F346599

General Info

Members Datasets Scaffolds Average Seq Length
233 182 221 158

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2739367898|2740165903
Length 160
Sequence TFIVNGERVTVDVEDDVRLLWVLRDLLGVTGPKYGCGINVCKACTSHLNGKAINPCAVPVGRLGDDDEVTTIEGLPEQVDAGRRGAHGLHPMQEAWLDRDVAQCGYCQPGQIMAAVALVNRVAAEGGQVTEADLDGIRNICRCGTYTRIREAIRDGASRM

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2739367898 Nocardioides sp. CF479 Isolate Unclassified
6 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
7 2862574272 Streptomyces sp. AcE210 Isolate Nodule
8 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
9 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
10 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
182 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.42
Metatranscriptomes 0.43
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0.43
Rhizoplane 3
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10160611 3300001989 Bacteria 663
2 JGI24737J22298_10047642 3300001990 Bacteria 1306
3 JGI24735J21928_10085240 3300002067 Bacteria 905
4 JGI24738J21930_10050289 3300002075 Bacteria 850
5 Ga0070682_100183549 3300005337 Bacteria 1463
6 Ga0070660_100079567 3300005339 Bacteria 2571
7 Ga0070689_100865871 3300005340 Bacteria 798
8 Ga0070714_100031927 3300005435 Bacteria 4396
9 Ga0070713_100053173 3300005436 Bacteria 3355
10 Ga0070713_100112899 3300005436 Bacteria 2371
11 Ga0070713_100387713 3300005436 Bacteria 1303
12 Ga0070710_10008183 3300005437 Bacteria 5085
13 Ga0070701_10463144 3300005438 Bacteria 816
14 Ga0070681_10009327 3300005458 Bacteria 9654
15 Ga0070681_10316642 3300005458 Bacteria 1470
16 Ga0070706_100329490 3300005467 Bacteria 1424
17 Ga0070706_101229703 3300005467 Bacteria 688
18 Ga0070679_100012658 3300005530 Bacteria 8069
19 Ga0070679_100073272 3300005530 Bacteria 3417
20 Ga0068853_100001738 3300005539 Bacteria 15965
21 Ga0068855_101000993 3300005563 Bacteria 878
22 Ga0068854_100532174 3300005578 Bacteria 994
23 Ga0068856_100247063 3300005614 Bacteria 1800
24 Ga0068861_101760325 3300005719 Bacteria 614
25 Ga0068860_101028344 3300005843 Bacteria 842
26 Ga0081455_10074997 3300005937 Bacteria 2792
27 Ga0070717_10248771 3300006028 Bacteria 1570
28 Ga0070717_10784917 3300006028 Bacteria 866
29 Ga0075365_10060889 3300006038 Bacteria 2519
30 Ga0075365_10147479 3300006038 Bacteria 1636
31 Ga0075368_10033028 3300006042 Bacteria 2012
32 Ga0075363_100051526 3300006048 Bacteria 2196
33 Ga0075363_100690004 3300006048 Bacteria 616
34 Ga0070712_100638656 3300006175 Bacteria 904
35 Ga0075367_10002334 3300006178 Bacteria 8631
36 Ga0075428_100323253 3300006844 Bacteria 1658
37 Ga0075428_100612377 3300006844 Bacteria 1163
38 Ga0075430_100286749 3300006846 Bacteria 1362
39 Ga0075431_100327905 3300006847 Bacteria 1542
40 Ga0075429_100293045 3300006880 Bacteria 1425
41 Ga0068865_101024274 3300006881 Bacteria 724
42 Ga0105240_10469353 3300009093 Bacteria 1405
43 Ga0111539_11123829 3300009094 Bacteria 913
44 Ga0111539_11692093 3300009094 Bacteria 734
45 Ga0105245_10014363 3300009098 Bacteria 6900
46 Ga0105245_10233761 3300009098 Bacteria 1779
47 Ga0114129_11327900 3300009147 Bacteria 890
48 Ga0105241_10166390 3300009174 Bacteria 1817
49 Ga0105242_10028346 3300009176 Bacteria 4457
50 Ga0105238_10134812 3300009551 Bacteria 2447
51 Ga0105239_10473832 3300010375 Bacteria 1422
52 Ga0105239_10960054 3300010375 Bacteria 982
