F346258

General Info

Members Datasets Scaffolds Average Seq Length
233 187 466 246

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0063894|Ga0373923_0063894_612_1505
Length 297
Sequence LPPVDCEARFPESGDFHEAERRAGTCVVRGARFDRWWQHAHPISNQGQAMDSNNIDGKVVVITGASSGLGEATARMLSAQGATVVLGARRLERIVALADELVRAGGQALALQTDVTRHEDVQRLVDAAVEKFGRIDVLVNNAGLMPSSPLERRKIDDWDRMIDVNIKGVLYGIAAALPHMQARKSGHIVNVSSVAGHKVRAGTAVYSATKHAVRVLTEGLRQEVKPYNIRTTIISPGAVATELPDSITEADVQAGVKAFYEIAIPAESFARAVVYALGQPEDVDINEILFRPTRQEF

Samples

Sample ID Description Type Environment
1 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
182 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
183 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
184 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
185 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
186 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
187 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 0
Rhizoplane 3
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373923_0063894 3300035111 Bacteria 1569
2 JGI24739J22299_10044769 3300001989 Bacteria 1455
3 JGI24735J21928_10011974 3300002067 Bacteria 2744
4 JGI24735J21928_10020336 3300002067 Bacteria 2034
5 rootH1_10002643 3300003316 Bacteria 9816
6 rootH2_10102649 3300003320 Bacteria 1418
7 rootL2_10032569 3300003322 Bacteria 7269
8 rootH1_10021181 3300003323 Bacteria 11194
9 rootH1_10193706 3300003323 Bacteria 1432
10 Ga0055539_1000291 3300003752 Bacteria 27701
11 Ga0055533_1000197 3300003756 Bacteria 49410
12 Ga0055525_1001071 3300003759 Bacteria 6952
13 Ga0055529_1014402 3300003763 Bacteria 1001
14 Ga0070658_10038059 3300005327 Bacteria 3879
15 Ga0070676_10004001 3300005328 Bacteria 7734
16 Ga0070670_100015462 3300005331 Bacteria 6554
17 Ga0070670_100101668 3300005331 Bacteria 2475
18 Ga0068869_100005963 3300005334 Bacteria 7705
19 Ga0070666_10331157 3300005335 Bacteria 1087
20 Ga0070680_100184242 3300005336 Bacteria 1759
21 Ga0070660_100219704 3300005339 Bacteria 1544
22 Ga0070671_100033205 3300005355 Bacteria 4267
23 Ga0070673_100000015 3300005364 Bacteria 118064
24 Ga0070659_100031223 3300005366 Bacteria 4125
25 Ga0070703_10081763 3300005406 Bacteria 1102
26 Ga0070709_10263224 3300005434 Bacteria 1247
27 Ga0070713_100250415 3300005436 Bacteria 1616
28 Ga0070662_100095702 3300005457 Bacteria 2239
29 Ga0070681_10047396 3300005458 Bacteria 4296
30 Ga0070681_10462617 3300005458 Bacteria 1181
31 Ga0068867_100000236 3300005459 Bacteria 36247
32 Ga0070699_100697212 3300005518 Unclassified 928
33 Ga0070679_100012160 3300005530 Bacteria 8223
34 Ga0070672_100277457 3300005543 Bacteria 1416
35 Ga0070693_100027932 3300005547 Bacteria 3063
36 Ga0068855_100122547 3300005563 Bacteria 2975
37 Ga0068864_100000984 3300005618 Bacteria 23862
38 Ga0068865_100001212 3300006881 Bacteria 15028
39 Ga0105251_10000215 3300009011 Bacteria 58675
40 Ga0105250_10000220 3300009092 Bacteria 47586
41 Ga0105240_10068801 3300009093 Bacteria 4384
42 Ga0105245_10009670 3300009098 Bacteria 8411
43 Ga0105245_10923981 3300009098 Bacteria 915
44 Ga0114129_11219277 3300009147 Bacteria 936
45 Ga0105242_10008694 3300009176 Bacteria 7790
46 Ga0105248_10003186 3300009177 Bacteria 18188
47 Ga0105248_10771075 3300009177 Bacteria 1085
48 Ga0105249_10175334 3300009553 Bacteria 2082
49 Ga0157373_10044292 3300013100 Bacteria 3177
50 Ga0157378_10000394 3300013297 Bacteria 43079
51 Ga0163162_10665658 3300013306 Bacteria 1164
52 Ga0157375_10004676 3300013308 Bacteria 11907
53 Ga0157377_10051005 3300014745 Bacteria 2332
54 Ga0157376_10000078 3300014969 Bacteria 72879
55 Ga0209674_100231 3300025226 Bacteria 49462
56 Ga0209563_100061 3300025230 Bacteria 274295
57 Ga0207427_102513 3300025231 Bacteria 4863
58 Ga0209677_100195 3300025253 Bacteria 49462
59 Ga0209148_1001934 3300025254 Bacteria 8420
60 Ga0209759_1012976 3300025256 Bacteria 2278
61 Ga0209455_1002795 3300025272 Bacteria 6511
62 Ga0207696_1000011 3300025711 Bacteria 530614
63 Ga0207713_1000162 3300025735 Bacteria 98630
64 Ga0207680_10203302 3300025903 Bacteria 1351
65 Ga0207647_10007374 3300025904 Bacteria 7950
66 Ga0207647_10018402 3300025904 Bacteria 4726
67 Ga0207699_10591847 3300025906 Bacteria 807
68 Ga0207645_10006551 3300025907 Bacteria 8336
69 Ga0207705_10069881 3300025909 Bacteria 2544
70 Ga0207707_10047881 3300025912 Bacteria 3723
71 Ga0207695_10027971 3300025913 Bacteria 6266
72 Ga0207660_10097411 3300025917 Bacteria 2192
73 Ga0207652_10171239 3300025921 Bacteria 1948
74 Ga0207652_10230579 3300025921 Bacteria 1669
75 Ga0207650_10018498 3300025925 Bacteria 4890
76 Ga0207687_10006298 3300025927 Bacteria 7848
77 Ga0207687_10046971 3300025927 Bacteria 2991
78 Ga0207700_10191414 3300025928 Bacteria 1719
79 Ga0207644_10013337 3300025931 Bacteria 5477
80 Ga0207644_10013954 3300025931 Bacteria 5369
81 Ga0207690_10028588 3300025932 Bacteria 3535
82 Ga0207706_10206037 3300025933 Bacteria 1724
83 Ga0207686_10004020 3300025934 Bacteria 7890
84 Ga0207709_10000118 3300025935 Bacteria 122125
85 Ga0207704_10000027 3300025938 Bacteria 122372
86 Ga0207711_10000817 3300025941 Bacteria 30510
87 Ga0207689_10011327 3300025942 Bacteria 7650
88 Ga0207667_10352237 3300025949 Bacteria 1501
89 Ga0207651_10000016 3300025960 Bacteria 122094
90 Ga0207641_10380867 3300026088 Bacteria 1351
91 Ga0207648_10000482 3300026089 Bacteria 44351
92 Ga0207676_10019868 3300026095 Bacteria 4906
93 Ga0307515_10008063 3300028794 Bacteria 20644
94 Ga0265338_10021059 3300028800 Bacteria 6818
95 Ga0265324_10006537 3300029957 Bacteria 4840
96 Ga0307508_10072941 3300031616 Bacteria 3008
97 Ga0307516_10002952 3300031730 Bacteria 22263
98 Ga0307516_10016789 3300031730 Bacteria 7645
99 Ga0373931_0031604 3300035691 Bacteria 2734
100 Ga0395899_0000104 3300037312 Bacteria 147238
101 Ga0395900_0000063 3300037418 Bacteria 201374
102 Ga0395900_0000942 3300037418 Bacteria 37967
103 Ga0395900_0010518 3300037418 Bacteria 9465
104 Ga0395898_0000169 3300037466 Bacteria 168667
105 Ga0395898_0003745 3300037466 Bacteria 16861
106 Ga0395898_0068330 3300037466 Bacteria 3438
107 Ga0395898_0529574 3300037466 Bacteria 1120
108 Ga0395905_0000109 3300037471 Bacteria 137754
109 Ga0395905_0022895 3300037471 Bacteria 5905
110 Ga0395905_0144836 3300037471 Bacteria 2235
111 Ga0395901_0053122 3300038443 Bacteria 4210
112 Ga0395901_0106511 3300038443 Bacteria 2942
113 Ga0439448_0006146 3300042005 Bacteria 3445
114 Ga0439458_0001410 3300042157 Bacteria 6060
115 Ga0439458_0007833 3300042157 Bacteria 2377
116 Ga0451577_0540110 3300042876 Bacteria 1058
117 Ga0466972_0003086 3300044658 Bacteria 8255
118 Ga0453683_0039992 3300044673 Bacteria 2946
119 Ga0453683_0176897 3300044673 Bacteria 1352
120 Ga0466965_0070096 3300044683 Bacteria 1762
121 Ga0466964_0005310 3300044706 Bacteria 4781
122 Ga0466968_0006503 3300044735 Bacteria 4408
123 Ga0466970_0003849 3300044765 Bacteria 7351
124 Ga0466970_0043245 3300044765 Bacteria 2397
125 Ga0466957_0057667 3300044842 Bacteria 2377
126 Ga0466957_0067801 3300044842 Bacteria 2202
127 Ga0466957_0306405 3300044842 Bacteria 1068
128 Ga0466960_0011311 3300044901 Bacteria 3729
129 Ga0466959_0614832 3300045049 Bacteria 730
130 Ga0466958_0095908 3300045836 Bacteria 1839
131 Ga0466967_0034351 3300045976 Bacteria 4303
132 Ga0466967_0345667 3300045976 Bacteria 1439
133 Ga0495590_0005628 3300046457 Bacteria 4938
134 Ga0495638_0008191 3300046460 Bacteria 7432
135 Ga0495651_0173512 3300046462 Bacteria 1533
136 Ga0495650_0000405 3300046471 Bacteria 71148
137 Ga0495605_0005250 3300046474 Bacteria 7558
138 Ga0495639_0005939 3300046475 Bacteria 5254
139 Ga0495584_0000240 3300046491 Bacteria 39603
140 Ga0495607_0055910 3300046501 Bacteria 2267
141 Ga0495606_0013066 3300046507 Bacteria 6596
142 Ga0495606_0049800 3300046507 Bacteria 2744
143 Ga0495608_0053624 3300046511 Bacteria 2668
144 Ga0495610_0039348 3300046512 Bacteria 2392
145 Ga0495620_0023647 3300046515 Bacteria 2934
146 Ga0495620_0071279 3300046515 Bacteria 1421
147 Ga0495630_0000514 3300046517 Bacteria 28617
148 Ga0495632_0000207 3300046519 Bacteria 59532
149 Ga0495632_0006135 3300046519 Bacteria 7788
150 Ga0495632_0057211 3300046519 Bacteria 1904
151 Ga0495637_0008527 3300046520 Bacteria 5030
152 Ga0495643_0006652 3300046522 Bacteria 7577
153 Ga0495643_0018734 3300046522 Bacteria 4013
154 Ga0495648_0002354 3300046524 Bacteria 17552
155 Ga0495648_0025070 3300046524 Bacteria 4045
156 Ga0495642_0000114 3300046528 Bacteria 45647
157 Ga0495654_0070719 3300046530 Bacteria 1654
158 Ga0495609_0001306 3300046538 Bacteria 16989
159 Ga0495621_0001163 3300046539 Bacteria 6803
160 Ga0495597_0007442 3300046542 Bacteria 5562
161 Ga0495597_0016495 3300046542 Bacteria 3486
162 Ga0495622_0004955 3300046557 Bacteria 6168
163 Ga0495625_0000101 3300046660 Bacteria 139139
164 Ga0495625_0009885 3300046660 Bacteria 7933
165 Ga0495625_0031139 3300046660 Bacteria 3971
166 Ga0495659_0013563 3300046664 Bacteria 2656
167 Ga0495661_0000912 3300046665 Bacteria 27119
168 Ga0495661_0113164 3300046665 Bacteria 1509
169 Ga0495657_0016395 3300046675 Bacteria 5399
170 Ga0495623_0032659 3300046679 Bacteria 3344
171 Ga0495671_0025203 3300046692 Bacteria 3092
172 Ga0495649_0002039 3300046694 Bacteria 14577
173 Ga0495649_0003006 3300046694 Bacteria 11575
174 Ga0495589_0013211 3300046794 Bacteria 4261
175 Ga0495589_0020724 3300046794 Bacteria 3361
176 Ga0495600_0004929 3300046809 Bacteria 8014
177 Ga0495660_0016501 3300046810 Bacteria 4257
178 Ga0495604_0009038 3300047317 Bacteria 7883
179 Ga0495636_0013035 3300047318 Bacteria 3295
180 Ga0495672_0006455 3300047320 Bacteria 9077
181 Ga0495672_0032613 3300047320 Bacteria 3238
182 Ga0495672_0044099 3300047320 Bacteria 2677
183 Ga0495680_0063355 3300047322 Bacteria 2839
184 Ga0495687_003897 3300047443 Bacteria 10461
185 Ga0495675_0023629 3300047444 Bacteria 3917
186 Ga0495684_0050519 3300047471 Bacteria 3174
187 Ga0495686_0028679 3300047472 Bacteria 3624
188 Ga0495686_0111964 3300047472 Bacteria 1636
189 Ga0495593_0003240 3300047673 Bacteria 9757
190 Ga0495626_0002465 3300048091 Bacteria 12814
191 Ga0496108_0029834 3300048911 Bacteria 4519
192 Ga0496109_0001589 3300048912 Bacteria 18947
193 Ga0496110_0536786 3300048913 Bacteria 1063
194 Ga0496112_0003363 3300048915 Bacteria 13202
195 Ga0496112_0136247 3300048915 Bacteria 2425
196 Ga0496113_0005385 3300048916 Bacteria 7978
197 Ga0496117_0010672 3300048920 Bacteria 8321
198 Ga0496118_0004958 3300048921 Bacteria 15414
199 Ga0496119_0023596 3300048922 Bacteria 4355
200 Ga0496119_0074231 3300048922 Bacteria 1981
201 Ga0496120_0025808 3300048923 Bacteria 3642
202 Ga0496121_0000105 3300048924 Bacteria 191437
203 Ga0496121_0029788 3300048924 Bacteria 5033
204 Ga0496121_0079808 3300048924 Bacteria 2596
205 Ga0496122_0005591 3300048925 Bacteria 14879
206 Ga0496123_0016109 3300048926 Bacteria 6090
207 Ga0496125_0062522 3300048928 Bacteria 2976
208 Ga0496126_0049743 3300048929 Bacteria 3825
209 Ga0495678_003058 3300049459 Bacteria 10619
210 Ga0495682_0004035 3300049460 Bacteria 6387
211 Ga0501032_0166359 3300049569 Bacteria 1447
212 Ga0501034_0045704 3300049571 Bacteria 4424
213 Ga0501034_0184801 3300049571 Bacteria 2048
214 Ga0501036_0160042 3300049572 Bacteria 1898
215 Ga0501039_0057958 3300049575 Bacteria 2999
216 Ga0501047_0063444 3300049581 Bacteria 3564
217 Ga0501068_0419219 3300049584 Bacteria 864
218 Ga0501070_0021271 3300049586 Bacteria 5444
219 Ga0501073_0106032 3300049589 Bacteria 1950
220 Ga0501080_0050077 3300049742 Bacteria 3888
221 Ga0501035_0143006 3300049822 Bacteria 2079
222 Ga0501044_0131122 3300049823 Bacteria 2500
223 Ga0501044_0434952 3300049823 Bacteria 1221
224 nmdc:mga07m45_137833_c1 3300050496 Bacteria 1413
225 Ga0500635_0000118 3300053080 Bacteria 46504
226 Ga0500658_0026038 3300053134 Bacteria 2251
227 Ga0500589_180558 3300053147 Bacteria 830
228 Ga0500636_0028944 3300053177 Bacteria 3271
229 Ga0500587_004724 3300053739 Bacteria 1859
230 2587755391 2585428062 Bacteria 6842168
231 2600202847 2599185354 Bacteria 4398675
232 2774128513 2773857672 Bacteria 4993178
233 2809146701 2808606418 Bacteria 6724496
234 Ga0373923_0063894
235 JGI24739J22299_10044769
236 JGI24735J21928_10011974
237 JGI24735J21928_10020336
238 rootH1_10002643
239 rootH2_10102649
240 rootL2_10032569
241 rootH1_10021181
242 rootH1_10193706
243 Ga0055539_1000291
244 Ga0055533_1000197
245 Ga0055525_1001071
246 Ga0055529_1014402
247 Ga0070658_10038059
248 Ga0070676_10004001
249 Ga0070670_100015462
250 Ga0070670_100101668
251 Ga0068869_100005963
252 Ga0070666_10331157
253 Ga0070680_100184242
254 Ga0070660_100219704
255 Ga0070671_100033205
256 Ga0070673_100000015
257 Ga0070659_100031223
258 Ga0070703_10081763
259 Ga0070709_10263224
260 Ga0070713_100250415
261 Ga0070662_100095702
262 Ga0070681_10047396
263 Ga0070681_10462617
264 Ga0068867_100000236
265 Ga0070699_100697212
266 Ga0070679_100012160
267 Ga0070672_100277457
268 Ga0070693_100027932
269 Ga0068855_100122547
270 Ga0068864_100000984
271 Ga0068865_100001212
272 Ga0105251_10000215
273 Ga0105250_10000220
274 Ga0105240_10068801
275 Ga0105245_10009670
276 Ga0105245_10923981
277 Ga0114129_11219277
278 Ga0105242_10008694
279 Ga0105248_10003186
280 Ga0105248_10771075
281 Ga0105249_10175334
282 Ga0157373_10044292
283 Ga0157378_10000394
284 Ga0163162_10665658
285 Ga0157375_10004676
286 Ga0157377_10051005
287 Ga0157376_10000078
288 Ga0209674_100231
289 Ga0209563_100061
290 Ga0207427_102513
291 Ga0209677_100195
292 Ga0209148_1001934
293 Ga0209759_1012976
294 Ga0209455_1002795
295 Ga0207696_1000011
296 Ga0207713_1000162
297 Ga0207680_10203302
298 Ga0207647_10007374
299 Ga0207647_10018402
300 Ga0207699_10591847
301 Ga0207645_10006551
302 Ga0207705_10069881
303 Ga0207707_10047881
304 Ga0207695_10027971
305 Ga0207660_10097411
306 Ga0207652_10171239
307 Ga0207652_10230579
308 Ga0207650_10018498
309 Ga0207687_10006298
310 Ga0207687_10046971
311 Ga0207700_10191414
312 Ga0207644_10013337
313 Ga0207644_10013954
314 Ga0207690_10028588
315 Ga0207706_10206037
316 Ga0207686_10004020
317 Ga0207709_10000118
318 Ga0207704_10000027
319 Ga0207711_10000817
320 Ga0207689_10011327
321 Ga0207667_10352237
322 Ga0207651_10000016
323 Ga0207641_10380867
324 Ga0207648_10000482
325 Ga0207676_10019868
326 Ga0307515_10008063
327 Ga0265338_10021059
328 Ga0265324_10006537
329 Ga0307508_10072941
330 Ga0307516_10002952
331 Ga0307516_10016789
332 Ga0373931_0031604
333 Ga0395899_0000104
334 Ga0395900_0000063
335 Ga0395900_0000942
336 Ga0395900_0010518
337 Ga0395898_0000169
338 Ga0395898_0003745
339 Ga0395898_0068330
340 Ga0395898_0529574
341 Ga0395905_0000109
342 Ga0395905_0022895
343 Ga0395905_0144836
344 Ga0395901_0053122
345 Ga0395901_0106511
346 Ga0439448_0006146
347 Ga0439458_0001410
348 Ga0439458_0007833
349 Ga0451577_0540110
350 Ga0466972_0003086
351 Ga0453683_0039992
352 Ga0453683_0176897
353 Ga0466965_0070096
354 Ga0466964_0005310
355 Ga0466968_0006503
356 Ga0466970_0003849
357 Ga0466970_0043245
358 Ga0466957_0057667
359 Ga0466957_0067801
360 Ga0466957_0306405
361 Ga0466960_0011311
362 Ga0466959_0614832
363 Ga0466958_0095908
364 Ga0466967_0034351
365 Ga0466967_0345667
366 Ga0495590_0005628
367 Ga0495638_0008191
368 Ga0495651_0173512
369 Ga0495650_0000405
370 Ga0495605_0005250
371 Ga0495639_0005939
372 Ga0495584_0000240
373 Ga0495607_0055910
374 Ga0495606_0013066
375 Ga0495606_0049800
376 Ga0495608_0053624
377 Ga0495610_0039348
378 Ga0495620_0023647
379 Ga0495620_0071279
380 Ga0495630_0000514
381 Ga0495632_0000207
382 Ga0495632_0006135
383 Ga0495632_0057211
384 Ga0495637_0008527
385 Ga0495643_0006652
386 Ga0495643_0018734
387 Ga0495648_0002354
388 Ga0495648_0025070
389 Ga0495642_0000114
390 Ga0495654_0070719
391 Ga0495609_0001306
392 Ga0495621_0001163
393 Ga0495597_0007442
394 Ga0495597_0016495
395 Ga0495622_0004955
396 Ga0495625_0000101
397 Ga0495625_0009885
398 Ga0495625_0031139
399 Ga0495659_0013563
400 Ga0495661_0000912
401 Ga0495661_0113164
402 Ga0495657_0016395
403 Ga0495623_0032659
404 Ga0495671_0025203
405 Ga0495649_0002039
406 Ga0495649_0003006
407 Ga0495589_0013211
408 Ga0495589_0020724
409 Ga0495600_0004929
410 Ga0495660_0016501
411 Ga0495604_0009038
412 Ga0495636_0013035
413 Ga0495672_0006455
414 Ga0495672_0032613
415 Ga0495672_0044099
416 Ga0495680_0063355
417 Ga0495687_003897
418 Ga0495675_0023629
419 Ga0495684_0050519
420 Ga0495686_0028679
421 Ga0495686_0111964
422 Ga0495593_0003240
423 Ga0495626_0002465
424 Ga0496108_0029834
425 Ga0496109_0001589
426 Ga0496110_0536786
427 Ga0496112_0003363
428 Ga0496112_0136247
429 Ga0496113_0005385
430 Ga0496117_0010672
431 Ga0496118_0004958
432 Ga0496119_0023596
433 Ga0496119_0074231
434 Ga0496120_0025808
435 Ga0496121_0000105
436 Ga0496121_0029788
437 Ga0496121_0079808
438 Ga0496122_0005591
439 Ga0496123_0016109
440 Ga0496125_0062522
441 Ga0496126_0049743
442 Ga0495678_003058
443 Ga0495682_0004035
444 Ga0501032_0166359
445 Ga0501034_0045704
446 Ga0501034_0184801
447 Ga0501036_0160042
448 Ga0501039_0057958
449 Ga0501047_0063444
450 Ga0501068_0419219
451 Ga0501070_0021271
452 Ga0501073_0106032
453 Ga0501080_0050077
454 Ga0501035_0143006
455 Ga0501044_0131122
456 Ga0501044_0434952
457 nmdc:mga07m45_137833_c1
458 Ga0500635_0000118
459 Ga0500658_0026038
460 Ga0500589_180558
461 Ga0500636_0028944
462 Ga0500587_004724
463 2587755391
464 2600202847
465 2774128513
466 2809146701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

58

252

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

64

279

0.91

PF08659

KR

KR domain

58

241

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9447 6 241
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9402 5 241
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9394 8 245
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9379 7 240
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9378 1 242
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 5 180 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 2 91 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9402 5 241 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 7 240 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9333 6 241 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A158A8Y7-F1-model_v4 Oxidoreductase 0.9848 3 245 GO:0016491
AF-A0A2X3J5C1-F1-model_v4 Uncharacterized oxidoreductase SAV2478 (EC 1.-.-.-) 0.9824 64 245 GO:0016491
AF-A0A158L0S5-F1-model_v4 Oxidoreductase 0.9801 1 245 GO:0016491
AF-A0A1M6T268-F1-model_v4 Short chain dehydrogenase 0.98 1 172 GO:0005829
GO:0016491
AF-A0A563D8W8-F1-model_v4 SDR family oxidoreductase 0.9776 3 245 GO:0016491

Map