga0373947_0103491
363 Ga0373937_0053551
364 Ga0316582_0000252
365 Ga0316582_0008771
366 Ga0316582_0022153
367 Ga0316582_0113145
368 Ga0316582_0154861
369 Ga0316584_0015634
370 Ga0316584_0024135
371 Ga0316584_0039044
372 Ga0316584_0064850
373 Ga0373925_0001535
374 Ga0316581_0033942
375 Ga0400484_13483
376 Ga0400484_33703
377 Ga0400484_39952
378 Ga0400490_43326
379 Ga0400490_49886
380 Ga0400490_57520
381 Ga0400491_13299
382 Ga0400491_14422
383 Ga0400491_20042
384 Ga0400485_14508
385 Ga0400485_21204
386 Ga0400485_22079
387 Ga0400485_22435
388 Ga0400488_02223
389 Ga0400488_04900
390 Ga0400488_13737
391 Ga0400488_46530
392 Ga0400486_09586
393 Ga0400486_09921
394 Ga0400486_22472
395 Ga0400486_29159
396 Ga0400486_32414
397 Ga0400483_186335
398 Ga0400483_187020
399 Ga0400483_191910
400 Ga0400483_236509
401 Ga0400483_266845
402 Ga0400489_02763
403 Ga0400489_25544
404 Ga0400489_85059
405 Ga0400489_86044
406 Ga0400487_11212
407 Ga0400487_12326
408 Ga0400487_20367
409 Ga0400487_42781
410 Ga0451577_0001362
411 Ga0451577_0016745
412 Ga0451577_0045123
413 Ga0451577_0078984
414 Ga0453684_0000004
415 Ga0453684_0000147
416 Ga0453684_0001355
417 Ga0453684_0024384
418 Ga0453684_0231304
419 Ga0453684_0288471
420 Ga0453684_0448436
421 Ga0495651_0053778
422 Ga0495580_0000012
423 Ga0495580_0000955
424 Ga0495582_0004912
425 Ga0495664_0086173
426 Ga0495628_0066463
427 Ga0495628_0134863
428 Ga0495630_0039865
429 Ga0495630_0145796
430 Ga0495630_0195172
431 Ga0495665_0055940
432 Ga0495665_0059169
433 Ga0495645_0138073
434 Ga0495667_0002274
435 Ga0495667_0080610
436 Ga0495657_0084532
437 Ga0495599_0044693
438 Ga0495623_0028277
439 Ga0495623_0033910
440 Ga0495623_0052464
441 Ga0495624_0012392
442 Ga0495581_0174204
443 Ga0495674_0007196
444 Ga0495674_0010647
445 Ga0495674_0060159
446 Ga0495674_0113911
447 Ga0495680_0044612
448 Ga0495675_0018331
449 Ga0495675_0050399
450 Ga0495684_0007449
451 Ga0495684_0183401
452 Ga0495602_0022147
453 Ga0496100_0099647
454 Ga0496114_0215973
455 Ga0496115_0016854
456 Ga0496115_0207335
457 Ga0501036_0111087
458 Ga0501048_0015912
459 Ga0501071_0091218
460 Ga0501075_0156634
461 Ga0501076_0036436
462 Ga0501080_0154629
463 Ga0501045_0013963
464 Ga0501084_0056271
465 Ga0501082_0003009
466 2740993976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03916

NrfD

Polysulphide reductase, NrfD

43

362

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.7606 3 409
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.7306 3 409
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.709 14 406
6f0k-assembly1.cif.gz_C alternative complex iii 0.705 2 415
6f0k-assembly1.cif.gz_C alternative complex iii 0.6886 2 415
ID Description Score Start End Superfamily
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.8365 56 359 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.8051 56 359 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7466 58 350 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7248 58 350 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6346 49 352 1.20.1630.10
ID Description Score Start End GO Terms
AF-F0JDG5-F1-model_v4 Polysulfide reductase NrfD 0.9489 1 407 GO:0005886
AF-B8DIW5-F1-model_v4 Polysulphide reductase NrfD 0.9471 1 407 GO:0005886
AF-F0JDG5-F1-model_v4 Polysulfide reductase NrfD 0.9444 1 407 GO:0005886
AF-A0A3N5TPZ4-F1-model_v4 Molybdopterin oxidoreductase 0.9345 98 407 GO:0016020
AF-A0A7C8DSX4-F1-model_v4 Polysulfide reductase NrfD 0.9264 1 351 GO:0005886

Map