53 Ga0105239_11656162 3300010375 Bacteria 740
54 Ga0105246_10057141 3300011119 Bacteria 2699
55 Ga0157369_12048932 3300013105 Bacteria 580
56 Ga0157374_10786133 3300013296 Bacteria 967
57 Ga0157378_10519198 3300013297 Bacteria 1192
58 Ga0157372_11412514 3300013307 Bacteria 802
59 Ga0182006_1183155 3300015261 Bacteria 698
60 Ga0206353_10230177 3300020082 Bacteria 1026
61 Ga0207692_10861336 3300025898 Bacteria 595
62 Ga0207647_10456245 3300025904 Bacteria 716
63 Ga0207684_10353493 3300025910 Bacteria 1265
64 Ga0207684_11018951 3300025910 Bacteria 692
65 Ga0207654_10142515 3300025911 Bacteria 1530
66 Ga0207707_10039723 3300025912 Bacteria 4113
67 Ga0207707_10055153 3300025912 Bacteria 3458
68 Ga0207707_10617918 3300025912 Bacteria 916
69 Ga0207693_10006490 3300025915 Bacteria 9687
70 Ga0207693_10727538 3300025915 Bacteria 768
71 Ga0207660_10175001 3300025917 Bacteria 1664
72 Ga0207657_10018141 3300025919 Bacteria 6733
73 Ga0207652_10202915 3300025921 Bacteria 1784
74 Ga0207694_10186602 3300025924 Bacteria 1683
75 Ga0207687_10181827 3300025927 Bacteria 1630
76 Ga0207700_10312729 3300025928 Bacteria 1359
77 Ga0207664_10020191 3300025929 Bacteria 4934
78 Ga0207690_11006086 3300025932 Bacteria 693
79 Ga0207686_10015117 3300025934 Bacteria 4310
80 Ga0207670_10572742 3300025936 Bacteria 925
81 Ga0207667_10892776 3300025949 Bacteria 881
82 Ga0207639_10229780 3300026041 Bacteria 1607
83 Ga0207702_10495548 3300026078 Bacteria 1190
84 Ga0207698_10495037 3300026142 Bacteria 1188
85 Ga0209813_10171087 3300027866 Bacteria 789
86 Ga0307512_10015854 3300030522 Bacteria 6974
87 Ga0307408_101665381 3300031548 Bacteria 607
88 Ga0307508_10006280 3300031616 Bacteria 11188
89 Ga0307405_10022156 3300031731 Bacteria 3587
90 Ga0307518_10032940 3300031838 Bacteria 3758
91 Ga0307410_10508118 3300031852 Bacteria 993
92 Ga0307406_10366788 3300031901 Bacteria 1131
93 Ga0307407_10095605 3300031903 Bacteria 1832
94 Ga0307407_11011750 3300031903 Bacteria 642
95 Ga0307409_100093108 3300031995 Bacteria 2475
96 Ga0307409_100101337 3300031995 Bacteria 2389
97 Ga0307416_101016154 3300032002 Bacteria 932
98 Ga0307411_10030180 3300032005 Bacteria 3321
99 Ga0307415_100267875 3300032126 Bacteria 1398
100 Ga0316580_10054781 3300032139 Bacteria 1227
101 Ga0373954_0116915 3300035118 Bacteria 1293
102 Ga0373935_0867585 3300035692 Bacteria 668
103 Ga0373937_0213734 3300036401 Bacteria 1815
104 Ga0373925_1399939 3300037068 Bacteria 573
105 Ga0395899_0541212 3300037312 Bacteria 750
106 Ga0395900_0652266 3300037418 Bacteria 989
107 Ga0395898_0001427 3300037466 Bacteria 33941
108 Ga0395898_0147009 3300037466 Bacteria 2256
109 Ga0395901_1441335 3300038443 Bacteria 646
110 Ga0451843_0508223 3300041509 Bacteria 587
111 Ga0451853_2555685 3300041512 Bacteria 637
112 Ga0466969_0039971 3300044656 Bacteria 2352
113 Ga0466972_0013358 3300044658 Bacteria 4123
114 Ga0466965_0232702 3300044683 Bacteria 985
115 Ga0466966_0003179 3300044684 Bacteria 10806
116 Ga0466966_0627702 3300044684 Bacteria 647
117 Ga0466961_0002160 3300044693 Bacteria 12237
118 Ga0466961_0020509 3300044693 Bacteria 4254
119 Ga0466961_0167400 3300044693 Bacteria 1368
120 Ga0466971_0040464 3300044719 Bacteria 2094
121 Ga0466970_0020552 3300044765 Bacteria 3432
122 Ga0466970_0172397 3300044765 Bacteria 1199
123 Ga0466970_0410039 3300044765 Bacteria 774
124 Ga0466957_0030872 3300044842 Bacteria 3200
