F346779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 234 | 185 | 234 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100339536|Ga0070680_1003395361 |
| Length | 227 |
| Sequence | MSEFTVHSIPGSPFGRSALATLEEKGASYRLAPLAPGSLKTPEYLKLHPFGRVPVLEHDGFMLYETQAILRYLDRALPQAPLTPSDAKRAARMDQAMNVNDWYLFNGVGNVIIFHRVIGPRVLGLAPDEEAIKAAMPKAQAVFNELARLLGAQPYFAGEELSLADLMLAPQIEFFTIIPEWSVLGTPHDNLVSWMKRMQDRPSMKATTWERVSELAKGHVKGQVKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 20 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 27 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 28 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 43 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 44 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 45 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 67 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 68 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 69 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 70 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 71 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 74 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 75 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 76 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 79 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 80 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 81 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 82 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 83 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 84 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 85 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 86 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 87 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 89 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 91 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 92 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 94 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 97 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 98 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 99 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 102 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 104 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 106 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 115 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 117 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 118 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 121 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 179 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 180 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 181 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 182 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 183 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 185 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.13 |
| Nodule | 0 |
| Rhizoplane | 3.42 |
| Rhizosphere | 81.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10095701 | 3300003323 | Bacteria | 2532 |
| 2 | rootH1_10402525 | 3300003323 | Bacteria | 1144 |
| 3 | Ga0070658_10158777 | 3300005327 | Bacteria | 1896 |
| 4 | Ga0070658_10388234 | 3300005327 | Bacteria | 1198 |
| 5 | Ga0070680_100210527 | 3300005336 | Bacteria | 1640 |
| 6 | Ga0070680_100339536 | 3300005336 | Bacteria | 1276 |
| 7 | Ga0070691_10086374 | 3300005341 | Bacteria | 1542 |
| 8 | Ga0070691_10093195 | 3300005341 | Bacteria | 1487 |
| 9 | Ga0070709_10019423 | 3300005434 | Bacteria | 3929 |
| 10 | Ga0070709_10461184 | 3300005434 | Bacteria | 959 |
| 11 | Ga0070714_101096447 | 3300005435 | Bacteria | 776 |
| 12 | Ga0070713_100010144 | 3300005436 | Bacteria | 6793 |
| 13 | Ga0070713_100018626 | 3300005436 | Bacteria | 5277 |
| 14 | Ga0070713_100051342 | 3300005436 | Bacteria | 3410 |
| 15 | Ga0070710_10118392 | 3300005437 | Bacteria | 1600 |
| 16 | Ga0070711_100162003 | 3300005439 | Bacteria | 1696 |
| 17 | Ga0070708_100054904 | 3300005445 | Bacteria | 3541 |
| 18 | Ga0070681_10080032 | 3300005458 | Bacteria | 3224 |
| 19 | Ga0070707_100575401 | 3300005468 | Bacteria | 1089 |
| 20 | Ga0070698_100178134 | 3300005471 | Bacteria | 2064 |
| 21 | Ga0070699_100376816 | 3300005518 | Bacteria | 1281 |
| 22 | Ga0070679_100022175 | 3300005530 | Bacteria | 6205 |
| 23 | Ga0070679_100034280 | 3300005530 | Bacteria | 5030 |
| 24 | Ga0070679_100054934 | 3300005530 | Bacteria | 3966 |
