F346593

General Info

Members Datasets Scaffolds Average Seq Length
233 200 205 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221621|2644121676
Length 240
Sequence LSDIHGNLPALQAVVADAKQRGCTRFLSLGDVAGYLAQPGECIDLLRELEAPNVLGNHDSYITLDENCPRSRVVTQIINYQKSILSTDQVAWLKGSQESIREGDCLYVHGGPEDPRDQYLYTISADKIPADVRLLFSGHTHVQVLAHFGPQRYCNPGSVGQPRDGDRRAAYATLHNDQVHLHRVAYDIDRTVQAMKAAGFEPFCYENLYKGAQIGGRVDSVNIIQNTESQDHGRHQTIPE

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
3 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
4 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
7 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
8 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
9 2643221594 Achromobacter sp. Root170 Isolate Unclassified
10 2643221607 Rhizobium sp. Root73 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
13 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
14 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
15 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
16 2643221723 Ensifer sp. Root278 Isolate Unclassified
17 2671180694 Paenibacillus sp. A3 Isolate Unclassified
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
20 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
21 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
22 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
23 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
24 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
25 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
26 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
73 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
113 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
119 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
123 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
181 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
186 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
194 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
197 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
198 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
199 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
200 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.55
Metatranscriptomes 0.43
Isolates 12.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.04
Nodule 0.86
Rhizoplane 6.44
Rhizosphere 46.78
Stem 0
Stem Tuber 0
Unclassified 18.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000638 3300002737 Bacteria 24891
2 JGI25158J39367_1003469 3300002739 Bacteria 2435
3 JGI25159J45721_1000008 3300002987 Bacteria 172667
4 JGI25151J46595_10014301 3300003187 Bacteria 3539
5 JGI25165J46597_1002392 3300003214 Bacteria 6196
6 JGI25165J46597_1004707 3300003214 Bacteria 2835
7 rootH1_10053596 3300003323 Bacteria 3051
8 rootH1_10309905 3300003323 Bacteria 1188
9 JGI25160J50197_1000033 3300003354 Bacteria 172667
10 JGI25161J50226_1003752 3300003374 Bacteria 3372
11 Ga0055526_1000440 3300003771 Bacteria 33129
12 Ga0055536_1002658 3300003781 Bacteria 9911
13 Ga0055531_10008462 3300003794 Bacteria 5416
14 Ga0055543_1000026 3300004625 Bacteria 136177
15 Ga0065165_1000178 3300005262 Bacteria 113319
16 Ga0065165_1000278 3300005262 Bacteria 87353
17 Ga0065714_10065066 3300005288 Bacteria 13300
18 Ga0065704_10164176 3300005289 Bacteria 1334
19 Ga0065707_10172666 3300005295 Bacteria 1473
20 Ga0070658_10000427 3300005327 Bacteria 36514
21 Ga0070658_10006490 3300005327 Bacteria 9482