125 Ga0466960_0002098 3300044901 Bacteria 7425
126 Ga0466960_0213940 3300044901 Bacteria 1058
127 Ga0466960_0265201 3300044901 Bacteria 958
128 Ga0466959_0002237 3300045049 Bacteria 12325
129 Ga0466958_0412126 3300045836 Bacteria 873
130 Ga0466967_0040466 3300045976 Bacteria 4013
131 Ga0466967_0137516 3300045976 Bacteria 2273
132 Ga0495603_0003132 3300046455 Bacteria 9830
133 Ga0495603_0017549 3300046455 Bacteria 4332
134 Ga0495603_0043926 3300046455 Bacteria 2667
135 Ga0495629_0042435 3300046459 Bacteria 3196
136 Ga0495629_0592434 3300046459 Bacteria 742
137 Ga0495641_0135339 3300046461 Bacteria 1100
138 Ga0495580_0070029 3300046472 Bacteria 2450
139 Ga0495585_0051590 3300046492 Bacteria 2279
140 Ga0495585_0497041 3300046492 Bacteria 580
141 Ga0495594_0000385 3300046499 Bacteria 22179
142 Ga0495594_0234931 3300046499 Bacteria 1045
143 Ga0495607_0088816 3300046501 Bacteria 1679
144 Ga0495628_0030496 3300046516 Bacteria 4366
145 Ga0495630_0022924 3300046517 Bacteria 4612
146 Ga0495666_0188459 3300046526 Bacteria 951
147 Ga0495640_0075598 3300046533 Bacteria 2249
148 Ga0495587_0233719 3300046536 Bacteria 1036
149 Ga0495597_0379934 3300046542 Bacteria 539
150 Ga0495622_0015061 3300046557 Bacteria 3595
151 Ga0495668_0209682 3300046616 Bacteria 1067
152 Ga0495668_0700011 3300046616 Bacteria 560
153 Ga0495634_0008120 3300046642 Bacteria 7825
154 Ga0495611_0100602 3300046648 Bacteria 1342
155 Ga0495611_0329974 3300046648 Bacteria 701
156 Ga0495635_0431394 3300046663 Bacteria 873
157 Ga0495588_0024212 3300046674 Bacteria 3014
158 Ga0495599_0335044 3300046678 Bacteria 909
159 Ga0495623_0059888 3300046679 Bacteria 2390
160 Ga0495658_0369004 3300046683 Bacteria 913
161 Ga0495613_0000128 3300046689 Bacteria 74734
162 Ga0495613_0099497 3300046689 Bacteria 2101
163 Ga0495670_0114779 3300046691 Bacteria 1396
164 Ga0495589_0002198 3300046794 Bacteria 10980
165 Ga0495589_0020348 3300046794 Bacteria 3394
166 Ga0495581_0106113 3300047315 Bacteria 1633
167 Ga0495636_0066497 3300047318 Bacteria 1532
168 Ga0495674_0251974 3300047319 Bacteria 1453
169 Ga0495676_0004028 3300047321 Bacteria 13368
170 Ga0495676_0094794 3300047321 Bacteria 2222
171 Ga0495676_0104669 3300047321 Bacteria 2087
172 Ga0495676_0897587 3300047321 Bacteria 568
173 Ga0495680_0242333 3300047322 Bacteria 1280
174 Ga0495683_0060973 3300047323 Bacteria 1868
175 Ga0495683_0222505 3300047323 Bacteria 841
176 Ga0495685_007277 3300047447 Bacteria 3649
177 Ga0495685_120506 3300047447 Bacteria 861
178 Ga0495684_0271707 3300047471 Bacteria 1226
179 Ga0495593_0062388 3300047673 Bacteria 1948
180 Ga0495602_0116715 3300048088 Bacteria 2156
181 Ga0496103_0387576 3300048906 Bacteria 898
182 Ga0496104_0333229 3300048907 Bacteria 1430
183 Ga0496104_1222793 3300048907 Bacteria 654
184 Ga0496105_0137620 3300048908 Bacteria 2011
185 Ga0496109_0691073 3300048912 Bacteria 958
186 Ga0496112_0252485 3300048915 Bacteria 1714
187 Ga0496115_0965477 3300048918 Bacteria 653
188 Ga0501033_0069870 3300049570 Bacteria 2580
189 Ga0501033_0147934 3300049570 Bacteria 1696
190 Ga0501034_0183999 3300049571 Bacteria 2053
191 Ga0501036_1055182 3300049572 Bacteria 664
192 Ga0501038_0004815 3300049574 Bacteria 12536
193 Ga0501038_0252715 3300049574 Bacteria 1396
194 Ga0501039_0281178 3300049575 Bacteria 1308
195 Ga0501040_0255580 3300049576 Bacteria 1250
196 Ga0501043_0239612 3300049579 Bacteria 1399