| 25 | Ga0070684_100220239 | 3300005535 | Bacteria | 1732 |
| 26 | Ga0070684_101094273 | 3300005535 | Bacteria | 749 |
| 27 | Ga0070693_100107515 | 3300005547 | Bacteria | 1710 |
| 28 | Ga0068855_100775089 | 3300005563 | Bacteria | 1021 |
| 29 | Ga0068858_100150025 | 3300005842 | Bacteria | 2191 |
| 30 | Ga0068862_100512029 | 3300005844 | Bacteria | 1141 |
| 31 | Ga0081455_10000816 | 3300005937 | Bacteria | 40084 |
| 32 | Ga0070717_10045129 | 3300006028 | Bacteria | 3602 |
| 33 | Ga0070717_10613893 | 3300006028 | Bacteria | 987 |
| 34 | Ga0075432_10058033 | 3300006058 | Bacteria | 1374 |
| 35 | Ga0070716_100224127 | 3300006173 | Bacteria | 1265 |
| 36 | Ga0070716_100391731 | 3300006173 | Bacteria | 996 |
| 37 | Ga0070712_100816127 | 3300006175 | Bacteria | 801 |
| 38 | Ga0075367_10378642 | 3300006178 | Bacteria | 894 |
| 39 | Ga0075434_100001873 | 3300006871 | Bacteria | 18199 |
| 40 | Ga0075435_100181074 | 3300007076 | Bacteria | 1781 |
| 41 | Ga0105240_10011273 | 3300009093 | Bacteria | 12463 |
| 42 | Ga0105240_10265346 | 3300009093 | Bacteria | 1979 |
| 43 | Ga0111539_10048412 | 3300009094 | Bacteria | 5075 |
| 44 | Ga0105247_10005003 | 3300009101 | Bacteria | 8419 |
| 45 | Ga0105238_10016778 | 3300009551 | Bacteria | 7424 |
| 46 | Ga0105238_10592533 | 3300009551 | Bacteria | 1116 |
| 47 | Ga0105238_10647183 | 3300009551 | Bacteria | 1067 |
| 48 | Ga0105238_11120796 | 3300009551 | Bacteria | 810 |
| 49 | Ga0099796_10004502 | 3300010159 | Bacteria | 3381 |
| 50 | Ga0105239_10117856 | 3300010375 | Bacteria | 2947 |
| 51 | Ga0157371_10053988 | 3300013102 | Bacteria | 2854 |
| 52 | Ga0157370_10120641 | 3300013104 | Bacteria | 2448 |
| 53 | Ga0157369_10012432 | 3300013105 | Bacteria | 9662 |
| 54 | Ga0157369_10124908 | 3300013105 | Bacteria | 2729 |
| 55 | Ga0157369_10411338 | 3300013105 | Bacteria | 1403 |
| 56 | Ga0157378_11282177 | 3300013297 | Bacteria | 773 |
| 57 | Ga0157372_10056620 | 3300013307 | Bacteria | 4380 |
| 58 | Ga0163163_10133397 | 3300014325 | Bacteria | 2524 |
| 59 | Ga0206354_10184547 | 3300020081 | Bacteria | 1574 |
| 60 | Ga0213874_10020243 | 3300021377 | Bacteria | 1822 |
| 61 | Ga0213876_10003089 | 3300021384 | Bacteria | 9640 |
| 62 | Ga0213875_10106519 | 3300021388 | Bacteria | 1309 |
| 63 | Ga0224712_10133561 | 3300022467 | Bacteria | 1086 |
| 64 | Ga0209758_1030775 | 3300025297 | Bacteria | 2215 |
| 65 | Ga0207692_10063800 | 3300025898 | Bacteria | 1916 |
| 66 | Ga0207692_10296257 | 3300025898 | Bacteria | 983 |
| 67 | Ga0207710_10194483 | 3300025900 | Bacteria | 1000 |
| 68 | Ga0207685_10269377 | 3300025905 | Bacteria | 831 |
| 69 | Ga0207699_10026757 | 3300025906 | Bacteria | 3184 |
| 70 | Ga0207699_10033072 | 3300025906 | Bacteria | 2920 |
| 71 | Ga0207705_10509664 | 3300025909 | Bacteria | 935 |
| 72 | Ga0207695_10029734 | 3300025913 | Bacteria | 6028 |
| 73 | Ga0207695_10086026 | 3300025913 | Bacteria | 3171 |
| 74 | Ga0207660_10242101 | 3300025917 | Bacteria | 1421 |
| 75 | Ga0207652_10012401 | 3300025921 | Bacteria | 6888 |
| 76 | Ga0207646_10464173 | 3300025922 | Bacteria | 1142 |
| 77 | Ga0207694_10001326 | 3300025924 | Bacteria | 21296 |
| 78 | Ga0207694_10142225 | 3300025924 | Bacteria | 1930 |
| 79 | Ga0207694_10419576 | 3300025924 | Bacteria | 1114 |
| 80 | Ga0207694_10487532 | 3300025924 | Bacteria | 1031 |
| 81 | Ga0207700_10038084 | 3300025928 | Bacteria | 3488 |
| 82 | Ga0207665_10143847 | 3300025939 | Bacteria | 1703 |
| 83 | Ga0207665_10215713 | 3300025939 | Bacteria | 1404 |
| 84 | Ga0207711_10706437 | 3300025941 | Bacteria | 940 |
| 85 | Ga0207667_10075239 | 3300025949 | Bacteria | 3507 |
| 86 | Ga0207640_10773214 | 3300025981 | Bacteria | 830 |
| 87 | Ga0207639_10807828 | 3300026041 | Bacteria | 874 |
| 88 | Ga0207698_10024283 | 3300026142 | Bacteria | 4252 |
| 89 | Ga0209813_10065569 | 3300027866 | Bacteria | 1169 |
| 90 | Ga0268264_10475985 | 3300028381 | Bacteria | 1214 |
| 91 | Ga0268264_10742233 | 3300028381 | Bacteria | 977 |
| 92 | Ga0265326_10006064 | 3300028558 | Bacteria | 3779 |
| 93 | Ga0265319_1011902 | 3300028563 | Bacteria | 3539 |
| 94 | Ga0265334_10002814 | 3300028573 | Bacteria | 8023 |
| 95 | Ga0265318_10003710 | 3300028577 | Bacteria | 7622 |
| 96 | Ga0265323_10001095 | 3300028653 | Bacteria | 14016 |
| 97 | Ga0265336_10000233 | 3300028666 | Bacteria | 39706 |
| 98 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 99 | Ga0307511_10059249 | 3300030521 | Bacteria | 2947 |
| 100 | Ga0265328_10005461 | 3300031239 | Bacteria | 5444 |