22 Ga0070658_10025207 3300005327 Unclassified 4767
23 Ga0070676_10158133 3300005328 Bacteria 1456
24 Ga0070666_10028004 3300005335 Bacteria 3695
25 Ga0070689_100535118 3300005340 Bacteria 1008
26 Ga0070669_100766395 3300005353 Unclassified 818
27 Ga0070671_100000001 3300005355 Bacteria 1228151
28 Ga0070701_10093511 3300005438 Bacteria 1652
29 Ga0070705_100491415 3300005440 Bacteria 930
30 Ga0070707_100461126 3300005468 Bacteria 1232
31 Ga0070698_100232801 3300005471 Bacteria 1775
32 Ga0070699_100265471 3300005518 Bacteria 1536
33 Ga0070665_100014248 3300005548 Bacteria 7985
34 Ga0068855_100171860 3300005563 Unclassified 2454
35 Ga0068857_100154472 3300005577 Unclassified 2080
36 Ga0068870_10199895 3300005840 Bacteria 1211
37 Ga0081455_10084771 3300005937 Unclassified 2585
38 Ga0081540_1003477 3300005983 Bacteria 12428
39 Ga0075369_10006228 3300006186 Bacteria 4506
40 Ga0075428_100022977 3300006844 Bacteria 6901
41 Ga0075428_100144163 3300006844 Bacteria 2589
42 Ga0075431_100085267 3300006847 Bacteria 3260
43 Ga0075429_100000358 3300006880 Bacteria 33554
44 Ga0075429_100032081 3300006880 Bacteria 4566
45 Ga0105240_10054529 3300009093 Bacteria 5010
46 Ga0105245_10291657 3300009098 Bacteria 1598
47 Ga0114129_10003853 3300009147 Bacteria 21155
48 Ga0105241_10205420 3300009174 Unclassified 1648
49 Ga0105249_10668235 3300009553 Bacteria 1097
50 Ga0171463_1007 3300013249 Bacteria 301198
51 Ga0157378_10236231 3300013297 Bacteria 1744
52 Ga0157377_10099254 3300014745 Bacteria 1732
53 Ga0183365_10950 3300015684 Bacteria 1019
54 Ga0183363_1138 3300015690 Bacteria 18553
55 Ga0213876_10001235 3300021384 Bacteria 16120
56 Ga0209436_100512 3300025208 Bacteria 16963
57 Ga0209437_100122 3300025233 Bacteria 201364
58 Ga0209233_1000317 3300025261 Bacteria 53589
59 Ga0209233_1001032 3300025261 Bacteria 11766
60 Ga0209130_1000017 3300025284 Bacteria 388431
61 Ga0209676_1002135 3300025292 Bacteria 15048
62 Ga0209025_1000153 3300025294 Bacteria 170548
63 Ga0209564_1000013 3300025295 Bacteria 775755
64 Ga0209050_1003385 3300025298 Bacteria 11835
65 Ga0209256_1002290 3300025299 Bacteria 16100
66 Ga0209256_1030763 3300025299 Bacteria 1477
67 Ga0207426_1000006 3300025302 Bacteria 1025969
68 Ga0207426_1036491 3300025302 Bacteria 1562
69 Ga0209051_1023330 3300025303 Bacteria 2576
70 Ga0209257_1005144 3300025304 Bacteria 9443
71 Ga0207653_10026775 3300025885 Bacteria 1850
72 Ga0207680_10060901 3300025903 Bacteria 2300
73 Ga0207647_10000410 3300025904 Bacteria 35247
74 Ga0207643_10200410 3300025908 Bacteria 1215
75 Ga0207705_10000057 3300025909 Bacteria 157369
76 Ga0207705_10019851 3300025909 Unclassified 4807
77 Ga0207705_10144133 3300025909 Bacteria 1781
78 Ga0207654_10226620 3300025911 Unclassified 1242
79 Ga0207646_10199845 3300025922 Bacteria 1806
80 Ga0207687_10319927 3300025927 Bacteria 1256
81 Ga0207644_10000001 3300025931 Bacteria 1243214
82 Ga0207670_10177492 3300025936 Bacteria 1602
83 Ga0207667_10109892 3300025949 Unclassified 2844
84 Ga0207712_10101977 3300025961 Bacteria 2135
85 Ga0207674_10153385 3300026116 Unclassified 2260
86 Ga0268266_10076017 3300028379 Bacteria 2918
87 Ga0268265_10031157 3300028380 Bacteria 3850
88 Ga0268264_10120849 3300028381 Unclassified 2308
89 Ga0265338_10036570 3300028800 Bacteria 4696
90 Ga0265316_10044134 3300031344 Bacteria 3548
91 Ga0307513_10277643 3300031456 Bacteria 1455
92 Ga0307408_100000018 3300031548 Bacteria 346872