197 Ga0501047_0089347 3300049581 Bacteria 2958
198 Ga0501067_0484197 3300049583 Bacteria 692
199 Ga0501070_0303982 3300049586 Bacteria 1299
200 Ga0501073_0272409 3300049589 Bacteria 1168
201 Ga0501076_0441545 3300049592 Bacteria 1071
202 Ga0501080_0219283 3300049742 Bacteria 1741
203 Ga0501080_0645607 3300049742 Bacteria 937
204 Ga0501044_0008514 3300049823 Bacteria 11238
205 Ga0501044_0023165 3300049823 Bacteria 6608
206 Ga0501044_0047233 3300049823 Bacteria 4454
207 Ga0501044_1122729 3300049823 Bacteria 655
208 nmdc:mga0yw44_25076_c1 3300050492 Bacteria 3384
209 nmdc:mga0yw44_391169_c1 3300050492 Bacteria 939
210 nmdc:mga06z11_2430_c1 3300050494 Bacteria 7101
211 nmdc:mga04h51_121045_c1 3300050495 Bacteria 975
212 nmdc:mga05p37_666401_c1 3300050507 Bacteria 1162
213 nmdc:mga09592_1464300_c1 3300050508 Bacteria 557
214 nmdc:mga0qj67_363641_c1 3300050509 Bacteria 1169
215 nmdc:mga08y16_682504_c1 3300050511 Bacteria 1028
216 Ga0495601_0024730 3300053077 Bacteria 3699
217 Ga0495612_0385670 3300053078 Bacteria 635
218 Ga0495619_0248072 3300053085 Bacteria 1234
219 Ga0500566_0000510 3300053094 Bacteria 21690
220 Ga0500566_0118786 3300053094 Bacteria 1428
221 Ga0466962_0007995 3300061719 Bacteria 5074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0867585 Ga0373935_0867585_85_462 120
2 3300048907 Ga0496104_0333229 Ga0496104_0333229_974_1408 144
3 3300049572 Ga0501036_1055182 Ga0501036_1055182_214_648 144
4 3300032139 Ga0316580_10054781 Ga0316580_100547812 148
5 3300036401 Ga0373937_0213734 Ga0373937_0213734_131_598 150
6 3300046472 Ga0495580_0070029 Ga0495580_0070029_168_635 150
7 3300046679 Ga0495623_0059888 Ga0495623_0059888_1454_1921 150
8 3300047319 Ga0495674_0251974 Ga0495674_0251974_924_1391 150
9 3300048088 Ga0495602_0116715 Ga0495602_0116715_1268_1735 150
10 3300013307 Ga0157372_11412514 Ga0157372_114125142 151
11 iso_pu_bacteria 2558860280 2559431123 154
12 iso_pu_bacteria 2582580736 2583150025 154
13 iso_pu_bacteria 2643221615 2644092981 154
14 iso_pu_bacteria 2643221657 2644322594 154
15 iso_pu_bacteria 2739367898 2740165903 154
16 iso_pu_bacteria 2811994878 2812352431 154
17 iso_pu_bacteria 2862574272 2862580728 154
18 iso_pu_bacteria 2895427314 2895434370 154
19 iso_pu_bacteria 2899359706 2899365744 154
20 iso_pu_bacteria 8056207758 8056210073 154
21 iso_pu_bacteria 8056829672 8056830836 154
22 3300046517 Ga0495630_0022924 Ga0495630_0022924_1114_1581 155
23 3300046526 Ga0495666_0188459 Ga0495666_0188459_395_862 155
24 3300046533 Ga0495640_0075598 Ga0495640_0075598_433_900 155
25 3300046642 Ga0495634_0008120 Ga0495634_0008120_3110_3577 155
26 3300046683 Ga0495658_0369004 Ga0495658_0369004_104_571 155
27 3300046689 Ga0495613_0000128 Ga0495613_0000128_48678_49145 155
28 3300046689 Ga0495613_0099497 Ga0495613_0099497_1135_1602 155
29 3300047321 Ga0495676_0897587 Ga0495676_0897587_38_520 155
30 3300047322 Ga0495680_0242333 Ga0495680_0242333_61_528 155
31 3300047471 Ga0495684_0271707 Ga0495684_0271707_372_839 155
32 3300053085 Ga0495619_0248072 Ga0495619_0248072_317_784 155
33 3300053094 Ga0500566_0118786 Ga0500566_0118786_438_905 155
34 3300048912 Ga0496109_0691073 Ga0496109_0691073_51_521 156
35 iso_pu_bacteria 2997451912 2997452078 156
36 3300001989 JGI24739J22299_10160611 JGI24739J22299_101606112 158
37 3300001990 JGI24737J22298_10047642 JGI24737J22298_100476422 158
38 3300002067 JGI24735J21928_10085240 JGI24735J21928_100852402 158