| 101 | Ga0265331_10003411 | 3300031250 | Bacteria | 10279 |
| 102 | Ga0265327_10053737 | 3300031251 | Bacteria | 2088 |
| 103 | Ga0265327_10092587 | 3300031251 | Bacteria | 1471 |
| 104 | Ga0265316_10044551 | 3300031344 | Bacteria | 3528 |
| 105 | Ga0307509_10021121 | 3300031507 | Bacteria | 7366 |
| 106 | Ga0307508_10000532 | 3300031616 | Bacteria | 45338 |
| 107 | Ga0307516_10024016 | 3300031730 | Bacteria | 6235 |
| 108 | Ga0307516_10275820 | 3300031730 | Bacteria | 1365 |
| 109 | Ga0307507_10058583 | 3300033179 | Bacteria | 3614 |
| 110 | Ga0316215_1007711 | 3300033544 | Bacteria | 1051 |
| 111 | Ga0373938_0006313 | 3300034957 | Bacteria | 2045 |
| 112 | Ga0373926_0026704 | 3300035083 | Bacteria | 2021 |
| 113 | Ga0373928_0080043 | 3300035084 | Unclassified | 822 |
| 114 | Ga0373934_0093931 | 3300035086 | Bacteria | 1210 |
| 115 | Ga0373944_0011227 | 3300035089 | Bacteria | 2451 |
| 116 | Ga0373949_0041841 | 3300035090 | Unclassified | 1129 |
| 117 | Ga0373923_0054055 | 3300035111 | Bacteria | 1689 |
| 118 | Ga0373936_0024234 | 3300035113 | Bacteria | 2368 |
| 119 | Ga0373939_0036873 | 3300035114 | Unclassified | 1449 |
| 120 | Ga0373945_0145014 | 3300035116 | Bacteria | 959 |
| 121 | Ga0373954_0235372 | 3300035118 | Bacteria | 901 |
| 122 | Ga0373956_0317908 | 3300035119 | Bacteria | 742 |
| 123 | Ga0373946_0040415 | 3300035171 | Bacteria | 1908 |
| 124 | Ga0373955_0059362 | 3300035172 | Bacteria | 2106 |
| 125 | Ga0373955_0126784 | 3300035172 | Bacteria | 1487 |
| 126 | Ga0373961_0028319 | 3300035241 | Unclassified | 1544 |
| 127 | Ga0373962_0014428 | 3300035242 | Bacteria | 2013 |
| 128 | Ga0373924_0235678 | 3300035410 | Bacteria | 809 |
| 129 | Ga0373931_0038432 | 3300035691 | Bacteria | 2503 |
| 130 | Ga0373927_0046294 | 3300035695 | Bacteria | 2814 |
| 131 | Ga0373927_0082798 | 3300035695 | Bacteria | 2080 |
| 132 | Ga0373927_0129429 | 3300035695 | Bacteria | 1648 |
| 133 | Ga0373927_0204158 | 3300035695 | Bacteria | 1297 |
| 134 | Ga0373933_0095706 | 3300035724 | Bacteria | 1837 |
| 135 | Ga0373947_0061633 | 3300035725 | Bacteria | 2280 |
| 136 | Ga0373947_0065320 | 3300035725 | Bacteria | 2219 |
| 137 | Ga0373947_0506496 | 3300035725 | Bacteria | 820 |
| 138 | Ga0373937_0370153 | 3300036401 | Bacteria | 1358 |
| 139 | Ga0373937_0550597 | 3300036401 | Unclassified | 1096 |
| 140 | Ga0373937_1543617 | 3300036401 | Bacteria | 611 |
| 141 | Ga0372808_013027 | 3300036459 | Bacteria | 1184 |
| 142 | Ga0373925_0051869 | 3300037068 | Bacteria | 3063 |
| 143 | Ga0373925_0098092 | 3300037068 | Bacteria | 2248 |
| 144 | Ga0395900_0018508 | 3300037418 | Bacteria | 7104 |
| 145 | Ga0395898_0348509 | 3300037466 | Bacteria | 1412 |
| 146 | Ga0395905_1097638 | 3300037471 | Bacteria | 699 |
| 147 | Ga0436364_0636714 | 3300037853 | Bacteria | 4248 |
| 148 | Ga0436364_0945662 | 3300037853 | Bacteria | 1675 |
| 149 | Ga0436364_1406908 | 3300037853 | Bacteria | 940 |
| 150 | Ga0436365_0675790 | 3300039437 | Bacteria | 17254 |
| 151 | Ga0436360_1259193 | 3300039438 | Bacteria | 953 |
| 152 | Ga0436363_0297222 | 3300039450 | Bacteria | 3726 |
| 153 | Ga0436362_0381540 | 3300039453 | Bacteria | 5193 |
| 154 | Ga0451789_0085209 | 3300041443 | Bacteria | 863 |
| 155 | Ga0451795_1092371 | 3300041456 | Bacteria | 693 |
| 156 | Ga0466966_0025192 | 3300044684 | Unclassified | 3887 |
| 157 | Ga0466961_0055681 | 3300044693 | Bacteria | 2521 |
| 158 | Ga0466963_0018885 | 3300044694 | Bacteria | 4317 |
| 159 | Ga0466971_0023985 | 3300044719 | Bacteria | 2720 |
| 160 | Ga0466959_0011820 | 3300045049 | Bacteria | 6285 |
| 161 | Ga0466959_0029891 | 3300045049 | Bacteria | 4035 |
| 162 | Ga0466967_0788031 | 3300045976 | Bacteria | 943 |
| 163 | Ga0495592_0156511 | 3300046454 | Bacteria | 1571 |
| 164 | Ga0495603_0149482 | 3300046455 | Bacteria | 1357 |
| 165 | Ga0495629_0155657 | 3300046459 | Bacteria | 1588 |
| 166 | Ga0495653_0027894 | 3300046463 | Bacteria | 4519 |
| 167 | Ga0495580_0063201 | 3300046472 | Bacteria | 2597 |
| 168 | Ga0495580_0233855 | 3300046472 | Bacteria | 1261 |
| 169 | Ga0495582_0160925 | 3300046473 | Bacteria | 1276 |
| 170 | Ga0495639_0044717 | 3300046475 | Bacteria | 2002 |
| 171 | Ga0495639_0118535 | 3300046475 | Bacteria | 1261 |
| 172 | Ga0495662_0028254 | 3300046476 | Bacteria | 2708 |
| 173 | Ga0495664_0176367 | 3300046477 | Bacteria | 1296 |
| 174 | Ga0495664_0243202 | 3300046477 | Unclassified | 1088 |
| 175 | Ga0495608_0234005 | 3300046511 | Bacteria | 1149 |