93 Ga0307414_10298034 3300032004 Bacteria 1363
94 Ga0307411_10235034 3300032005 Bacteria 1431
95 Ga0316593_10042239 3300032168 Unclassified 1520
96 Ga0307510_10010031 3300033180 Bacteria 11255
97 Ga0307510_10124433 3300033180 Bacteria 2273
98 Ga0395905_0104000 3300037471 Bacteria 2666
99 Ga0400490_55593 3300038726 Bacteria 7209
100 Ga0400488_17967 3300038741 Bacteria 1608
101 Ga0400483_130704 3300039062 Bacteria 1035
102 Ga0400487_19953 3300039110 Unclassified 2341
103 Ga0436365_1226289 3300039437 Bacteria 31121
104 Ga0439436_0002641 3300041404 Bacteria 5401
105 Ga0439438_024007 3300041405 Bacteria 1674
106 Ga0451839_1170448 3300041496 Bacteria 2168
107 Ga0451841_0039785 3300041498 Bacteria 1085
108 Ga0451853_2820881 3300041512 Bacteria 10193
109 Ga0439451_003445 3300042009 Bacteria 3209
110 Ga0439463_000169 3300042016 Bacteria 17043
111 Ga0451577_0000013 3300042876 Bacteria 550689
112 Ga0453684_0036685 3300044712 Bacteria 6751
113 Ga0453684_0616676 3300044712 Bacteria 1187
114 Ga0451576_0017612 3300045051 Bacteria 7851
115 Ga0495629_0004408 3300046459 Bacteria 10543
116 Ga0495651_0074361 3300046462 Bacteria 2578
117 Ga0495607_0049284 3300046501 Bacteria 2457
118 Ga0495606_0021354 3300046507 Bacteria 4743
119 Ga0495608_0174790 3300046511 Bacteria 1361
120 Ga0495648_0038058 3300046524 Bacteria 3083
121 Ga0495648_0152537 3300046524 Bacteria 1204
122 Ga0495652_0137452 3300046529 Bacteria 1926
123 Ga0495665_0254987 3300046531 Bacteria 903
124 Ga0495640_0061103 3300046533 Bacteria 2561
125 Ga0495597_0072797 3300046542 Bacteria 1478
126 Ga0495622_0018053 3300046557 Bacteria 3285
127 Ga0495668_0128055 3300046616 Bacteria 1390
128 Ga0495625_0043898 3300046660 Bacteria 3239
129 Ga0495625_0054228 3300046660 Bacteria 2864
130 Ga0495635_0001213 3300046663 Bacteria 17235
131 Ga0495657_0022136 3300046675 Bacteria 4557
132 Ga0495657_0031606 3300046675 Bacteria 3699
133 Ga0495669_0016243 3300046684 Unclassified 3188
134 Ga0495613_0110111 3300046689 Bacteria 1985
135 Ga0495624_0012421 3300046690 Bacteria 5822
136 Ga0495624_0053747 3300046690 Bacteria 2542
137 Ga0495660_0198033 3300046810 Bacteria 961
138 Ga0495604_0004387 3300047317 Bacteria 11167
139 Ga0495604_0124919 3300047317 Bacteria 1857
140 Ga0495676_0039180 3300047321 Bacteria 3928
141 Ga0495680_0085818 3300047322 Bacteria 2370
142 Ga0495673_0002215 3300047469 Bacteria 13991
143 Ga0495602_0086215 3300048088 Bacteria 2622
144 Ga0496102_0162416 3300048905 Bacteria 2101
145 Ga0496102_0328028 3300048905 Bacteria 1442
146 Ga0496104_0007090 3300048907 Bacteria 9882
147 Ga0496105_0020795 3300048908 Bacteria 5306
148 Ga0496105_0097758 3300048908 Bacteria 2425
149 Ga0496106_0001243 3300048909 Bacteria 19075
150 Ga0496108_0045644 3300048911 Bacteria 3660
151 Ga0496109_0315875 3300048912 Bacteria 1474
152 Ga0496110_0070312 3300048913 Bacteria 3101
153 Ga0496112_0209741 3300048915 Bacteria 1906
154 Ga0496115_0411295 3300048918 Bacteria 1097
155 Ga0496116_0065637 3300048919 Bacteria 2327
156 Ga0496119_0016293 3300048922 Bacteria 5665
157 Ga0496120_0004616 3300048923 Bacteria 11425
158 Ga0496120_0044644 3300048923 Bacteria 2573
159 Ga0496121_0004210 3300048924 Bacteria 19626
160 Ga0496121_0079602 3300048924 Bacteria 2601
161 Ga0496124_0009431 3300048927 Bacteria 10054
162 Ga0496125_0042172 3300048928 Bacteria 3891
163 Ga0496125_0107252 3300048928 Bacteria 2036
164 Ga0496126_0022371 3300048929 Bacteria 6154
165 Ga0496126_0202990 3300048929 Bacteria 1673