39 3300002075 JGI24738J21930_10050289 JGI24738J21930_100502892 158
40 3300005337 Ga0070682_100183549 Ga0070682_1001835493 158
41 3300005339 Ga0070660_100079567 Ga0070660_1000795673 158
42 3300005340 Ga0070689_100865871 Ga0070689_1008658712 158
43 3300005435 Ga0070714_100031927 Ga0070714_1000319272 158
44 3300005436 Ga0070713_100053173 Ga0070713_1000531732 158
45 3300005436 Ga0070713_100112899 Ga0070713_1001128993 158
46 3300005436 Ga0070713_100387713 Ga0070713_1003877132 158
47 3300005437 Ga0070710_10008183 Ga0070710_100081834 158
48 3300005438 Ga0070701_10463144 Ga0070701_104631441 158
49 3300005458 Ga0070681_10009327 Ga0070681_100093272 158
50 3300005458 Ga0070681_10316642 Ga0070681_103166422 158
51 3300005467 Ga0070706_100329490 Ga0070706_1003294902 158
52 3300005467 Ga0070706_101229703 Ga0070706_1012297031 158
53 3300005530 Ga0070679_100012658 Ga0070679_1000126587 158
54 3300005530 Ga0070679_100073272 Ga0070679_1000732722 158
55 3300005539 Ga0068853_100001738 Ga0068853_1000017382 158
56 3300005563 Ga0068855_101000993 Ga0068855_1010009932 158
57 3300005578 Ga0068854_100532174 Ga0068854_1005321742 158
58 3300005614 Ga0068856_100247063 Ga0068856_1002470632 158
59 3300005719 Ga0068861_101760325 Ga0068861_1017603251 158
60 3300005843 Ga0068860_101028344 Ga0068860_1010283442 158
61 3300005937 Ga0081455_10074997 Ga0081455_100749973 158
62 3300006028 Ga0070717_10248771 Ga0070717_102487712 158
63 3300006028 Ga0070717_10784917 Ga0070717_107849172 158
64 3300006038 Ga0075365_10060889 Ga0075365_100608892 158
65 3300006038 Ga0075365_10147479 Ga0075365_101474792 158
66 3300006042 Ga0075368_10033028 Ga0075368_100330284 158
67 3300006048 Ga0075363_100051526 Ga0075363_1000515262 158
68 3300006048 Ga0075363_100690004 Ga0075363_1006900041 158
69 3300006175 Ga0070712_100638656 Ga0070712_1006386562 158
70 3300006178 Ga0075367_10002334 Ga0075367_1000233410 158
71 3300006844 Ga0075428_100323253 Ga0075428_1003232533 158
72 3300006844 Ga0075428_100612377 Ga0075428_1006123772 158
73 3300006846 Ga0075430_100286749 Ga0075430_1002867492 158
74 3300006847 Ga0075431_100327905 Ga0075431_1003279052 158
75 3300006880 Ga0075429_100293045 Ga0075429_1002930451 158
76 3300006881 Ga0068865_101024274 Ga0068865_1010242742 158
77 3300009093 Ga0105240_10469353 Ga0105240_104693532 158
78 3300009094 Ga0111539_11123829 Ga0111539_111238291 158
79 3300009094 Ga0111539_11692093 Ga0111539_116920932 158
80 3300009098 Ga0105245_10014363 Ga0105245_100143633 158
81 3300009098 Ga0105245_10233761 Ga0105245_102337612 158
82 3300009147 Ga0114129_11327900 Ga0114129_113279002 158
83 3300009174 Ga0105241_10166390 Ga0105241_101663902 158
84 3300009176 Ga0105242_10028346 Ga0105242_100283462 158
85 3300009551 Ga0105238_10134812 Ga0105238_101348122 158
86 3300010375 Ga0105239_10473832 Ga0105239_104738321 158
87 3300010375 Ga0105239_10960054 Ga0105239_109600542 158
88 3300010375 Ga0105239_11656162 Ga0105239_116561621 158
89 3300011119 Ga0105246_10057141 Ga0105246_100571412 158
90 3300013105 Ga0157369_12048932 Ga0157369_120489321 158
91 3300013296 Ga0157374_10786133 Ga0157374_107861332 158
92 3300013297 Ga0157378_10519198 Ga0157378_105191982 158
93 3300015261 Ga0182006_1183155 Ga0182006_11831551 158
94 3300020082 Ga0206353_10230177 Ga0206353_102301772 158
95 3300025898 Ga0207692_10861336 Ga0207692_108613361 158
96 3300025904 Ga0207647_10456245 Ga0207647_104562451 158
97 3300025910 Ga0207684_10353493 Ga0207684_103534931 158
98 3300025910 Ga0207684_11018951 Ga0207684_110189511 158
99 3300025911 Ga0207654_10142515 Ga0207654_101425152 158
100 3300025912 Ga0207707_10039723 Ga0207707_100397232 158
101 3300025912 Ga0207707_10055153 Ga0207707_100551532 158
102 3300025912 Ga0207707_10617918 Ga0207707_106179182 158
103 3300025915 Ga0207693_10006490 Ga0207693_100064901 158
104 3300025915 Ga0207693_10727538 Ga0207693_107275382 158
105 3300025917 Ga0207660_10175001 Ga0207660_101750012 158
106 3300025919 Ga0207657_10018141 Ga0207657_100181414 158
107 3300025921 Ga0207652_10202915 Ga0207652_102029152 158
108 3300025924 Ga0207694_10186602 Ga0207694_101866022 158
109 3300025927 Ga0207687_10181827 Ga0207687_101818272 158
110 3300025928 Ga0207700_10312729 Ga0207700_103127292 158
111 3300025929 Ga0207664_10020191 Ga0207664_100201912 158
112 3300025932 Ga0207690_11006086 Ga0207690_110060862 158
113 3300025934 Ga0207686_10015117 Ga0207686_100151172 158
114 3300025936 Ga0207670_10572742 Ga0207670_105727422 158
115 3300025949 Ga0207667_10892776 Ga0207667_108927762 158
116 3300026041 Ga0207639_10229780 Ga0207639_102297803 158
117 3300026078 Ga0207702_10495548 Ga0207702_104955482 158
118 3300026142 Ga0207698_10495037 Ga0207698_104950372 158
119 3300027866 Ga0209813_10171087 Ga0209813_101710872 158
120 3300030522 Ga0307512_10015854 Ga0307512_100158546 158
121 3300031548 Ga0307408_101665381 Ga0307408_1016653812 158
122 3300031616 Ga0307508_10006280 Ga0307508_100062808 158
123 3300031731 Ga0307405_10022156 Ga0307405_100221564 158
124 3300031838 Ga0307518_10032940 Ga0307518_100329402 158
125 3300031852 Ga0307410_10508118 Ga0307410_105081182 158
126 3300031901 Ga0307406_10366788 Ga0307406_103667882 158
127 3300031903 Ga0307407_10095605 Ga0307407_100956052 158
128 3300031903 Ga0307407_11011750 Ga0307407_110117502 158
129 3300031995 Ga0307409_100093108 Ga0307409_1000931082 158
130 3300031995 Ga0307409_100101337 Ga0307409_1001013372 158
131 3300032002 Ga0307416_101016154 Ga0307416_1010161541 158
132 3300032005 Ga0307411_10030180 Ga0307411_100301802 158
133 3300032126 Ga0307415_100267875 Ga0307415_1002678752 158
134 3300035118 Ga0373954_0116915 Ga0373954_0116915_770_1246 158
135 3300037068 Ga0373925_1399939 Ga0373925_1399939_14_490 158
136 3300037312 Ga0395899_0541212 Ga0395899_0541212_87_563 158
137 3300037418 Ga0395900_0652266 Ga0395900_0652266_288_764 158
138 3300037466 Ga0395898_0001427 Ga0395898_0001427_32568_33044 158
139 3300037466 Ga0395898_0147009 Ga0395898_0147009_415_903 158
140 3300038443 Ga0395901_1441335 Ga0395901_1441335_15_491 158
141 3300041509 Ga0451843_0508223 Ga0451843_0508223_19_495 158
142 3300041512 Ga0451853_2555685 Ga0451853_2555685_124_600 158
143 3300044656 Ga0466969_0039971 Ga0466969_0039971_594_1070 158
144 3300044658 Ga0466972_0013358 Ga0466972_0013358_2495_2977 158
145 3300044683 Ga0466965_0232702 Ga0466965_0232702_323_799 158
146 3300044684 Ga0466966_0003179 Ga0466966_0003179_8611_9087 158
147 3300044684 Ga0466966_0627702 Ga0466966_0627702_12_488 158
148 3300044693 Ga0466961_0002160 Ga0466961_0002160_1908_2384 158
149 3300044693 Ga0466961_0020509 Ga0466961_0020509_1606_2088 158
150 3300044693 Ga0466961_0167400 Ga0466961_0167400_824_1345 158
151 3300044719 Ga0466971_0040464 Ga0466971_0040464_771_1247 158
152 3300044765 Ga0466970_0020552 Ga0466970_0020552_639_1115 158
153 3300044765 Ga0466970_0172397 Ga0466970_0172397_669_1151 158
154 3300044765 Ga0466970_0410039 Ga0466970_0410039_23_502 158
155 3300044842 Ga0466957_0030872 Ga0466957_0030872_2424_2900 158
156 3300044901 Ga0466960_0002098 Ga0466960_0002098_5161_5643 158
157 3300044901 Ga0466960_0213940 Ga0466960_0213940_30_506 158
158 3300044901 Ga0466960_0265201 Ga0466960_0265201_162_638 158
159 3300045049 Ga0466959_0002237 Ga0466959_0002237_2374_2850 158
160 3300045836 Ga0466958_0412126 Ga0466958_0412126_201_677 158
161 3300045976 Ga0466967_0040466 Ga0466967_0040466_1084_1560 158
162 3300045976 Ga0466967_0137516 Ga0466967_0137516_1231_1707 158
163 3300046455 Ga0495603_0003132 Ga0495603_0003132_1690_2166 158
164 3300046455 Ga0495603_0017549 Ga0495603_0017549_2085_2561 158
165 3300046455 Ga0495603_0043926 Ga0495603_0043926_1670_2146 158
166 3300046459 Ga0495629_0042435 Ga0495629_0042435_2686_3162 158
167 3300046459 Ga0495629_0592434 Ga0495629_0592434_219_695 158
168 3300046461 Ga0495641_0135339 Ga0495641_0135339_564_1040 158
169 3300046492 Ga0495585_0051590 Ga0495585_0051590_776_1252 158
170 3300046492 Ga0495585_0497041 Ga0495585_0497041_72_548 158
171 3300046499 Ga0495594_0000385 Ga0495594_0000385_7676_8152 158
172 3300046499 Ga0495594_0234931 Ga0495594_0234931_26_502 158
173 3300046501 Ga0495607_0088816 Ga0495607_0088816_265_741 158
174 3300046516 Ga0495628_0030496 Ga0495628_0030496_3148_3624 158
175 3300046536 Ga0495587_0233719 Ga0495587_0233719_235_711 158
176 3300046542 Ga0495597_0379934 Ga0495597_0379934_47_523 158
177 3300046557 Ga0495622_0015061 Ga0495622_0015061_1401_1877 158
178 3300046616 Ga0495668_0209682 Ga0495668_0209682_254_730 158
179 3300046616 Ga0495668_0700011 Ga0495668_0700011_26_502 158
180 3300046648 Ga0495611_0100602 Ga0495611_0100602_110_586 158
181 3300046648 Ga0495611_0329974 Ga0495611_0329974_45_521 158
182 3300046663 Ga0495635_0431394 Ga0495635_0431394_328_804 158
183 3300046674 Ga0495588_0024212 Ga0495588_0024212_1689_2165 158
184 3300046678 Ga0495599_0335044 Ga0495599_0335044_227_703 158
185 3300046691 Ga0495670_0114779 Ga0495670_0114779_117_593 158
186 3300046794 Ga0495589_0002198 Ga0495589_0002198_4986_5462 158
187 3300046794 Ga0495589_0020348 Ga0495589_0020348_2605_3081 158
188 3300047315 Ga0495581_0106113 Ga0495581_0106113_589_1065 158
189 3300047318 Ga0495636_0066497 Ga0495636_0066497_835_1311 158
190 3300047321 Ga0495676_0004028 Ga0495676_0004028_5370_5846 158
191 3300047321 Ga0495676_0094794 Ga0495676_0094794_1388_1864 158
192 3300047321 Ga0495676_0104669 Ga0495676_0104669_975_1451 158
193 3300047323 Ga0495683_0060973 Ga0495683_0060973_1283_1759 158
194 3300047323 Ga0495683_0222505 Ga0495683_0222505_344_820 158
195 3300047447 Ga0495685_007277 Ga0495685_007277_757_1233 158
196 3300047447 Ga0495685_120506 Ga0495685_120506_370_846 158
197 3300047673 Ga0495593_0062388 Ga0495593_0062388_174_650 158
198 3300048906 Ga0496103_0387576 Ga0496103_0387576_353_829 158
199 3300048907 Ga0496104_1222793 Ga0496104_1222793_115_591 158
200 3300048908 Ga0496105_0137620 Ga0496105_0137620_1282_1758 158
201 3300048915 Ga0496112_0252485 Ga0496112_0252485_1133_1609 158
202 3300048918 Ga0496115_0965477 Ga0496115_0965477_112_588 158
203 3300049570 Ga0501033_0069870 Ga0501033_0069870_1909_2406 158
204 3300049570 Ga0501033_0147934 Ga0501033_0147934_748_1224 158
205 3300049571 Ga0501034_0183999 Ga0501034_0183999_62_538 158
206 3300049574 Ga0501038_0004815 Ga0501038_0004815_8365_8841 158
207 3300049574 Ga0501038_0252715 Ga0501038_0252715_209_685 158
208 3300049575 Ga0501039_0281178 Ga0501039_0281178_308_832 158
209 3300049576 Ga0501040_0255580 Ga0501040_0255580_608_1084 158
210 3300049579 Ga0501043_0239612 Ga0501043_0239612_555_1031 158
211 3300049581 Ga0501047_0089347 Ga0501047_0089347_266_742 158
212 3300049583 Ga0501067_0484197 Ga0501067_0484197_161_637 158
213 3300049586 Ga0501070_0303982 Ga0501070_0303982_491_967 158
214 3300049589 Ga0501073_0272409 Ga0501073_0272409_105_581 158
215 3300049592 Ga0501076_0441545 Ga0501076_0441545_491_967 158
216 3300049742 Ga0501080_0219283 Ga0501080_0219283_873_1397 158
217 3300049742 Ga0501080_0645607 Ga0501080_0645607_74_550 158
218 3300049823 Ga0501044_0008514 Ga0501044_0008514_6790_7266 158
219 3300049823 Ga0501044_0023165 Ga0501044_0023165_998_1495 158
220 3300049823 Ga0501044_0047233 Ga0501044_0047233_2430_2954 158
221 3300049823 Ga0501044_1122729 Ga0501044_1122729_162_638 158
222 3300050492 nmdc:mga0yw44_25076_c1 nmdc:mga0yw44_25076_c1_921_1409 158
223 3300050492 nmdc:mga0yw44_391169_c1 nmdc:mga0yw44_391169_c1_337_813 158
224 3300050494 nmdc:mga06z11_2430_c1 nmdc:mga06z11_2430_c1_5899_6375 158
225 3300050495 nmdc:mga04h51_121045_c1 nmdc:mga04h51_121045_c1_116_592 158
226 3300050507 nmdc:mga05p37_666401_c1 nmdc:mga05p37_666401_c1_572_1048 158
227 3300050508 nmdc:mga09592_1464300_c1 nmdc:mga09592_1464300_c1_11_487 158
228 3300050509 nmdc:mga0qj67_363641_c1 nmdc:mga0qj67_363641_c1_670_1146 158
229 3300050511 nmdc:mga08y16_682504_c1 nmdc:mga08y16_682504_c1_185_661 158
230 3300053077 Ga0495601_0024730 Ga0495601_0024730_458_934 158
231 3300053078 Ga0495612_0385670 Ga0495612_0385670_61_537 158
232 3300053094 Ga0500566_0000510 Ga0500566_0000510_9785_10273 158
233 3300061719 Ga0466962_0007995 Ga0466962_0007995_4194_4670 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

2

71

0.86

PF01799

Fer2_2

[2Fe-2S] binding domain

71

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lxf-assembly1.cif.gz_A crystal structure of [2fe-2s] ferredoxin arx from novosphingobium aromaticivorans 0.7213 5 75
2wp9-assembly3.cif.gz_J crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant 0.71 12 73
7kcm-assembly1.cif.gz_C full-length human mitochondrial hsp90 (trap1) in complex with sdhb in the presence of amp-pnp 0.7069 12 75
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.7 4 74
6yj4-assembly1.cif.gz_G structure of yarrowia lipolytica complex i at 2.7 a 0.6832 2 74
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9265 2 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9103 2 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9034 2 77 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8932 1 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8826 2 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A257LNN9-F1-model_v4 (2Fe-2S)-binding protein 0.9387 1 75 GO:0051537
AF-A0A257JGG5-F1-model_v4 Isoquinoline 1-oxidoreductase 0.932 4 79 GO:0051537
AF-A0A257LNN9-F1-model_v4 (2Fe-2S)-binding protein 0.9268 1 75 GO:0051537
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9252 1 79 GO:0051537
AF-A0A1Q7AH13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9222 1 80 GO:0051537

Feature Viewer

pLDDT pTM Quality
84.85 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map