| 176 | Ga0495628_0052069 | 3300046516 | Bacteria | 3235 |
| 177 | Ga0495628_0088857 | 3300046516 | Bacteria | 2394 |
| 178 | Ga0495630_0063778 | 3300046517 | Bacteria | 2768 |
| 179 | Ga0495665_0040529 | 3300046531 | Bacteria | 2479 |
| 180 | Ga0495640_0089497 | 3300046533 | Bacteria | 2033 |
| 181 | Ga0495645_0097474 | 3300046543 | Bacteria | 2094 |
| 182 | Ga0495667_0086135 | 3300046559 | Bacteria | 2038 |
| 183 | Ga0495625_0019567 | 3300046660 | Bacteria | 5247 |
| 184 | Ga0495635_0357644 | 3300046663 | Bacteria | 973 |
| 185 | Ga0495588_0049360 | 3300046674 | Bacteria | 2164 |
| 186 | Ga0495599_0143439 | 3300046678 | Bacteria | 1481 |
| 187 | Ga0495658_0244451 | 3300046683 | Bacteria | 1127 |
| 188 | Ga0495613_0202059 | 3300046689 | Bacteria | 1401 |
| 189 | Ga0495624_0105137 | 3300046690 | Bacteria | 1737 |
| 190 | Ga0495581_0062350 | 3300047315 | Bacteria | 2154 |
| 191 | Ga0495581_0328931 | 3300047315 | Bacteria | 892 |
| 192 | Ga0495604_0124294 | 3300047317 | Bacteria | 1863 |
| 193 | Ga0495674_0008725 | 3300047319 | Bacteria | 9642 |
| 194 | Ga0495674_0428121 | 3300047319 | Bacteria | 1066 |
| 195 | Ga0495676_0364502 | 3300047321 | Bacteria | 964 |
| 196 | Ga0495684_0146055 | 3300047471 | Bacteria | 1771 |
| 197 | Ga0495684_0215395 | 3300047471 | Bacteria | 1410 |
| 198 | Ga0495593_0036902 | 3300047673 | Bacteria | 2647 |
| 199 | Ga0495602_0004249 | 3300048088 | Bacteria | 14908 |
| 200 | Ga0495614_0104094 | 3300048089 | Bacteria | 1243 |
| 201 | Ga0496100_0515294 | 3300048903 | Bacteria | 923 |
| 202 | Ga0496105_0339390 | 3300048908 | Bacteria | 1202 |
| 203 | Ga0496106_0016547 | 3300048909 | Bacteria | 5456 |
| 204 | Ga0496107_0025590 | 3300048910 | Bacteria | 4179 |
| 205 | Ga0496108_0062772 | 3300048911 | Bacteria | 3128 |
| 206 | Ga0496112_0064908 | 3300048915 | Bacteria | 3603 |
| 207 | Ga0496117_0211239 | 3300048920 | Bacteria | 1088 |
| 208 | Ga0496118_0001822 | 3300048921 | Bacteria | 30624 |
| 209 | Ga0496121_0000707 | 3300048924 | Bacteria | 62128 |
| 210 | Ga0496124_0009690 | 3300048927 | Bacteria | 9862 |
| 211 | Ga0496126_0009966 | 3300048929 | Bacteria | 10034 |
| 212 | Ga0496126_0013247 | 3300048929 | Bacteria | 8407 |
| 213 | Ga0501032_0511911 | 3300049569 | Bacteria | 767 |
| 214 | Ga0501047_0010684 | 3300049581 | Bacteria | 8676 |
| 215 | Ga0501070_0027622 | 3300049586 | Bacteria | 4760 |
| 216 | Ga0501073_0185439 | 3300049589 | Bacteria | 1440 |
| 217 | Ga0501074_0051571 | 3300049590 | Bacteria | 2969 |
| 218 | Ga0501080_0311535 | 3300049742 | Bacteria | 1426 |
| 219 | nmdc:mga04h51_78091_c1 | 3300050495 | Bacteria | 1169 |
| 220 | nmdc:mga08y16_120865_c1 | 3300050511 | Bacteria | 2726 |
| 221 | nmdc:mga0n895_20767_c1 | 3300050512 | Bacteria | 6132 |
| 222 | nmdc:mga0a205_4364_c1 | 3300050515 | Bacteria | 12685 |
| 223 | Ga0495601_0298456 | 3300053077 | Bacteria | 1050 |
| 224 | Ga0495612_0035868 | 3300053078 | Bacteria | 2011 |
| 225 | Ga0495619_0056468 | 3300053085 | Bacteria | 2603 |
| 226 | Ga0500650_0133484 | 3300053098 | Bacteria | 1153 |
| 227 | Ga0500572_001810 | 3300053111 | Bacteria | 5462 |
| 228 | Ga0500559_0000491 | 3300053136 | Bacteria | 27718 |
| 229 | Ga0500590_091829 | 3300053148 | Bacteria | 1473 |
| 230 | Ga0500639_021707 | 3300053163 | Bacteria | 3393 |
| 231 | Ga0500636_0232659 | 3300053177 | Bacteria | 952 |
| 232 | Ga0500596_000662 | 3300053735 | Bacteria | 6663 |
| 233 | Ga0500596_002498 | 3300053735 | Bacteria | 3626 |
| 234 | Ga0466962_0048926 | 3300061719 | Bacteria | 2020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_1543617 | Ga0373937_1543617_48_593 | 181 |
| 2 | 3300041456 | Ga0451795_1092371 | Ga0451795_1092371_81_659 | 191 |
| 3 | 3300037853 | Ga0436364_0636714 | Ga0436364_0636714_3462_4109 | 215 |
| 4 | 3300046689 | Ga0495613_0202059 | Ga0495613_0202059_67_735 | 217 |
| 5 | 3300003323 | rootH1_10095701 | rootH1_100957014 | 219 |
| 6 | 3300003323 | rootH1_10402525 | rootH1_104025252 | 219 |
| 7 | 3300005327 | Ga0070658_10158777 | Ga0070658_101587774 | 219 |
| 8 | 3300005327 | Ga0070658_10388234 | Ga0070658_103882342 | 219 |
| 9 | 3300005336 | Ga0070680_100210527 | Ga0070680_1002105273 | 219 |
| 10 | 3300005336 | Ga0070680_100339536 | Ga0070680_1003395361 | 219 |
| 11 | 3300005341 | Ga0070691_10086374 | Ga0070691_100863741 | 219 |
| 12 | 3300005341 | Ga0070691_10093195 | Ga0070691_100931952 | 219 |
| 13 | 3300005434 | Ga0070709_10019423 | Ga0070709_100194232 | 219 |