166 Ga0495682_0000925 3300049460 Bacteria 17821
167 Ga0495682_0002093 3300049460 Bacteria 9730
168 Ga0501034_0062473 3300049571 Bacteria 3740
169 nmdc:mga03n38_309328_c1 3300050490 Bacteria 850
170 nmdc:mga06z11_169924_c1 3300050494 Bacteria 1251
171 nmdc:mga06z11_197016_c1 3300050494 Bacteria 1168
172 nmdc:mga05p37_803_c1 3300050507 Bacteria 35042
173 nmdc:mga09592_142149_c1 3300050508 Bacteria 2069
174 nmdc:mga09592_44_c1 3300050508 Bacteria 69981
175 nmdc:mga06r32_443777_c1 3300050510 Bacteria 1278
176 nmdc:mga0sz30_76976_c1 3300050516 Bacteria 1441
177 Ga0500635_0026397 3300053080 Bacteria 1838
178 Ga0500578_0343609 3300053086 Bacteria 874
179 Ga0500643_000019 3300053087 Bacteria 294301
180 Ga0500643_002636 3300053087 Bacteria 9080
181 Ga0500583_0041186 3300053092 Bacteria 2096
182 Ga0500651_0092743 3300053093 Bacteria 1858
183 Ga0500650_0135399 3300053098 Bacteria 1144
184 Ga0500555_004262 3300053103 Bacteria 4067
185 Ga0500556_0005124 3300053104 Bacteria 3707
186 Ga0500556_0026633 3300053104 Bacteria 1922
187 Ga0500562_000516 3300053108 Bacteria 9357
188 Ga0500608_166175 3300053122 Bacteria 951
189 Ga0500642_0000980 3300053130 Bacteria 8206
190 Ga0500655_007051 3300053133 Bacteria 2022
191 Ga0500658_0006868 3300053134 Bacteria 4213
192 Ga0500564_056748 3300053138 Bacteria 1783
193 Ga0500568_0000654 3300053139 Bacteria 24999
194 Ga0500568_0020825 3300053139 Bacteria 2831
195 Ga0500590_224628 3300053148 Bacteria 771
196 Ga0500604_0033951 3300053151 Bacteria 1511
197 Ga0500622_0004100 3300053156 Bacteria 9334
198 Ga0500627_0073139 3300053158 Bacteria 1520
199 Ga0500611_000537 3300053727 Bacteria 3838
200 Ga0500645_009018 3300053730 Bacteria 3370
201 Ga0500599_016962 3300053736 Bacteria 1009
202 Ga0500601_000030 3300053737 Bacteria 31644
203 Ga0500661_009911 3300055283 Bacteria 1738
204 Ga0500661_016066 3300055283 Bacteria 1341
205 Ga0500661_018509 3300055283 Bacteria 1241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_130704 Ga0400483_130704_262_939 196
2 3300039110 Ga0400487_19953 Ga0400487_19953_908_1609 205
3 3300005518 Ga0070699_100265471 Ga0070699_1002654712 206
4 3300002739 JGI25158J39367_1003469 JGI25158J39367_10034692 208
5 3300002987 JGI25159J45721_1000008 JGI25159J45721_1000008147 208
6 3300003187 JGI25151J46595_10014301 JGI25151J46595_100143013 208
7 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003328 208
8 3300003374 JGI25161J50226_1003752 JGI25161J50226_10037522 208
9 3300003771 Ga0055526_1000440 Ga0055526_10004408 208
10 3300003781 Ga0055536_1002658 Ga0055536_10026583 208
11 3300003794 Ga0055531_10008462 Ga0055531_100084623 208
12 3300004625 Ga0055543_1000026 Ga0055543_1000026112 208
13 3300005262 Ga0065165_1000178 Ga0065165_100017828 208
14 3300025208 Ga0209436_100512 Ga0209436_1005125 208
15 3300025284 Ga0209130_1000017 Ga0209130_1000017149 208
16 3300025292 Ga0209676_1002135 Ga0209676_100213517 208
17 3300025294 Ga0209025_1000153 Ga0209025_100015326 208
18 3300025295 Ga0209564_1000013 Ga0209564_1000013598 208
19 3300025298 Ga0209050_1003385 Ga0209050_10033854 208
20 3300025299 Ga0209256_1002290 Ga0209256_10022908 208
21 3300025302 Ga0207426_1000006 Ga0207426_1000006148 208
22 3300025303 Ga0209051_1023330 Ga0209051_10233302 208
23 3300025304 Ga0209257_1005144 Ga0209257_10051442 208
24 3300041405 Ga0439438_024007 Ga0439438_024007_224_934 208
25 3300038726 Ga0400490_55593 Ga0400490_55593_3961_4662 209
