F346554

General Info

Members Datasets Scaffolds Average Seq Length
233 143 466 257

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_057789|Ga0500643_057789_59_967
Length 293
Sequence LVRCISSATDNVGPICREGEALNAATPCLPADALLRAAAARIGRTDAEPLLLHALGRDRAWLFTHGRDPVDPAVAETFETLVARREAGEPVAYLTGRRGFWTLDLRVTPATLIPRPETETLVELALERVDAMPGRRIADLGTGSERPSARVIAVDLSEAALAVARANAADHTLGNVEFRHGSWLAPLTGERFDLIASNPPYIAADDPHLAQGDLRHEPAEALASGDDGLDAIREIVAGAPAHLLAGGWLLFEHGWDQGGAVAELLRQCGFVEVATHRDLEDRDRVTLGRWPAP

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
142 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
143 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0.86
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.17
Nodule 0
Rhizoplane 0.43
Rhizosphere 69.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_057789 3300053087 Bacteria 1094
2 JGI24736J21556_1001350 3300001904 Bacteria 4485
3 JGI25156J39149_1000869 3300002705 Bacteria 15048
4 JGI25156J39149_1001216 3300002705 Bacteria 11376
5 JGI25162J39368_1001600 3300002737 Bacteria 11383
6 JGI25162J39368_1002096 3300002737 Bacteria 8511
7 JGI25162J39368_1002519 3300002737 Bacteria 7005
8 JGI25154J39366_1001293 3300002738 Bacteria 9289
9 JGI25154J39366_1003856 3300002738 Bacteria 2934
10 JGI25157J39369_1000161 3300002741 Bacteria 56020
11 JGI25157J39369_1000774 3300002741 Bacteria 16565
12 JGI25157J39369_1001838 3300002741 Bacteria 6662
13 JGI25164J39214_1000713 3300002772 Bacteria 12708
14 JGI25164J39214_1000783 3300002772 Bacteria 11494
15 JGI25164J39214_1000822 3300002772 Bacteria 10871
16 JGI25165J46597_1001276 3300003214 Bacteria 14684
17 JGI25165J46597_1001552 3300003214 Bacteria 11383
18 JGI25165J46597_1001886 3300003214 Bacteria 8505
19 Ga0055539_1001036 3300003752 Bacteria 5964
20 Ga0055535_1000443 3300003761 Bacteria 38316
21 Ga0055535_1001687 3300003761 Bacteria 10088
22 Ga0055542_1000110 3300003762 Bacteria 110960
23 Ga0055542_1001503 3300003762 Bacteria 11384
24 Ga0055529_1001130 3300003763 Bacteria 11384
25 Ga0068869_100086045 3300005334 Bacteria 2355
26 Ga0070666_10196476 3300005335 Bacteria 1418
27 Ga0070682_100006012 3300005337 Bacteria 6794
28 Ga0068868_100080989 3300005338 Bacteria 2602
29 Ga0070660_100019384 3300005339 Bacteria 4985
30 Ga0070691_10074014 3300005341 Bacteria 1657
31 Ga0070692_10148566 3300005345 Bacteria 1333
32 Ga0070671_100161778 3300005355 Bacteria 1892
33 Ga0070674_100008309 3300005356 Bacteria 6176
34 Ga0070659_100021045 3300005366 Bacteria 4961
35 Ga0070659_100099833 3300005366 Bacteria 2335
36 Ga0070714_100000244 3300005435 Bacteria 42515
37 Ga0070714_100002987 3300005435 Bacteria 12531
38 Ga0070714_100019684 3300005435 Bacteria 5502
39 Ga0070713_100001046 3300005436 Bacteria 17685
40 Ga0070710_10023051 3300005437 Bacteria 3266
41 Ga0070705_100280078 3300005440 Bacteria 1185
42 Ga0070663_100063874 3300005455 Bacteria 2659
43 Ga0070663_100390670 3300005455 Bacteria 1135
44 Ga0070678_100045124 3300005456 Bacteria 3151
45 Ga0070662_100331948 3300005457 Bacteria 1242
46 Ga0068853_100017810 3300005539 Bacteria 5866
47 Ga0070696_100016062 3300005546 Bacteria 5035
48 Ga0070696_100045239 3300005546 Bacteria 3050
49 Ga0070696_100120552 3300005546 Bacteria 1898
50 Ga0070693_100000436 3300005547 Bacteria 18835
51 Ga0070693_100024735 3300005547 Bacteria 3224
52 Ga0068855_100101810 3300005563 Bacteria 3306
53 Ga0068855_100512286 3300005563 Bacteria 1303
54 Ga0068857_100008925 3300005577 Bacteria 8685
55 Ga0068857_100014849 3300005577 Bacteria 6791
56 Ga0068857_100321322 3300005577 Bacteria 1429
57 Ga0068854_100014534 3300005578 Bacteria 5193
58 Ga0068854_100065372 3300005578 Bacteria 2644
59 Ga0068856_100000239 3300005614 Bacteria 59777
60 Ga0068856_100023499 3300005614 Bacteria 5994
61 Ga0068856_100117758 3300005614 Bacteria 2657
62 Ga0070702_100006320 3300005615 Bacteria 5599
63 Ga0068852_100196454 3300005616 Bacteria 1907
64 Ga0068866_10001517 3300005718 Bacteria 9879
65 Ga0068860_100012172 3300005843 Bacteria 8475
66 Ga0075370_10022904 3300006353 Bacteria 3435
67 Ga0068871_100160712 3300006358 Bacteria 1921
68 Ga0105240_10055301 3300009093 Bacteria 4969
69 Ga0105240_10234327 3300009093 Bacteria 2131
70 Ga0105245_10046157 3300009098 Bacteria 3893
71 Ga0105241_10146247 3300009174 Bacteria 1929
72 Ga0105242_10017662 3300009176 Bacteria 5564
73 Ga0105237_10000351 3300009545 Bacteria 64886
74 Ga0105238_10108790 3300009551 Bacteria 2753
75 Ga0105239_10033787 3300010375 Bacteria 5615
76 Ga0105239_10246789 3300010375 Bacteria 2005
77 Ga0157373_10018471 3300013100 Bacteria 5077
78 Ga0157373_10138924 3300013100 Bacteria 1708
79 Ga0157371_10033112 3300013102 Bacteria 3715
80 Ga0157370_10019036 3300013104 Bacteria 6902
81 Ga0157370_10054047 3300013104 Bacteria 3829
82 Ga0157370_10489718 3300013104 Bacteria 1130
83 Ga0157370_10559867 3300013104 Bacteria 1048
84 Ga0157369_10002066 3300013105 Bacteria 24251
85 Ga0157378_10062939 3300013297 Bacteria 3314
86 Ga0163162_10138800 3300013306 Bacteria 2543
87 Ga0157372_10232308 3300013307 Bacteria 2138
88 Ga0157372_10257225 3300013307 Bacteria 2027
89 Ga0157372_10285959 3300013307 Bacteria 1918
90 Ga0157372_10398582 3300013307 Bacteria 1604
91 Ga0157372_10986324 3300013307 Bacteria 976
92 Ga0157375_10872457 3300013308 Bacteria 1045
93 Ga0182008_10046167 3300014497 Bacteria 2165
94 Ga0182008_10053553 3300014497 Bacteria 1998
95 Ga0157376_10012606 3300014969 Bacteria 6282
96 Ga0182006_1011633 3300015261 Bacteria 3868
97 Ga0183369_1003 3300015685 Bacteria 726443
98 Ga0163161_10036921 3300017792 Bacteria 3501
99 Ga0206356_10026662 3300020070 Bacteria 1780
100 Ga0206353_11940203 3300020082 Bacteria 1207
101 Ga0209672_101106 3300025228 Bacteria 11415
102 Ga0207427_100057 3300025231 Bacteria 198202
103 Ga0207427_100147 3300025231 Bacteria 80584
104 Ga0207427_100205 3300025231 Bacteria 53817
105 Ga0209437_100005 3300025233 Bacteria 1071596
106 Ga0209437_100349 3300025233 Bacteria 53817
107 Ga0209437_101148 3300025233 Bacteria 7907
108 Ga0209258_100165 3300025242 Bacteria 148376
109 Ga0209258_100659 3300025242 Bacteria 24988
110 Ga0209258_101118 3300025242 Bacteria 11233
111 Ga0209646_1000157 3300025246 Bacteria 94054
112 Ga0209646_1001078 3300025246 Bacteria 8175
113 Ga0209646_1006527 3300025246 Bacteria 1955
114 Ga0209026_1000006 3300025250 Bacteria 677225
115 Ga0209026_1000084 3300025250 Bacteria 186997
116 Ga0209026_1000090 3300025250 Bacteria 172829
117 Ga0209026_1001279 3300025250 Bacteria 11436
118 Ga0209677_101252 3300025253 Bacteria 11431
119 Ga0209148_1000092 3300025254 Bacteria 249076
120 Ga0209148_1000201 3300025254 Bacteria 107073
121 Ga0209759_1000194 3300025256 Bacteria 97047
122 Ga0209759_1001676 3300025256 Bacteria 11551
123 Ga0209759_1003745 3300025256 Bacteria 5944
124 Ga0209759_1006939 3300025256 Bacteria 3728
125 Ga0209233_1000011 3300025261 Bacteria 1071611
126 Ga0209233_1000315 3300025261 Bacteria 53817
127 Ga0209233_1000335 3300025261 Bacteria 47566
128 Ga0209455_1000018 3300025272 Bacteria 718034
129 Ga0209455_1000368 3300025272 Bacteria 41648
130 Ga0209455_1024971 3300025272 Bacteria 1096
131 Ga0209051_1006637 3300025303 Bacteria 6483
132 Ga0209257_1056075 3300025304 Bacteria 1089
133 Ga0207680_10292175 3300025903 Bacteria 1134
134 Ga0207647_10000016 3300025904 Bacteria 130866
135 Ga0207647_10068784 3300025904 Bacteria 2142
136 Ga0207654_10021806 3300025911 Bacteria 3411
137 Ga0207695_10021157 3300025913 Bacteria 7429
138 Ga0207671_10001262 3300025914 Bacteria 29805
139 Ga0207671_10228497 3300025914 Bacteria 1459
140 Ga0207694_10188171 3300025924 Bacteria 1676
141 Ga0207687_10006084 3300025927 Bacteria 7988
142 Ga0207700_10003751 3300025928 Bacteria 8870
143 Ga0207664_10000132 3300025929 Bacteria 64236
144 Ga0207664_10002042 3300025929 Bacteria 13298
145 Ga0207664_10114135 3300025929 Bacteria 2250
146 Ga0207690_10002164 3300025932 Bacteria 12007
147 Ga0207690_10003943 3300025932 Bacteria 8773
148 Ga0207690_10043469 3300025932 Bacteria 2957
149 Ga0207706_10041672 3300025933 Bacteria 4069
150 Ga0207706_10079453 3300025933 Bacteria 2885
151 Ga0207686_10000406 3300025934 Bacteria 29849
152 Ga0207669_10011363 3300025937 Bacteria 4329
153 Ga0207704_10283906 3300025938 Bacteria 1260
154 Ga0207711_10572009 3300025941 Bacteria 1054
155 Ga0207689_10223469 3300025942 Bacteria 1556
156 Ga0207667_10001852 3300025949 Bacteria 26559
157 Ga0207667_10011089 3300025949 Bacteria 10495
158 Ga0207667_10305718 3300025949 Bacteria 1625
159 Ga0207677_10012454 3300026023 Bacteria 4890
160 Ga0207639_10009120 3300026041 Bacteria 6836
161 Ga0207639_10057225 3300026041 Bacteria 2993
162 Ga0207678_10022520 3300026067 Bacteria 5517
163 Ga0207678_10320120 3300026067 Bacteria 1334
164 Ga0207702_10002902 3300026078 Bacteria 16043
165 Ga0207702_10003117 3300026078 Bacteria 15366
166 Ga0207702_10068614 3300026078 Bacteria 3046
167 Ga0207648_10040522 3300026089 Bacteria 4093
168 Ga0207674_10004639 3300026116 Bacteria 16503
169 Ga0207674_10008173 3300026116 Bacteria 12133
170 Ga0207674_10185612 3300026116 Bacteria 2030
171 Ga0207683_10000249 3300026121 Bacteria 48074
172 Ga0207698_10073224 3300026142 Bacteria 2727
173 Ga0268264_10087412 3300028381 Bacteria 2680
174 Ga0373943_0065102 3300035170 Bacteria 1832
175 Ga0395899_0001190 3300037312 Bacteria 22916
176 Ga0395899_0002734 3300037312 Bacteria 14221
177 Ga0395899_0118948 3300037312 Bacteria 1894
178 Ga0395900_0003375 3300037418 Bacteria 17243
179 Ga0395900_0041381 3300037418 Bacteria 4750
180 Ga0395898_0000922 3300037466 Bacteria 47049
181 Ga0395898_0016247 3300037466 Bacteria 7617
182 Ga0395898_0065666 3300037466 Bacteria 3517
183 Ga0395898_0110929 3300037466 Bacteria 2629
184 Ga0395898_0807325 3300037466 Bacteria 878
185 Ga0395905_0099826 3300037471 Bacteria 2726
186 Ga0395901_0001368 3300038443 Bacteria 25522
187 Ga0395901_0002206 3300038443 Bacteria 19856
188 Ga0395901_0002225 3300038443 Bacteria 19803
189 Ga0395901_0227022 3300038443 Bacteria 1950
190 Ga0439459_0000613 3300042438 Bacteria 4792
191 Ga0466969_0003585 3300044656 Bacteria 8264
192 Ga0466966_0004337 3300044684 Bacteria 9349
193 Ga0466961_0006522 3300044693 Bacteria 7416
194 Ga0466961_0037895 3300044693 Bacteria 3092
195 Ga0466967_0426412 3300045976 Bacteria 1293
196 Ga0495638_0000019 3300046460 Bacteria 384671
197 Ga0495582_0041998 3300046473 Bacteria 2519
198 Ga0495664_0015543 3300046477 Bacteria 4328
199 Ga0495645_0024851 3300046543 Bacteria 4346
200 Ga0495633_0038974 3300046558 Bacteria 2268
201 Ga0495588_0117298 3300046674 Bacteria 1403
202 Ga0495658_0195353 3300046683 Bacteria 1259
203 Ga0495686_0000117 3300047472 Bacteria 166073
204 Ga0496109_0272116 3300048912 Bacteria 1596
205 Ga0496117_0011406 3300048920 Bacteria 7960
206 Ga0496117_0059967 3300048920 Bacteria 2625
207 Ga0496118_0001051 3300048921 Bacteria 43101
208 Ga0496118_0017420 3300048921 Bacteria 6539
209 Ga0496118_0115747 3300048921 Bacteria 1764
210 Ga0496121_0006894 3300048924 Bacteria 13872
211 Ga0496122_0088094 3300048925 Bacteria 2129
212 Ga0496123_0047538 3300048926 Bacteria 2897
213 Ga0496125_0024853 3300048928 Bacteria 5498
214 Ga0501033_0001935 3300049570 Bacteria 18038
215 Ga0501034_0632871 3300049571 Bacteria 973
216 Ga0501037_0389387 3300049573 Bacteria 957
217 Ga0501043_0133159 3300049579 Bacteria 1948
218 Ga0501047_0001595 3300049581 Bacteria 22104
219 Ga0501047_0220891 3300049581 Bacteria 1751
220 Ga0501047_0302085 3300049581 Bacteria 1443
221 Ga0501048_0065125 3300049582 Bacteria 2577
222 Ga0501035_0030778 3300049822 Bacteria 4892
223 Ga0501035_0443495 3300049822 Bacteria 1075
224 Ga0501044_0071107 3300049823 Bacteria 3538
225 Ga0501044_0097154 3300049823 Bacteria 2967
226 Ga0501044_0240053 3300049823 Bacteria 1756
227 Ga0501044_0335625 3300049823 Bacteria 1433
228 nmdc:mga07m45_136_c1 3300050496 Bacteria 27318
229 Ga0500634_0000311 3300053161 Bacteria 15499
230 Ga0466962_0010320 3300061719 Bacteria 4486
231 2526212087 2526164512 Bacteria 4025691
232 2884341970 2884338543 Bacteria 4610696
233 2941473972 2941471342 Bacteria 5018624
234 Ga0500643_057789
235 JGI24736J21556_1001350
236 JGI25156J39149_1000869
237 JGI25156J39149_1001216
238 JGI25162J39368_1001600
239 JGI25162J39368_1002096
240 JGI25162J39368_1002519
241 JGI25154J39366_1001293
242 JGI25154J39366_1003856
243 JGI25157J39369_1000161
244 JGI25157J39369_1000774
245 JGI25157J39369_1001838
246 JGI25164J39214_1000713
247 JGI25164J39214_1000783
248 JGI25164J39214_1000822
249 JGI25165J46597_1001276
250 JGI25165J46597_1001552
251 JGI25165J46597_1001886
252 Ga0055539_1001036
253 Ga0055535_1000443
254 Ga0055535_1001687
255 Ga0055542_1000110
256 Ga0055542_1001503
257 Ga0055529_1001130
258 Ga0068869_100086045
259 Ga0070666_10196476
260 Ga0070682_100006012
261 Ga0068868_100080989
262 Ga0070660_100019384
263 Ga0070691_10074014
264 Ga0070692_10148566
265 Ga0070671_100161778
266 Ga0070674_100008309
267 Ga0070659_100021045
268 Ga0070659_100099833
269 Ga0070714_100000244
270 Ga0070714_100002987
271 Ga0070714_100019684
272 Ga0070713_100001046
273 Ga0070710_10023051
274 Ga0070705_100280078
275 Ga0070663_100063874
276 Ga0070663_100390670
277 Ga0070678_100045124
278 Ga0070662_100331948
279 Ga0068853_100017810
280 Ga0070696_100016062
281 Ga0070696_100045239
282 Ga0070696_100120552
283 Ga0070693_100000436
284 Ga0070693_100024735
285 Ga0068855_100101810
286 Ga0068855_100512286
287 Ga0068857_100008925
288 Ga0068857_100014849
289 Ga0068857_100321322
290 Ga0068854_100014534
291 Ga0068854_100065372
292 Ga0068856_100000239
293 Ga0068856_100023499
294 Ga0068856_100117758
295 Ga0070702_100006320
296 Ga0068852_100196454
297 Ga0068866_10001517
298 Ga0068860_100012172
299 Ga0075370_10022904
300 Ga0068871_100160712
301 Ga0105240_10055301
302 Ga0105240_10234327
303 Ga0105245_10046157
304 Ga0105241_10146247
305 Ga0105242_10017662
306 Ga0105237_10000351
307 Ga0105238_10108790
308 Ga0105239_10033787
309 Ga0105239_10246789
310 Ga0157373_10018471
311 Ga0157373_10138924
312 Ga0157371_10033112
313 Ga0157370_10019036
314 Ga0157370_10054047
315 Ga0157370_10489718
316 Ga0157370_10559867
317 Ga0157369_10002066
318 Ga0157378_10062939
319 Ga0163162_10138800
320 Ga0157372_10232308
321 Ga0157372_10257225
322 Ga0157372_10285959
323 Ga0157372_10398582
324 Ga0157372_10986324
325 Ga0157375_10872457
326 Ga0182008_10046167
327 Ga0182008_10053553
328 Ga0157376_10012606
329 Ga0182006_1011633
330 Ga0183369_1003
331 Ga0163161_10036921
332 Ga0206356_10026662
333 Ga0206353_11940203
334 Ga0209672_101106
335 Ga0207427_100057
336 Ga0207427_100147
337 Ga0207427_100205
338 Ga0209437_100005
339 Ga0209437_100349
340 Ga0209437_101148
341 Ga0209258_100165
342 Ga0209258_100659
343 Ga0209258_101118
344 Ga0209646_1000157
345 Ga0209646_1001078
346 Ga0209646_1006527
347 Ga0209026_1000006
348 Ga0209026_1000084
349 Ga0209026_1000090
350 Ga0209026_1001279
351 Ga0209677_101252
352 Ga0209148_1000092
353 Ga0209148_1000201
354 Ga0209759_1000194
355 Ga0209759_1001676
356 Ga0209759_1003745
357 Ga0209759_1006939
358 Ga0209233_1000011
359 Ga0209233_1000315
360 Ga0209233_1000335
361 Ga0209455_1000018
362 Ga0209455_1000368
363 Ga0209455_1024971
364 Ga0209051_1006637
365 Ga0209257_1056075
366 Ga0207680_10292175
367 Ga0207647_10000016
368 Ga0207647_10068784
369 Ga0207654_10021806
370 Ga0207695_10021157
371 Ga0207671_10001262
372 Ga0207671_10228497
373 Ga0207694_10188171
374 Ga0207687_10006084
375 Ga0207700_10003751
376 Ga0207664_10000132
377 Ga0207664_10002042
378 Ga0207664_10114135
379 Ga0207690_10002164
380 Ga0207690_10003943
381 Ga0207690_10043469
382 Ga0207706_10041672
383 Ga0207706_10079453
384 Ga0207686_10000406
385 Ga0207669_10011363
386 Ga0207704_10283906
387 Ga0207711_10572009
388 Ga0207689_10223469
389 Ga0207667_10001852
390 Ga0207667_10011089
391 Ga0207667_10305718
392 Ga0207677_10012454
393 Ga0207639_10009120
394 Ga0207639_10057225
395 Ga0207678_10022520
396 Ga0207678_10320120
397 Ga0207702_10002902
398 Ga0207702_10003117
399 Ga0207702_10068614
400 Ga0207648_10040522
401 Ga0207674_10004639
402 Ga0207674_10008173
403 Ga0207674_10185612
404 Ga0207683_10000249
405 Ga0207698_10073224
406 Ga0268264_10087412
407 Ga0373943_0065102
408 Ga0395899_0001190
409 Ga0395899_0002734
410 Ga0395899_0118948
411 Ga0395900_0003375
412 Ga0395900_0041381
413 Ga0395898_0000922
414 Ga0395898_0016247
415 Ga0395898_0065666
416 Ga0395898_0110929
417 Ga0395898_0807325
418 Ga0395905_0099826
419 Ga0395901_0001368
420 Ga0395901_0002206
421 Ga0395901_0002225
422 Ga0395901_0227022
423 Ga0439459_0000613
424 Ga0466969_0003585
425 Ga0466966_0004337
426 Ga0466961_0006522
427 Ga0466961_0037895
428 Ga0466967_0426412
429 Ga0495638_0000019
430 Ga0495582_0041998
431 Ga0495664_0015543
432 Ga0495645_0024851
433 Ga0495633_0038974
434 Ga0495588_0117298
435 Ga0495658_0195353
436 Ga0495686_0000117
437 Ga0496109_0272116
438 Ga0496117_0011406
439 Ga0496117_0059967
440 Ga0496118_0001051
441 Ga0496118_0017420
442 Ga0496118_0115747
443 Ga0496121_0006894
444 Ga0496122_0088094
445 Ga0496123_0047538
446 Ga0496125_0024853
447 Ga0501033_0001935
448 Ga0501034_0632871
449 Ga0501037_0389387
450 Ga0501043_0133159
451 Ga0501047_0001595
452 Ga0501047_0220891
453 Ga0501047_0302085
454 Ga0501048_0065125
455 Ga0501035_0030778
456 Ga0501035_0443495
457 Ga0501044_0071107
458 Ga0501044_0097154
459 Ga0501044_0240053
460 Ga0501044_0335625
461 nmdc:mga07m45_136_c1
462 Ga0500634_0000311
463 Ga0466962_0010320
464 2526212087
465 2884341970
466 2941473972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

30

96

0.95

PF08241

Methyltransf_11

Methyltransferase domain

134

211

0.89

PF05175

MTS

Methyltransferase small domain

120

226

0.83

PF13649

Methyltransf_25

Methyltransferase domain

134

216

0.83

PF13847

Methyltransf_31

Methyltransferase domain

132

224

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9478 3 262
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9205 3 262
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.8724 6 267
1nv9-assembly1.cif.gz_A hemk, apo structure 0.8714 6 260
1nv8-assembly2.cif.gz_B n5-glutamine methyltransferase, hemk 0.8679 6 267
ID Description Score Start End Superfamily
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9546 2 79 1.10.8.10
af_Q2FWE1_84_278_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9455 80 262 3.40.50.150
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9413 82 262 3.40.50.150
1nv8A01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9204 2 70 1.10.8.10
1t43A01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9099 3 81 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A6S6T7L3-F1-model_v4 Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2 0.9787 170 264 GO:0032259
GO:0036009
AF-A0A1H1AVJ5-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9767 2 265 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A5C7RFZ5-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9765 3 264 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A1E4ZNI3-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9751 2 262 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A522X5N3-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9739 61 264 GO:0003676
GO:0032259
GO:0036009
GO:0102559

Map