| 14 | 3300005434 | Ga0070709_10461184 | Ga0070709_104611841 | 219 |
| 15 | 3300005435 | Ga0070714_101096447 | Ga0070714_1010964471 | 219 |
| 16 | 3300005436 | Ga0070713_100010144 | Ga0070713_1000101442 | 219 |
| 17 | 3300005436 | Ga0070713_100018626 | Ga0070713_1000186263 | 219 |
| 18 | 3300005436 | Ga0070713_100051342 | Ga0070713_1000513422 | 219 |
| 19 | 3300005437 | Ga0070710_10118392 | Ga0070710_101183922 | 219 |
| 20 | 3300005439 | Ga0070711_100162003 | Ga0070711_1001620033 | 219 |
| 21 | 3300005445 | Ga0070708_100054904 | Ga0070708_1000549045 | 219 |
| 22 | 3300005458 | Ga0070681_10080032 | Ga0070681_100800322 | 219 |
| 23 | 3300005468 | Ga0070707_100575401 | Ga0070707_1005754012 | 219 |
| 24 | 3300005471 | Ga0070698_100178134 | Ga0070698_1001781343 | 219 |
| 25 | 3300005518 | Ga0070699_100376816 | Ga0070699_1003768163 | 219 |
| 26 | 3300005530 | Ga0070679_100022175 | Ga0070679_1000221754 | 219 |
| 27 | 3300005530 | Ga0070679_100034280 | Ga0070679_1000342805 | 219 |
| 28 | 3300005530 | Ga0070679_100054934 | Ga0070679_1000549342 | 219 |
| 29 | 3300005535 | Ga0070684_100220239 | Ga0070684_1002202392 | 219 |
| 30 | 3300005535 | Ga0070684_101094273 | Ga0070684_1010942731 | 219 |
| 31 | 3300005547 | Ga0070693_100107515 | Ga0070693_1001075152 | 219 |
| 32 | 3300005563 | Ga0068855_100775089 | Ga0068855_1007750892 | 219 |
| 33 | 3300005842 | Ga0068858_100150025 | Ga0068858_1001500254 | 219 |
| 34 | 3300005844 | Ga0068862_100512029 | Ga0068862_1005120291 | 219 |
| 35 | 3300005937 | Ga0081455_10000816 | Ga0081455_1000081622 | 219 |
| 36 | 3300006028 | Ga0070717_10045129 | Ga0070717_100451294 | 219 |
| 37 | 3300006028 | Ga0070717_10613893 | Ga0070717_106138931 | 219 |
| 38 | 3300006058 | Ga0075432_10058033 | Ga0075432_100580332 | 219 |
| 39 | 3300006173 | Ga0070716_100224127 | Ga0070716_1002241272 | 219 |
| 40 | 3300006173 | Ga0070716_100391731 | Ga0070716_1003917312 | 219 |
| 41 | 3300006175 | Ga0070712_100816127 | Ga0070712_1008161271 | 219 |
| 42 | 3300006178 | Ga0075367_10378642 | Ga0075367_103786422 | 219 |
| 43 | 3300006871 | Ga0075434_100001873 | Ga0075434_10000187310 | 219 |
| 44 | 3300007076 | Ga0075435_100181074 | Ga0075435_1001810743 | 219 |
| 45 | 3300009093 | Ga0105240_10011273 | Ga0105240_100112732 | 219 |
| 46 | 3300009093 | Ga0105240_10265346 | Ga0105240_102653462 | 219 |
| 47 | 3300009094 | Ga0111539_10048412 | Ga0111539_100484124 | 219 |
| 48 | 3300009101 | Ga0105247_10005003 | Ga0105247_100050031 | 219 |
| 49 | 3300009551 | Ga0105238_10016778 | Ga0105238_100167785 | 219 |
| 50 | 3300009551 | Ga0105238_10592533 | Ga0105238_105925332 | 219 |
| 51 | 3300009551 | Ga0105238_10647183 | Ga0105238_106471831 | 219 |
| 52 | 3300009551 | Ga0105238_11120796 | Ga0105238_111207962 | 219 |
| 53 | 3300010159 | Ga0099796_10004502 | Ga0099796_100045025 | 219 |
| 54 | 3300010375 | Ga0105239_10117856 | Ga0105239_101178564 | 219 |
| 55 | 3300013102 | Ga0157371_10053988 | Ga0157371_100539883 | 219 |
| 56 | 3300013104 | Ga0157370_10120641 | Ga0157370_101206412 | 219 |
| 57 | 3300013105 | Ga0157369_10012432 | Ga0157369_100124329 | 219 |
| 58 | 3300013105 | Ga0157369_10124908 | Ga0157369_101249083 | 219 |
| 59 | 3300013105 | Ga0157369_10411338 | Ga0157369_104113382 | 219 |
| 60 | 3300013297 | Ga0157378_11282177 | Ga0157378_112821771 | 219 |
| 61 | 3300013307 | Ga0157372_10056620 | Ga0157372_100566205 | 219 |
| 62 | 3300014325 | Ga0163163_10133397 | Ga0163163_101333974 | 219 |
| 63 | 3300020081 | Ga0206354_10184547 | Ga0206354_101845471 | 219 |
| 64 | 3300021377 | Ga0213874_10020243 | Ga0213874_100202431 | 219 |
| 65 | 3300021384 | Ga0213876_10003089 | Ga0213876_100030897 | 219 |
| 66 | 3300021388 | Ga0213875_10106519 | Ga0213875_101065192 | 219 |
| 67 | 3300022467 | Ga0224712_10133561 | Ga0224712_101335612 | 219 |
| 68 | 3300025297 | Ga0209758_1030775 | Ga0209758_10307752 | 219 |
| 69 | 3300025898 | Ga0207692_10063800 | Ga0207692_100638002 | 219 |
| 70 | 3300025898 | Ga0207692_10296257 | Ga0207692_102962572 | 219 |
| 71 | 3300025900 | Ga0207710_10194483 | Ga0207710_101944831 | 219 |
| 72 | 3300025905 | Ga0207685_10269377 | Ga0207685_102693771 | 219 |
| 73 | 3300025906 | Ga0207699_10026757 | Ga0207699_100267571 | 219 |
| 74 | 3300025906 | Ga0207699_10033072 | Ga0207699_100330724 | 219 |
| 75 | 3300025909 | Ga0207705_10509664 | Ga0207705_105096642 | 219 |
| 76 | 3300025913 | Ga0207695_10029734 | Ga0207695_100297347 | 219 |
| 77 | 3300025913 | Ga0207695_10086026 | Ga0207695_100860261 | 219 |