26 3300038741 Ga0400488_17967 Ga0400488_17967_641_1342 209
27 iso_pu_bacteria 2582581283 2585164781 218
28 iso_pu_bacteria 2582581306 2585265158 218
29 iso_pu_bacteria 2582581865 2585385709 218
30 iso_pu_bacteria 2599185292 2599906407 218
31 iso_pu_bacteria 2599185352 2600196109 218
32 iso_pu_bacteria 2600254954 2600446806 218
33 iso_pu_bacteria 2600255389 2602010656 218
34 iso_pu_bacteria 2643221594 2643978559 218
35 iso_pu_bacteria 2643221607 2644047354 218
36 iso_pu_bacteria 2643221621 2644121676 218
37 iso_pu_bacteria 2643221636 2644199772 218
38 iso_pu_bacteria 2643221686 2644480143 218
39 iso_pu_bacteria 2643221689 2644496942 218
40 iso_pu_bacteria 2643221723 2644672814 218
41 iso_pu_bacteria 2808606395 2809031115 218
42 iso_pu_bacteria 2857537821 2857542160 218
43 iso_pu_bacteria 2899803654 2899805437 218
44 iso_pu_bacteria 2920822456 2920825590 218
45 iso_pu_bacteria 2671180694 2673818627 219
46 iso_pu_bacteria 8055878733 8055883090 219
47 3300009093 Ga0105240_10054529 Ga0105240_100545293 220
48 iso_pu_bacteria 2513237094 2513643532 220
49 iso_pu_bacteria 2643221633 2644188344 220
50 iso_pu_bacteria 2824704595 2824707752 220
51 iso_pu_bacteria 2824753945 2824758060 220
52 iso_pu_bacteria 2824763712 2824766198 220
53 iso_pu_bacteria 2874628541 2874636010 220
54 iso_pu_bacteria 2904711408 2904718450 220
55 iso_pu_bacteria 8056967851 8056969563 220
56 3300044712 Ga0453684_0616676 Ga0453684_0616676_205_870 221
57 3300005335 Ga0070666_10028004 Ga0070666_100280044 222
58 3300005353 Ga0070669_100766395 Ga0070669_1007663951 222
59 3300005355 Ga0070671_100000001 Ga0070671_1000000011120 222
60 3300005563 Ga0068855_100171860 Ga0068855_1001718602 222
61 3300005937 Ga0081455_10084771 Ga0081455_100847713 222
62 3300013249 Ga0171463_1007 Ga0171463_1007153 222
63 3300014745 Ga0157377_10099254 Ga0157377_100992542 222
64 3300015684 Ga0183365_10950 Ga0183365_109502 222
65 3300015690 Ga0183363_1138 Ga0183363_113810 222
66 3300025903 Ga0207680_10060901 Ga0207680_100609012 222
67 3300025904 Ga0207647_10000410 Ga0207647_1000041016 222
68 3300025931 Ga0207644_10000001 Ga0207644_10000001317 222
69 3300025949 Ga0207667_10109892 Ga0207667_101098923 222
70 3300031344 Ga0265316_10044134 Ga0265316_100441343 222
71 3300031456 Ga0307513_10277643 Ga0307513_102776431 222
72 3300031548 Ga0307408_100000018 Ga0307408_10000001845 222
73 3300032004 Ga0307414_10298034 Ga0307414_102980342 222
74 3300032168 Ga0316593_10042239 Ga0316593_100422392 222
75 3300041404 Ga0439436_0002641 Ga0439436_0002641_270_959 222
76 3300041496 Ga0451839_1170448 Ga0451839_1170448_121_813 222
77 3300041498 Ga0451841_0039785 Ga0451841_0039785_121_813 222
78 3300041512 Ga0451853_2820881 Ga0451853_2820881_8801_9493 222
79 3300046660 Ga0495625_0043898 Ga0495625_0043898_1967_2656 222
80 3300046684 Ga0495669_0016243 Ga0495669_0016243_803_1474 222
81 3300046810 Ga0495660_0198033 Ga0495660_0198033_236_946 222
82 3300048909 Ga0496106_0001243 Ga0496106_0001243_3977_4669 222
83 3300048919 Ga0496116_0065637 Ga0496116_0065637_541_1233 222
84 3300048923 Ga0496120_0004616 Ga0496120_0004616_6803_7480 222
85 3300048924 Ga0496121_0004210 Ga0496121_0004210_15872_16564 222
86 3300049571 Ga0501034_0062473 Ga0501034_0062473_2787_3503 222
87 3300053139 Ga0500568_0000654 Ga0500568_0000654_6132_6824 222
88 3300053727 Ga0500611_000537 Ga0500611_000537_1545_2246 222
89 3300002737 JGI25162J39368_1000638 JGI25162J39368_100063822 223
90 3300003214 JGI25165J46597_1002392 JGI25165J46597_10023923 223
91 3300003214 JGI25165J46597_1004707 JGI25165J46597_10047073 223
92 3300003323 rootH1_10053596 rootH1_100535962 223
93 3300003323 rootH1_10309905 rootH1_103099051 223
94 3300005262 Ga0065165_1000278 Ga0065165_100027820 223
95 3300005288 Ga0065714_10065066 Ga0065714_100650664 223
96 3300005289 Ga0065704_10164176 Ga0065704_101641762 223
97 3300005295 Ga0065707_10172666 Ga0065707_101726662 223
98 3300005327 Ga0070658_10000427 Ga0070658_1000042720 223
99 3300005327 Ga0070658_10006490 Ga0070658_100064905 223
100 3300005327 Ga0070658_10025207 Ga0070658_100252075 223
101 3300005328 Ga0070676_10158133 Ga0070676_101581332 223
102 3300005340 Ga0070689_100535118 Ga0070689_1005351182 223
103 3300005438 Ga0070701_10093511 Ga0070701_100935112 223
104 3300005440 Ga0070705_100491415 Ga0070705_1004914152 223
105 3300005468 Ga0070707_100461126 Ga0070707_1004611262 223
106 3300005471 Ga0070698_100232801 Ga0070698_1002328012 223
107 3300005548 Ga0070665_100014248 Ga0070665_1000142482 223
108 3300005577 Ga0068857_100154472 Ga0068857_1001544722 223
109 3300005840 Ga0068870_10199895 Ga0068870_101998952 223
110 3300005983 Ga0081540_1003477 Ga0081540_10034778 223
111 3300006186 Ga0075369_10006228 Ga0075369_100062285 223
112 3300006844 Ga0075428_100022977 Ga0075428_1000229772 223
113 3300006844 Ga0075428_100144163 Ga0075428_1001441633 223
114 3300006847 Ga0075431_100085267 Ga0075431_1000852673 223
115 3300006880 Ga0075429_100000358 Ga0075429_10000035811 223
116 3300006880 Ga0075429_100032081 Ga0075429_1000320813 223
117 3300009098 Ga0105245_10291657 Ga0105245_102916572 223
118 3300009147 Ga0114129_10003853 Ga0114129_1000385312 223
119 3300009174 Ga0105241_10205420 Ga0105241_102054202 223
120 3300009553 Ga0105249_10668235 Ga0105249_106682352 223
121 3300013297 Ga0157378_10236231 Ga0157378_102362312 223
122 3300021384 Ga0213876_10001235 Ga0213876_1000123514 223
123 3300025233 Ga0209437_100122 Ga0209437_100122210 223
124 3300025261 Ga0209233_1000317 Ga0209233_10003176 223
125 3300025261 Ga0209233_1001032 Ga0209233_100103210 223
126 3300025299 Ga0209256_1030763 Ga0209256_10307632 223
127 3300025302 Ga0207426_1036491 Ga0207426_10364912 223
128 3300025885 Ga0207653_10026775 Ga0207653_100267751 223
129 3300025908 Ga0207643_10200410 Ga0207643_102004102 223
130 3300025909 Ga0207705_10000057 Ga0207705_10000057107 223
131 3300025909 Ga0207705_10019851 Ga0207705_100198513 223
132 3300025909 Ga0207705_10144133 Ga0207705_101441332 223
133 3300025911 Ga0207654_10226620 Ga0207654_102266202 223
134 3300025922 Ga0207646_10199845 Ga0207646_101998453 223
135 3300025927 Ga0207687_10319927 Ga0207687_103199272 223
136 3300025936 Ga0207670_10177492 Ga0207670_101774922 223
137 3300025961 Ga0207712_10101977 Ga0207712_101019772 223
138 3300026116 Ga0207674_10153385 Ga0207674_101533852 223
139 3300028379 Ga0268266_10076017 Ga0268266_100760172 223
140 3300028380 Ga0268265_10031157 Ga0268265_100311574 223
141 3300028381 Ga0268264_10120849 Ga0268264_101208492 223
142 3300028800 Ga0265338_10036570 Ga0265338_100365704 223
143 3300032005 Ga0307411_10235034 Ga0307411_102350342 223
144 3300033180 Ga0307510_10010031 Ga0307510_1001003110 223
145 3300033180 Ga0307510_10124433 Ga0307510_101244333 223
146 3300037471 Ga0395905_0104000 Ga0395905_0104000_774_1454 223
147 3300039437 Ga0436365_1226289 Ga0436365_1226289_24916_25608 223
148 3300042009 Ga0439451_003445 Ga0439451_003445_1472_2149 223