| 78 | 3300025917 | Ga0207660_10242101 | Ga0207660_102421012 | 219 |
| 79 | 3300025921 | Ga0207652_10012401 | Ga0207652_100124015 | 219 |
| 80 | 3300025922 | Ga0207646_10464173 | Ga0207646_104641732 | 219 |
| 81 | 3300025924 | Ga0207694_10001326 | Ga0207694_1000132610 | 219 |
| 82 | 3300025924 | Ga0207694_10142225 | Ga0207694_101422252 | 219 |
| 83 | 3300025924 | Ga0207694_10419576 | Ga0207694_104195762 | 219 |
| 84 | 3300025924 | Ga0207694_10487532 | Ga0207694_104875322 | 219 |
| 85 | 3300025928 | Ga0207700_10038084 | Ga0207700_100380843 | 219 |
| 86 | 3300025939 | Ga0207665_10143847 | Ga0207665_101438472 | 219 |
| 87 | 3300025939 | Ga0207665_10215713 | Ga0207665_102157132 | 219 |
| 88 | 3300025941 | Ga0207711_10706437 | Ga0207711_107064372 | 219 |
| 89 | 3300025949 | Ga0207667_10075239 | Ga0207667_100752394 | 219 |
| 90 | 3300025981 | Ga0207640_10773214 | Ga0207640_107732141 | 219 |
| 91 | 3300026041 | Ga0207639_10807828 | Ga0207639_108078282 | 219 |
| 92 | 3300026142 | Ga0207698_10024283 | Ga0207698_100242834 | 219 |
| 93 | 3300027866 | Ga0209813_10065569 | Ga0209813_100655692 | 219 |
| 94 | 3300028381 | Ga0268264_10475985 | Ga0268264_104759852 | 219 |
| 95 | 3300028381 | Ga0268264_10742233 | Ga0268264_107422332 | 219 |
| 96 | 3300028558 | Ga0265326_10006064 | Ga0265326_100060644 | 219 |
| 97 | 3300028563 | Ga0265319_1011902 | Ga0265319_10119021 | 219 |
| 98 | 3300028573 | Ga0265334_10002814 | Ga0265334_100028148 | 219 |
| 99 | 3300028577 | Ga0265318_10003710 | Ga0265318_100037102 | 219 |
| 100 | 3300028653 | Ga0265323_10001095 | Ga0265323_100010958 | 219 |
| 101 | 3300028666 | Ga0265336_10000233 | Ga0265336_1000023321 | 219 |
| 102 | 3300028800 | Ga0265338_10000090 | Ga0265338_1000009039 | 219 |
| 103 | 3300030521 | Ga0307511_10059249 | Ga0307511_100592493 | 219 |
| 104 | 3300031239 | Ga0265328_10005461 | Ga0265328_100054612 | 219 |
| 105 | 3300031250 | Ga0265331_10003411 | Ga0265331_1000341110 | 219 |
| 106 | 3300031251 | Ga0265327_10053737 | Ga0265327_100537371 | 219 |
| 107 | 3300031251 | Ga0265327_10092587 | Ga0265327_100925873 | 219 |
| 108 | 3300031344 | Ga0265316_10044551 | Ga0265316_100445514 | 219 |
| 109 | 3300031507 | Ga0307509_10021121 | Ga0307509_100211215 | 219 |
| 110 | 3300031616 | Ga0307508_10000532 | Ga0307508_100005326 | 219 |
| 111 | 3300031730 | Ga0307516_10024016 | Ga0307516_100240162 | 219 |
| 112 | 3300031730 | Ga0307516_10275820 | Ga0307516_102758202 | 219 |
| 113 | 3300033179 | Ga0307507_10058583 | Ga0307507_100585833 | 219 |
| 114 | 3300033544 | Ga0316215_1007711 | Ga0316215_10077112 | 219 |
| 115 | 3300034957 | Ga0373938_0006313 | Ga0373938_0006313_691_1350 | 219 |
| 116 | 3300035083 | Ga0373926_0026704 | Ga0373926_0026704_1123_1782 | 219 |
| 117 | 3300035084 | Ga0373928_0080043 | Ga0373928_0080043_109_768 | 219 |
| 118 | 3300035086 | Ga0373934_0093931 | Ga0373934_0093931_380_1039 | 219 |
| 119 | 3300035089 | Ga0373944_0011227 | Ga0373944_0011227_1159_1818 | 219 |
| 120 | 3300035090 | Ga0373949_0041841 | Ga0373949_0041841_126_785 | 219 |
| 121 | 3300035111 | Ga0373923_0054055 | Ga0373923_0054055_599_1258 | 219 |
| 122 | 3300035113 | Ga0373936_0024234 | Ga0373936_0024234_1081_1740 | 219 |
| 123 | 3300035114 | Ga0373939_0036873 | Ga0373939_0036873_294_953 | 219 |
| 124 | 3300035116 | Ga0373945_0145014 | Ga0373945_0145014_49_708 | 219 |
| 125 | 3300035118 | Ga0373954_0235372 | Ga0373954_0235372_15_674 | 219 |
| 126 | 3300035119 | Ga0373956_0317908 | Ga0373956_0317908_15_674 | 219 |
| 127 | 3300035171 | Ga0373946_0040415 | Ga0373946_0040415_674_1333 | 219 |
| 128 | 3300035172 | Ga0373955_0059362 | Ga0373955_0059362_1073_1732 | 219 |
| 129 | 3300035172 | Ga0373955_0126784 | Ga0373955_0126784_66_725 | 219 |
| 130 | 3300035241 | Ga0373961_0028319 | Ga0373961_0028319_296_955 | 219 |
| 131 | 3300035242 | Ga0373962_0014428 | Ga0373962_0014428_378_1037 | 219 |
| 132 | 3300035410 | Ga0373924_0235678 | Ga0373924_0235678_114_773 | 219 |
| 133 | 3300035691 | Ga0373931_0038432 | Ga0373931_0038432_856_1515 | 219 |
| 134 | 3300035695 | Ga0373927_0046294 | Ga0373927_0046294_1104_1763 | 219 |
| 135 | 3300035695 | Ga0373927_0082798 | Ga0373927_0082798_1132_1791 | 219 |
| 136 | 3300035695 | Ga0373927_0129429 | Ga0373927_0129429_205_864 | 219 |
| 137 | 3300035695 | Ga0373927_0204158 | Ga0373927_0204158_133_792 | 219 |
| 138 | 3300035724 | Ga0373933_0095706 | Ga0373933_0095706_366_1025 | 219 |
| 139 | 3300035725 | Ga0373947_0061633 | Ga0373947_0061633_994_1653 | 219 |
| 140 | 3300035725 | Ga0373947_0065320 | Ga0373947_0065320_829_1488 | 219 |
| 141 | 3300035725 | Ga0373947_0506496 | Ga0373947_0506496_49_708 | 219 |
| 142 | 3300036401 | Ga0373937_0370153 | Ga0373937_0370153_423_1082 | 219 |
| 143 | 3300036401 | Ga0373937_0550597 | Ga0373937_0550597_11_670 | 219 |
| 144 | 3300036459 | Ga0372808_013027 | Ga0372808_013027_272_931 | 219 |
| 145 | 3300037068 | Ga0373925_0051869 | Ga0373925_0051869_735_1394 | 219 |
| 146 | 3300037068 | Ga0373925_0098092 | Ga0373925_0098092_162_821 | 219 |
| 147 | 3300037418 | Ga0395900_0018508 | Ga0395900_0018508_1088_1747 | 219 |
| 148 | 3300037466 | Ga0395898_0348509 | Ga0395898_0348509_687_1346 | 219 |
| 149 | 3300037471 | Ga0395905_1097638 | Ga0395905_1097638_10_669 | 219 |
| 150 | 3300037853 | Ga0436364_0945662 | Ga0436364_0945662_597_1256 | 219 |
| 151 | 3300037853 | Ga0436364_1406908 | Ga0436364_1406908_93_755 | 219 |
| 152 | 3300039437 | Ga0436365_0675790 | Ga0436365_0675790_4407_5066 | 219 |
| 153 | 3300039438 | Ga0436360_1259193 | Ga0436360_1259193_207_866 | 219 |
| 154 | 3300039450 | Ga0436363_0297222 | Ga0436363_0297222_100_759 | 219 |
| 155 | 3300039453 | Ga0436362_0381540 | Ga0436362_0381540_2461_3120 | 219 |
| 156 | 3300041443 | Ga0451789_0085209 | Ga0451789_0085209_93_764 | 219 |
| 157 | 3300044684 | Ga0466966_0025192 | Ga0466966_0025192_2614_3285 | 219 |
| 158 | 3300044693 | Ga0466961_0055681 | Ga0466961_0055681_382_1041 | 219 |
| 159 | 3300044694 | Ga0466963_0018885 | Ga0466963_0018885_223_882 | 219 |
| 160 | 3300044719 | Ga0466971_0023985 | Ga0466971_0023985_1955_2614 | 219 |
| 161 | 3300045049 | Ga0466959_0011820 | Ga0466959_0011820_2907_3578 | 219 |
| 162 | 3300045049 | Ga0466959_0029891 | Ga0466959_0029891_1291_1950 | 219 |
| 163 | 3300045976 | Ga0466967_0788031 | Ga0466967_0788031_92_751 | 219 |
| 164 | 3300046454 | Ga0495592_0156511 | Ga0495592_0156511_854_1513 | 219 |
| 165 | 3300046455 | Ga0495603_0149482 | Ga0495603_0149482_273_938 | 219 |
| 166 | 3300046459 | Ga0495629_0155657 | Ga0495629_0155657_168_827 | 219 |
| 167 | 3300046463 | Ga0495653_0027894 | Ga0495653_0027894_243_902 | 219 |
| 168 | 3300046472 | Ga0495580_0063201 | Ga0495580_0063201_262_921 | 219 |
| 169 | 3300046472 | Ga0495580_0233855 | Ga0495580_0233855_289_948 | 219 |
| 170 | 3300046473 | Ga0495582_0160925 | Ga0495582_0160925_366_1025 | 219 |
| 171 | 3300046475 | Ga0495639_0044717 | Ga0495639_0044717_725_1384 | 219 |
| 172 | 3300046475 | Ga0495639_0118535 | Ga0495639_0118535_222_881 | 219 |
| 173 | 3300046476 | Ga0495662_0028254 | Ga0495662_0028254_1228_1887 | 219 |
| 174 | 3300046477 | Ga0495664_0176367 | Ga0495664_0176367_391_1050 | 219 |
| 175 | 3300046477 | Ga0495664_0243202 | Ga0495664_0243202_378_1037 | 219 |
| 176 | 3300046511 | Ga0495608_0234005 | Ga0495608_0234005_145_804 | 219 |
| 177 | 3300046516 | Ga0495628_0052069 | Ga0495628_0052069_2284_2943 | 219 |
| 178 | 3300046516 | Ga0495628_0088857 | Ga0495628_0088857_1068_1727 | 219 |
| 179 | 3300046517 | Ga0495630_0063778 | Ga0495630_0063778_1197_1856 | 219 |
| 180 | 3300046531 | Ga0495665_0040529 | Ga0495665_0040529_1197_1856 | 219 |
| 181 | 3300046533 | Ga0495640_0089497 | Ga0495640_0089497_209_868 | 219 |
| 182 | 3300046543 | Ga0495645_0097474 | Ga0495645_0097474_1099_1758 | 219 |
| 183 | 3300046559 | Ga0495667_0086135 | Ga0495667_0086135_1270_1929 | 219 |
| 184 | 3300046660 | Ga0495625_0019567 | Ga0495625_0019567_280_945 | 219 |
| 185 | 3300046663 | Ga0495635_0357644 | Ga0495635_0357644_276_935 | 219 |
| 186 | 3300046674 | Ga0495588_0049360 | Ga0495588_0049360_883_1542 | 219 |
| 187 | 3300046678 | Ga0495599_0143439 | Ga0495599_0143439_336_995 | 219 |
| 188 | 3300046683 | Ga0495658_0244451 | Ga0495658_0244451_411_1070 | 219 |
| 189 | 3300046690 | Ga0495624_0105137 | Ga0495624_0105137_25_684 | 219 |
| 190 | 3300047315 | Ga0495581_0062350 | Ga0495581_0062350_968_1627 | 219 |
| 191 | 3300047315 | Ga0495581_0328931 | Ga0495581_0328931_185_844 | 219 |
| 192 | 3300047317 | Ga0495604_0124294 | Ga0495604_0124294_388_1047 | 219 |
| 193 | 3300047319 | Ga0495674_0008725 | Ga0495674_0008725_7098_7757 | 219 |
| 194 | 3300047319 | Ga0495674_0428121 | Ga0495674_0428121_114_773 | 219 |
| 195 | 3300047321 | Ga0495676_0364502 | Ga0495676_0364502_259_918 | 219 |
| 196 | 3300047471 | Ga0495684_0146055 | Ga0495684_0146055_235_894 | 219 |
| 197 | 3300047471 | Ga0495684_0215395 | Ga0495684_0215395_552_1211 | 219 |
| 198 | 3300047673 | Ga0495593_0036902 | Ga0495593_0036902_439_1098 | 219 |