149 3300042016 Ga0439463_000169 Ga0439463_000169_9287_9964 223
150 3300042876 Ga0451577_0000013 Ga0451577_0000013_282893_283573 223
151 3300044712 Ga0453684_0036685 Ga0453684_0036685_367_1047 223
152 3300045051 Ga0451576_0017612 Ga0451576_0017612_6072_6752 223
153 3300046459 Ga0495629_0004408 Ga0495629_0004408_7661_8341 223
154 3300046462 Ga0495651_0074361 Ga0495651_0074361_1798_2475 223
155 3300046501 Ga0495607_0049284 Ga0495607_0049284_1384_2061 223
156 3300046507 Ga0495606_0021354 Ga0495606_0021354_3963_4643 223
157 3300046511 Ga0495608_0174790 Ga0495608_0174790_142_822 223
158 3300046524 Ga0495648_0038058 Ga0495648_0038058_422_1102 223
159 3300046524 Ga0495648_0152537 Ga0495648_0152537_267_947 223
160 3300046529 Ga0495652_0137452 Ga0495652_0137452_881_1561 223
161 3300046531 Ga0495665_0254987 Ga0495665_0254987_171_851 223
162 3300046533 Ga0495640_0061103 Ga0495640_0061103_1737_2417 223
163 3300046542 Ga0495597_0072797 Ga0495597_0072797_101_778 223
164 3300046557 Ga0495622_0018053 Ga0495622_0018053_2376_3056 223
165 3300046616 Ga0495668_0128055 Ga0495668_0128055_33_713 223
166 3300046660 Ga0495625_0054228 Ga0495625_0054228_1427_2107 223
167 3300046663 Ga0495635_0001213 Ga0495635_0001213_9748_10428 223
168 3300046675 Ga0495657_0022136 Ga0495657_0022136_586_1266 223
169 3300046675 Ga0495657_0031606 Ga0495657_0031606_2806_3483 223
170 3300046689 Ga0495613_0110111 Ga0495613_0110111_203_883 223
171 3300046690 Ga0495624_0012421 Ga0495624_0012421_5060_5740 223
172 3300046690 Ga0495624_0053747 Ga0495624_0053747_1635_2315 223
173 3300047317 Ga0495604_0004387 Ga0495604_0004387_10149_10829 223
174 3300047317 Ga0495604_0124919 Ga0495604_0124919_752_1429 223
175 3300047321 Ga0495676_0039180 Ga0495676_0039180_2014_2694 223
176 3300047322 Ga0495680_0085818 Ga0495680_0085818_521_1198 223
177 3300047469 Ga0495673_0002215 Ga0495673_0002215_7067_7744 223
178 3300048088 Ga0495602_0086215 Ga0495602_0086215_218_895 223
179 3300048905 Ga0496102_0162416 Ga0496102_0162416_331_1011 223
180 3300048905 Ga0496102_0328028 Ga0496102_0328028_158_838 223
181 3300048907 Ga0496104_0007090 Ga0496104_0007090_5951_6631 223
182 3300048908 Ga0496105_0020795 Ga0496105_0020795_3410_4090 223
183 3300048908 Ga0496105_0097758 Ga0496105_0097758_336_1016 223
184 3300048911 Ga0496108_0045644 Ga0496108_0045644_538_1218 223
185 3300048912 Ga0496109_0315875 Ga0496109_0315875_538_1218 223
186 3300048913 Ga0496110_0070312 Ga0496110_0070312_241_921 223
187 3300048915 Ga0496112_0209741 Ga0496112_0209741_715_1395 223
188 3300048918 Ga0496115_0411295 Ga0496115_0411295_362_1042 223
189 3300048922 Ga0496119_0016293 Ga0496119_0016293_309_989 223
190 3300048923 Ga0496120_0044644 Ga0496120_0044644_1685_2365 223
191 3300048924 Ga0496121_0079602 Ga0496121_0079602_1087_1767 223
192 3300048927 Ga0496124_0009431 Ga0496124_0009431_8949_9626 223
193 3300048928 Ga0496125_0042172 Ga0496125_0042172_212_889 223
194 3300048928 Ga0496125_0107252 Ga0496125_0107252_242_922 223
195 3300048929 Ga0496126_0022371 Ga0496126_0022371_3773_4465 223
196 3300048929 Ga0496126_0202990 Ga0496126_0202990_133_813 223
197 3300049460 Ga0495682_0000925 Ga0495682_0000925_9387_10064 223
198 3300049460 Ga0495682_0002093 Ga0495682_0002093_4469_5149 223
199 3300050490 nmdc:mga03n38_309328_c1 nmdc:mga03n38_309328_c1_113_793 223
200 3300050494 nmdc:mga06z11_169924_c1 nmdc:mga06z11_169924_c1_238_918 223
201 3300050494 nmdc:mga06z11_197016_c1 nmdc:mga06z11_197016_c1_462_1142 223
202 3300050507 nmdc:mga05p37_803_c1 nmdc:mga05p37_803_c1_1287_1976 223
203 3300050508 nmdc:mga09592_142149_c1 nmdc:mga09592_142149_c1_1096_1770 223
204 3300050508 nmdc:mga09592_44_c1 nmdc:mga09592_44_c1_17453_18142 223
205 3300050510 nmdc:mga06r32_443777_c1 nmdc:mga06r32_443777_c1_195_884 223
206 3300050516 nmdc:mga0sz30_76976_c1 nmdc:mga0sz30_76976_c1_548_1228 223
207 3300053080 Ga0500635_0026397 Ga0500635_0026397_663_1343 223
208 3300053086 Ga0500578_0343609 Ga0500578_0343609_69_749 223
209 3300053087 Ga0500643_000019 Ga0500643_000019_65993_66673 223
210 3300053087 Ga0500643_002636 Ga0500643_002636_7387_8091 223
211 3300053092 Ga0500583_0041186 Ga0500583_0041186_469_1149 223
212 3300053093 Ga0500651_0092743 Ga0500651_0092743_343_1023 223
213 3300053098 Ga0500650_0135399 Ga0500650_0135399_183_863 223
214 3300053103 Ga0500555_004262 Ga0500555_004262_579_1259 223
215 3300053104 Ga0500556_0005124 Ga0500556_0005124_2666_3346 223
216 3300053104 Ga0500556_0026633 Ga0500556_0026633_23_700 223
217 3300053108 Ga0500562_000516 Ga0500562_000516_6504_7184 223
218 3300053122 Ga0500608_166175 Ga0500608_166175_252_932 223
219 3300053130 Ga0500642_0000980 Ga0500642_0000980_5704_6384 223
220 3300053133 Ga0500655_007051 Ga0500655_007051_460_1140 223
221 3300053134 Ga0500658_0006868 Ga0500658_0006868_1481_2161 223
222 3300053138 Ga0500564_056748 Ga0500564_056748_1011_1691 223
223 3300053139 Ga0500568_0020825 Ga0500568_0020825_1157_1837 223
224 3300053148 Ga0500590_224628 Ga0500590_224628_28_708 223
225 3300053151 Ga0500604_0033951 Ga0500604_0033951_385_1065 223
226 3300053156 Ga0500622_0004100 Ga0500622_0004100_1773_2453 223
227 3300053158 Ga0500627_0073139 Ga0500627_0073139_213_893 223
228 3300053730 Ga0500645_009018 Ga0500645_009018_2386_3066 223
229 3300053736 Ga0500599_016962 Ga0500599_016962_37_717 223
230 3300053737 Ga0500601_000030 Ga0500601_000030_12550_13230 223
231 3300055283 Ga0500661_009911 Ga0500661_009911_334_1014 223
232 3300055283 Ga0500661_016066 Ga0500661_016066_475_1155 223
233 3300055283 Ga0500661_018509 Ga0500661_018509_402_1082 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

159

0.73

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

178

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.9187 2 212
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.8875 2 217
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.881 2 215
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8794 2 215
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8791 2 215
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9145 1 215 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8907 2 212 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8799 1 215 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8541 1 215 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8423 2 212 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A446ANK1-F1-model_v4 Metallophosphoesterase 0.9921 2 218 GO:0005737
GO:0016791
AF-A0A1W1ECB4-F1-model_v4 Diadenosine tetraphosphatase and related serine/threonine protein phosphatases 0.9763 23 222
AF-A0A2S7X111-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9745 1 222 GO:0005737
GO:0016791
AF-A0A7K3U5W7-F1-model_v4 Metallophosphoesterase 0.9724 1 222 GO:0005737
GO:0016791
AF-A0A7V3X818-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.972 2 219 GO:0005737
GO:0016791
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map