| 199 | 3300048088 | Ga0495602_0004249 | Ga0495602_0004249_1933_2592 | 219 |
| 200 | 3300048089 | Ga0495614_0104094 | Ga0495614_0104094_465_1124 | 219 |
| 201 | 3300048903 | Ga0496100_0515294 | Ga0496100_0515294_32_691 | 219 |
| 202 | 3300048908 | Ga0496105_0339390 | Ga0496105_0339390_194_853 | 219 |
| 203 | 3300048909 | Ga0496106_0016547 | Ga0496106_0016547_4310_4969 | 219 |
| 204 | 3300048910 | Ga0496107_0025590 | Ga0496107_0025590_1431_2090 | 219 |
| 205 | 3300048911 | Ga0496108_0062772 | Ga0496108_0062772_84_743 | 219 |
| 206 | 3300048915 | Ga0496112_0064908 | Ga0496112_0064908_360_1019 | 219 |
| 207 | 3300048920 | Ga0496117_0211239 | Ga0496117_0211239_298_957 | 219 |
| 208 | 3300048921 | Ga0496118_0001822 | Ga0496118_0001822_14043_14702 | 219 |
| 209 | 3300048924 | Ga0496121_0000707 | Ga0496121_0000707_1043_1702 | 219 |
| 210 | 3300048927 | Ga0496124_0009690 | Ga0496124_0009690_4301_4960 | 219 |
| 211 | 3300048929 | Ga0496126_0009966 | Ga0496126_0009966_4961_5620 | 219 |
| 212 | 3300048929 | Ga0496126_0013247 | Ga0496126_0013247_2014_2673 | 219 |
| 213 | 3300049569 | Ga0501032_0511911 | Ga0501032_0511911_31_696 | 219 |
| 214 | 3300049581 | Ga0501047_0010684 | Ga0501047_0010684_2800_3459 | 219 |
| 215 | 3300049586 | Ga0501070_0027622 | Ga0501070_0027622_2906_3565 | 219 |
| 216 | 3300049589 | Ga0501073_0185439 | Ga0501073_0185439_228_887 | 219 |
| 217 | 3300049590 | Ga0501074_0051571 | Ga0501074_0051571_1478_2137 | 219 |
| 218 | 3300049742 | Ga0501080_0311535 | Ga0501080_0311535_77_736 | 219 |
| 219 | 3300050495 | nmdc:mga04h51_78091_c1 | nmdc:mga04h51_78091_c1_69_728 | 219 |
| 220 | 3300050511 | nmdc:mga08y16_120865_c1 | nmdc:mga08y16_120865_c1_895_1554 | 219 |
| 221 | 3300050512 | nmdc:mga0n895_20767_c1 | nmdc:mga0n895_20767_c1_4293_4952 | 219 |
| 222 | 3300050515 | nmdc:mga0a205_4364_c1 | nmdc:mga0a205_4364_c1_1556_2215 | 219 |
| 223 | 3300053077 | Ga0495601_0298456 | Ga0495601_0298456_217_876 | 219 |
| 224 | 3300053078 | Ga0495612_0035868 | Ga0495612_0035868_119_778 | 219 |
| 225 | 3300053085 | Ga0495619_0056468 | Ga0495619_0056468_1265_1924 | 219 |
| 226 | 3300053098 | Ga0500650_0133484 | Ga0500650_0133484_91_768 | 219 |
| 227 | 3300053111 | Ga0500572_001810 | Ga0500572_001810_2374_3033 | 219 |
| 228 | 3300053136 | Ga0500559_0000491 | Ga0500559_0000491_14431_15090 | 219 |
| 229 | 3300053148 | Ga0500590_091829 | Ga0500590_091829_196_855 | 219 |
| 230 | 3300053163 | Ga0500639_021707 | Ga0500639_021707_1266_1925 | 219 |
| 231 | 3300053177 | Ga0500636_0232659 | Ga0500636_0232659_53_712 | 219 |
| 232 | 3300053735 | Ga0500596_000662 | Ga0500596_000662_821_1480 | 219 |
| 233 | 3300053735 | Ga0500596_002498 | Ga0500596_002498_1346_2005 | 219 |
| 234 | 3300061719 | Ga0466962_0048926 | Ga0466962_0048926_194_853 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5a4u-assembly1.cif.gz_A | atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde | 0.9026 | 2 | 208 |
| 6tk8-assembly1.cif.gz_AAA-2 | gstf1 f122t variant from alopecurus myosuroides | 0.9021 | 4 | 212 |
| 7odm-assembly1.cif.gz_AAA-2 | amgstf1 y118s variant | 0.8971 | 2 | 212 |
| 7obo-assembly1.cif.gz_AAA-2 | gstf1 from alopecurus myosuroides | 0.897 | 2 | 212 |
| 6zb6-assembly1.cif.gz_A | crystal structure of lolium rigidum gstf in complex with s-(p-nitrobenzyl) glutathione | 0.8961 | 1 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0B5EC52_24_99_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.968 | 7 | 79 | 3.40.30.10 |
| af_Q5ZCX6_5_69_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9659 | 6 | 65 | 3.40.30.10 |
| 4ke3D01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9594 | 4 | 80 | 3.40.30.10 |
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9569 | 7 | 78 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9505 | 3 | 77 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QUM8-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.982 | 1 | 207 |
GO:0004364
GO:0005737 GO:0043295 |
| AF-A0A150RKZ4-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.9805 | 1 | 182 |
GO:0004364
GO:0005737 GO:0043295 |
| AF-A0A3S0ED57-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.98 | 1 | 219 |
GO:0004364
GO:0005737 GO:0043295 |
| AF-A0A0N0JTA3-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.9787 | 1 | 214 |
GO:0004364
GO:0005737 GO:0043295 |
| AF-A0A4Q2U908-F1-model_v4 | glutathione transferase (EC 2.5.1.18) | 0.9757 | 1 | 215 |
GO:0004364
GO:0005737 GO:0043295 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar