F346779

General Info

Members Datasets Scaffolds Average Seq Length
234 185 234 219

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100339536|Ga0070680_1003395361
Length 227
Sequence MSEFTVHSIPGSPFGRSALATLEEKGASYRLAPLAPGSLKTPEYLKLHPFGRVPVLEHDGFMLYETQAILRYLDRALPQAPLTPSDAKRAARMDQAMNVNDWYLFNGVGNVIIFHRVIGPRVLGLAPDEEAIKAAMPKAQAVFNELARLLGAQPYFAGEELSLADLMLAPQIEFFTIIPEWSVLGTPHDNLVSWMKRMQDRPSMKATTWERVSELAKGHVKGQVKAA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
83 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
182 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.13
Nodule 0
Rhizoplane 3.42
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10095701 3300003323 Bacteria 2532
2 rootH1_10402525 3300003323 Bacteria 1144
3 Ga0070658_10158777 3300005327 Bacteria 1896
4 Ga0070658_10388234 3300005327 Bacteria 1198
5 Ga0070680_100210527 3300005336 Bacteria 1640
6 Ga0070680_100339536 3300005336 Bacteria 1276
7 Ga0070691_10086374 3300005341 Bacteria 1542
8 Ga0070691_10093195 3300005341 Bacteria 1487
9 Ga0070709_10019423 3300005434 Bacteria 3929
10 Ga0070709_10461184 3300005434 Bacteria 959
11 Ga0070714_101096447 3300005435 Bacteria 776
12 Ga0070713_100010144 3300005436 Bacteria 6793
13 Ga0070713_100018626 3300005436 Bacteria 5277
14 Ga0070713_100051342 3300005436 Bacteria 3410
15 Ga0070710_10118392 3300005437 Bacteria 1600
16 Ga0070711_100162003 3300005439 Bacteria 1696
17 Ga0070708_100054904 3300005445 Bacteria 3541
18 Ga0070681_10080032 3300005458 Bacteria 3224
19 Ga0070707_100575401 3300005468 Bacteria 1089
20 Ga0070698_100178134 3300005471 Bacteria 2064
21 Ga0070699_100376816 3300005518 Bacteria 1281
22 Ga0070679_100022175 3300005530 Bacteria 6205
23 Ga0070679_100034280 3300005530 Bacteria 5030
24 Ga0070679_100054934 3300005530 Bacteria 3966
25 Ga0070684_100220239 3300005535 Bacteria 1732
26 Ga0070684_101094273 3300005535 Bacteria 749
27 Ga0070693_100107515 3300005547 Bacteria 1710
28 Ga0068855_100775089 3300005563 Bacteria 1021
29 Ga0068858_100150025 3300005842 Bacteria 2191
30 Ga0068862_100512029 3300005844 Bacteria 1141
31 Ga0081455_10000816 3300005937 Bacteria 40084
32 Ga0070717_10045129 3300006028 Bacteria 3602
33 Ga0070717_10613893 3300006028 Bacteria 987
34 Ga0075432_10058033 3300006058 Bacteria 1374
35 Ga0070716_100224127 3300006173 Bacteria 1265
36 Ga0070716_100391731 3300006173 Bacteria 996
37 Ga0070712_100816127 3300006175 Bacteria 801
38 Ga0075367_10378642 3300006178 Bacteria 894
39 Ga0075434_100001873 3300006871 Bacteria 18199
40 Ga0075435_100181074 3300007076 Bacteria 1781
41 Ga0105240_10011273 3300009093 Bacteria 12463
42 Ga0105240_10265346 3300009093 Bacteria 1979
43 Ga0111539_10048412 3300009094 Bacteria 5075
44 Ga0105247_10005003 3300009101 Bacteria 8419
45 Ga0105238_10016778 3300009551 Bacteria 7424
46 Ga0105238_10592533 3300009551 Bacteria 1116
47 Ga0105238_10647183 3300009551 Bacteria 1067
48 Ga0105238_11120796 3300009551 Bacteria 810
49 Ga0099796_10004502 3300010159 Bacteria 3381
50 Ga0105239_10117856 3300010375 Bacteria 2947
51 Ga0157371_10053988 3300013102 Bacteria 2854
52 Ga0157370_10120641 3300013104 Bacteria 2448
53 Ga0157369_10012432 3300013105 Bacteria 9662
54 Ga0157369_10124908 3300013105 Bacteria 2729
55 Ga0157369_10411338 3300013105 Bacteria 1403
56 Ga0157378_11282177 3300013297 Bacteria 773
57 Ga0157372_10056620 3300013307 Bacteria 4380
58 Ga0163163_10133397 3300014325 Bacteria 2524
59 Ga0206354_10184547 3300020081 Bacteria 1574
60 Ga0213874_10020243 3300021377 Bacteria 1822
61 Ga0213876_10003089 3300021384 Bacteria 9640
62 Ga0213875_10106519 3300021388 Bacteria 1309
63 Ga0224712_10133561 3300022467 Bacteria 1086
64 Ga0209758_1030775 3300025297 Bacteria 2215
65 Ga0207692_10063800 3300025898 Bacteria 1916
66 Ga0207692_10296257 3300025898 Bacteria 983
67 Ga0207710_10194483 3300025900 Bacteria 1000
68 Ga0207685_10269377 3300025905 Bacteria 831
69 Ga0207699_10026757 3300025906 Bacteria 3184
70 Ga0207699_10033072 3300025906 Bacteria 2920
71 Ga0207705_10509664 3300025909 Bacteria 935
72 Ga0207695_10029734 3300025913 Bacteria 6028
73 Ga0207695_10086026 3300025913 Bacteria 3171
74 Ga0207660_10242101 3300025917 Bacteria 1421
75 Ga0207652_10012401 3300025921 Bacteria 6888
76 Ga0207646_10464173 3300025922 Bacteria 1142
77 Ga0207694_10001326 3300025924 Bacteria 21296
78 Ga0207694_10142225 3300025924 Bacteria 1930
79 Ga0207694_10419576 3300025924 Bacteria 1114
80 Ga0207694_10487532 3300025924 Bacteria 1031
81 Ga0207700_10038084 3300025928 Bacteria 3488
82 Ga0207665_10143847 3300025939 Bacteria 1703
83 Ga0207665_10215713 3300025939 Bacteria 1404
84 Ga0207711_10706437 3300025941 Bacteria 940
85 Ga0207667_10075239 3300025949 Bacteria 3507
86 Ga0207640_10773214 3300025981 Bacteria 830
87 Ga0207639_10807828 3300026041 Bacteria 874
88 Ga0207698_10024283 3300026142 Bacteria 4252
89 Ga0209813_10065569 3300027866 Bacteria 1169
90 Ga0268264_10475985 3300028381 Bacteria 1214
91 Ga0268264_10742233 3300028381 Bacteria 977
92 Ga0265326_10006064 3300028558 Bacteria 3779
93 Ga0265319_1011902 3300028563 Bacteria 3539
94 Ga0265334_10002814 3300028573 Bacteria 8023
95 Ga0265318_10003710 3300028577 Bacteria 7622
96 Ga0265323_10001095 3300028653 Bacteria 14016
97 Ga0265336_10000233 3300028666 Bacteria 39706
98 Ga0265338_10000090 3300028800 Bacteria 171540
99 Ga0307511_10059249 3300030521 Bacteria 2947
100 Ga0265328_10005461 3300031239 Bacteria 5444
101 Ga0265331_10003411 3300031250 Bacteria 10279
102 Ga0265327_10053737 3300031251 Bacteria 2088
103 Ga0265327_10092587 3300031251 Bacteria 1471
104 Ga0265316_10044551 3300031344 Bacteria 3528
105 Ga0307509_10021121 3300031507 Bacteria 7366
106 Ga0307508_10000532 3300031616 Bacteria 45338
107 Ga0307516_10024016 3300031730 Bacteria 6235
108 Ga0307516_10275820 3300031730 Bacteria 1365
109 Ga0307507_10058583 3300033179 Bacteria 3614
110 Ga0316215_1007711 3300033544 Bacteria 1051
111 Ga0373938_0006313 3300034957 Bacteria 2045
112 Ga0373926_0026704 3300035083 Bacteria 2021
113 Ga0373928_0080043 3300035084 Unclassified 822
114 Ga0373934_0093931 3300035086 Bacteria 1210
115 Ga0373944_0011227 3300035089 Bacteria 2451
116 Ga0373949_0041841 3300035090 Unclassified 1129
117 Ga0373923_0054055 3300035111 Bacteria 1689
118 Ga0373936_0024234 3300035113 Bacteria 2368
119 Ga0373939_0036873 3300035114 Unclassified 1449
120 Ga0373945_0145014 3300035116 Bacteria 959
121 Ga0373954_0235372 3300035118 Bacteria 901
122 Ga0373956_0317908 3300035119 Bacteria 742
123 Ga0373946_0040415 3300035171 Bacteria 1908
124 Ga0373955_0059362 3300035172 Bacteria 2106
125 Ga0373955_0126784 3300035172 Bacteria 1487
126 Ga0373961_0028319 3300035241 Unclassified 1544
127 Ga0373962_0014428 3300035242 Bacteria 2013
128 Ga0373924_0235678 3300035410 Bacteria 809
129 Ga0373931_0038432 3300035691 Bacteria 2503
130 Ga0373927_0046294 3300035695 Bacteria 2814
131 Ga0373927_0082798 3300035695 Bacteria 2080
132 Ga0373927_0129429 3300035695 Bacteria 1648
133 Ga0373927_0204158 3300035695 Bacteria 1297
134 Ga0373933_0095706 3300035724 Bacteria 1837
135 Ga0373947_0061633 3300035725 Bacteria 2280
136 Ga0373947_0065320 3300035725 Bacteria 2219
137 Ga0373947_0506496 3300035725 Bacteria 820
138 Ga0373937_0370153 3300036401 Bacteria 1358
139 Ga0373937_0550597 3300036401 Unclassified 1096
140 Ga0373937_1543617 3300036401 Bacteria 611
141 Ga0372808_013027 3300036459 Bacteria 1184
142 Ga0373925_0051869 3300037068 Bacteria 3063
143 Ga0373925_0098092 3300037068 Bacteria 2248
144 Ga0395900_0018508 3300037418 Bacteria 7104
145 Ga0395898_0348509 3300037466 Bacteria 1412
146 Ga0395905_1097638 3300037471 Bacteria 699
147 Ga0436364_0636714 3300037853 Bacteria 4248
148 Ga0436364_0945662 3300037853 Bacteria 1675
149 Ga0436364_1406908 3300037853 Bacteria 940
150 Ga0436365_0675790 3300039437 Bacteria 17254
151 Ga0436360_1259193 3300039438 Bacteria 953
152 Ga0436363_0297222 3300039450 Bacteria 3726
153 Ga0436362_0381540 3300039453 Bacteria 5193
154 Ga0451789_0085209 3300041443 Bacteria 863
155 Ga0451795_1092371 3300041456 Bacteria 693
156 Ga0466966_0025192 3300044684 Unclassified 3887
157 Ga0466961_0055681 3300044693 Bacteria 2521
158 Ga0466963_0018885 3300044694 Bacteria 4317
159 Ga0466971_0023985 3300044719 Bacteria 2720
160 Ga0466959_0011820 3300045049 Bacteria 6285
161 Ga0466959_0029891 3300045049 Bacteria 4035
162 Ga0466967_0788031 3300045976 Bacteria 943
163 Ga0495592_0156511 3300046454 Bacteria 1571
164 Ga0495603_0149482 3300046455 Bacteria 1357
165 Ga0495629_0155657 3300046459 Bacteria 1588
166 Ga0495653_0027894 3300046463 Bacteria 4519
167 Ga0495580_0063201 3300046472 Bacteria 2597
168 Ga0495580_0233855 3300046472 Bacteria 1261
169 Ga0495582_0160925 3300046473 Bacteria 1276
170 Ga0495639_0044717 3300046475 Bacteria 2002
171 Ga0495639_0118535 3300046475 Bacteria 1261
172 Ga0495662_0028254 3300046476 Bacteria 2708
173 Ga0495664_0176367 3300046477 Bacteria 1296
174 Ga0495664_0243202 3300046477 Unclassified 1088
175 Ga0495608_0234005 3300046511 Bacteria 1149
176 Ga0495628_0052069 3300046516 Bacteria 3235
177 Ga0495628_0088857 3300046516 Bacteria 2394
178 Ga0495630_0063778 3300046517 Bacteria 2768
179 Ga0495665_0040529 3300046531 Bacteria 2479
180 Ga0495640_0089497 3300046533 Bacteria 2033
181 Ga0495645_0097474 3300046543 Bacteria 2094
182 Ga0495667_0086135 3300046559 Bacteria 2038
183 Ga0495625_0019567 3300046660 Bacteria 5247
184 Ga0495635_0357644 3300046663 Bacteria 973
185 Ga0495588_0049360 3300046674 Bacteria 2164
186 Ga0495599_0143439 3300046678 Bacteria 1481
187 Ga0495658_0244451 3300046683 Bacteria 1127
188 Ga0495613_0202059 3300046689 Bacteria 1401
189 Ga0495624_0105137 3300046690 Bacteria 1737
190 Ga0495581_0062350 3300047315 Bacteria 2154
191 Ga0495581_0328931 3300047315 Bacteria 892
192 Ga0495604_0124294 3300047317 Bacteria 1863
193 Ga0495674_0008725 3300047319 Bacteria 9642
194 Ga0495674_0428121 3300047319 Bacteria 1066
195 Ga0495676_0364502 3300047321 Bacteria 964
196 Ga0495684_0146055 3300047471 Bacteria 1771
197 Ga0495684_0215395 3300047471 Bacteria 1410
198 Ga0495593_0036902 3300047673 Bacteria 2647
199 Ga0495602_0004249 3300048088 Bacteria 14908
200 Ga0495614_0104094 3300048089 Bacteria 1243
201 Ga0496100_0515294 3300048903 Bacteria 923
202 Ga0496105_0339390 3300048908 Bacteria 1202
203 Ga0496106_0016547 3300048909 Bacteria 5456
204 Ga0496107_0025590 3300048910 Bacteria 4179
205 Ga0496108_0062772 3300048911 Bacteria 3128
206 Ga0496112_0064908 3300048915 Bacteria 3603
207 Ga0496117_0211239 3300048920 Bacteria 1088
208 Ga0496118_0001822 3300048921 Bacteria 30624
209 Ga0496121_0000707 3300048924 Bacteria 62128
210 Ga0496124_0009690 3300048927 Bacteria 9862
211 Ga0496126_0009966 3300048929 Bacteria 10034
212 Ga0496126_0013247 3300048929 Bacteria 8407
213 Ga0501032_0511911 3300049569 Bacteria 767
214 Ga0501047_0010684 3300049581 Bacteria 8676
215 Ga0501070_0027622 3300049586 Bacteria 4760
216 Ga0501073_0185439 3300049589 Bacteria 1440
217 Ga0501074_0051571 3300049590 Bacteria 2969
218 Ga0501080_0311535 3300049742 Bacteria 1426
219 nmdc:mga04h51_78091_c1 3300050495 Bacteria 1169
220 nmdc:mga08y16_120865_c1 3300050511 Bacteria 2726
221 nmdc:mga0n895_20767_c1 3300050512 Bacteria 6132
222 nmdc:mga0a205_4364_c1 3300050515 Bacteria 12685
223 Ga0495601_0298456 3300053077 Bacteria 1050
224 Ga0495612_0035868 3300053078 Bacteria 2011
225 Ga0495619_0056468 3300053085 Bacteria 2603
226 Ga0500650_0133484 3300053098 Bacteria 1153
227 Ga0500572_001810 3300053111 Bacteria 5462
228 Ga0500559_0000491 3300053136 Bacteria 27718
229 Ga0500590_091829 3300053148 Bacteria 1473
230 Ga0500639_021707 3300053163 Bacteria 3393
231 Ga0500636_0232659 3300053177 Bacteria 952
232 Ga0500596_000662 3300053735 Bacteria 6663
233 Ga0500596_002498 3300053735 Bacteria 3626
234 Ga0466962_0048926 3300061719 Bacteria 2020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_1543617 Ga0373937_1543617_48_593 181
2 3300041456 Ga0451795_1092371 Ga0451795_1092371_81_659 191
3 3300037853 Ga0436364_0636714 Ga0436364_0636714_3462_4109 215
4 3300046689 Ga0495613_0202059 Ga0495613_0202059_67_735 217
5 3300003323 rootH1_10095701 rootH1_100957014 219
6 3300003323 rootH1_10402525 rootH1_104025252 219
7 3300005327 Ga0070658_10158777 Ga0070658_101587774 219
8 3300005327 Ga0070658_10388234 Ga0070658_103882342 219
9 3300005336 Ga0070680_100210527 Ga0070680_1002105273 219
10 3300005336 Ga0070680_100339536 Ga0070680_1003395361 219
11 3300005341 Ga0070691_10086374 Ga0070691_100863741 219
12 3300005341 Ga0070691_10093195 Ga0070691_100931952 219
13 3300005434 Ga0070709_10019423 Ga0070709_100194232 219
14 3300005434 Ga0070709_10461184 Ga0070709_104611841 219
15 3300005435 Ga0070714_101096447 Ga0070714_1010964471 219
16 3300005436 Ga0070713_100010144 Ga0070713_1000101442 219
17 3300005436 Ga0070713_100018626 Ga0070713_1000186263 219
18 3300005436 Ga0070713_100051342 Ga0070713_1000513422 219
19 3300005437 Ga0070710_10118392 Ga0070710_101183922 219
20 3300005439 Ga0070711_100162003 Ga0070711_1001620033 219
21 3300005445 Ga0070708_100054904 Ga0070708_1000549045 219
22 3300005458 Ga0070681_10080032 Ga0070681_100800322 219
23 3300005468 Ga0070707_100575401 Ga0070707_1005754012 219
24 3300005471 Ga0070698_100178134 Ga0070698_1001781343 219
25 3300005518 Ga0070699_100376816 Ga0070699_1003768163 219
26 3300005530 Ga0070679_100022175 Ga0070679_1000221754 219
27 3300005530 Ga0070679_100034280 Ga0070679_1000342805 219
28 3300005530 Ga0070679_100054934 Ga0070679_1000549342 219
29 3300005535 Ga0070684_100220239 Ga0070684_1002202392 219
30 3300005535 Ga0070684_101094273 Ga0070684_1010942731 219
31 3300005547 Ga0070693_100107515 Ga0070693_1001075152 219
32 3300005563 Ga0068855_100775089 Ga0068855_1007750892 219
33 3300005842 Ga0068858_100150025 Ga0068858_1001500254 219
34 3300005844 Ga0068862_100512029 Ga0068862_1005120291 219
35 3300005937 Ga0081455_10000816 Ga0081455_1000081622 219
36 3300006028 Ga0070717_10045129 Ga0070717_100451294 219
37 3300006028 Ga0070717_10613893 Ga0070717_106138931 219
38 3300006058 Ga0075432_10058033 Ga0075432_100580332 219
39 3300006173 Ga0070716_100224127 Ga0070716_1002241272 219
40 3300006173 Ga0070716_100391731 Ga0070716_1003917312 219
41 3300006175 Ga0070712_100816127 Ga0070712_1008161271 219
42 3300006178 Ga0075367_10378642 Ga0075367_103786422 219
43 3300006871 Ga0075434_100001873 Ga0075434_10000187310 219
44 3300007076 Ga0075435_100181074 Ga0075435_1001810743 219
45 3300009093 Ga0105240_10011273 Ga0105240_100112732 219
46 3300009093 Ga0105240_10265346 Ga0105240_102653462 219
47 3300009094 Ga0111539_10048412 Ga0111539_100484124 219
48 3300009101 Ga0105247_10005003 Ga0105247_100050031 219
49 3300009551 Ga0105238_10016778 Ga0105238_100167785 219
50 3300009551 Ga0105238_10592533 Ga0105238_105925332 219
51 3300009551 Ga0105238_10647183 Ga0105238_106471831 219
52 3300009551 Ga0105238_11120796 Ga0105238_111207962 219
53 3300010159 Ga0099796_10004502 Ga0099796_100045025 219
54 3300010375 Ga0105239_10117856 Ga0105239_101178564 219
55 3300013102 Ga0157371_10053988 Ga0157371_100539883 219
56 3300013104 Ga0157370_10120641 Ga0157370_101206412 219
57 3300013105 Ga0157369_10012432 Ga0157369_100124329 219
58 3300013105 Ga0157369_10124908 Ga0157369_101249083 219
59 3300013105 Ga0157369_10411338 Ga0157369_104113382 219
60 3300013297 Ga0157378_11282177 Ga0157378_112821771 219
61 3300013307 Ga0157372_10056620 Ga0157372_100566205 219
62 3300014325 Ga0163163_10133397 Ga0163163_101333974 219
63 3300020081 Ga0206354_10184547 Ga0206354_101845471 219
64 3300021377 Ga0213874_10020243 Ga0213874_100202431 219
65 3300021384 Ga0213876_10003089 Ga0213876_100030897 219
66 3300021388 Ga0213875_10106519 Ga0213875_101065192 219
67 3300022467 Ga0224712_10133561 Ga0224712_101335612 219
68 3300025297 Ga0209758_1030775 Ga0209758_10307752 219
69 3300025898 Ga0207692_10063800 Ga0207692_100638002 219
70 3300025898 Ga0207692_10296257 Ga0207692_102962572 219
71 3300025900 Ga0207710_10194483 Ga0207710_101944831 219
72 3300025905 Ga0207685_10269377 Ga0207685_102693771 219
73 3300025906 Ga0207699_10026757 Ga0207699_100267571 219
74 3300025906 Ga0207699_10033072 Ga0207699_100330724 219
75 3300025909 Ga0207705_10509664 Ga0207705_105096642 219
76 3300025913 Ga0207695_10029734 Ga0207695_100297347 219
77 3300025913 Ga0207695_10086026 Ga0207695_100860261 219
78 3300025917 Ga0207660_10242101 Ga0207660_102421012 219
79 3300025921 Ga0207652_10012401 Ga0207652_100124015 219
80 3300025922 Ga0207646_10464173 Ga0207646_104641732 219
81 3300025924 Ga0207694_10001326 Ga0207694_1000132610 219
82 3300025924 Ga0207694_10142225 Ga0207694_101422252 219
83 3300025924 Ga0207694_10419576 Ga0207694_104195762 219
84 3300025924 Ga0207694_10487532 Ga0207694_104875322 219
85 3300025928 Ga0207700_10038084 Ga0207700_100380843 219
86 3300025939 Ga0207665_10143847 Ga0207665_101438472 219
87 3300025939 Ga0207665_10215713 Ga0207665_102157132 219
88 3300025941 Ga0207711_10706437 Ga0207711_107064372 219
89 3300025949 Ga0207667_10075239 Ga0207667_100752394 219
90 3300025981 Ga0207640_10773214 Ga0207640_107732141 219
91 3300026041 Ga0207639_10807828 Ga0207639_108078282 219
92 3300026142 Ga0207698_10024283 Ga0207698_100242834 219
93 3300027866 Ga0209813_10065569 Ga0209813_100655692 219
94 3300028381 Ga0268264_10475985 Ga0268264_104759852 219
95 3300028381 Ga0268264_10742233 Ga0268264_107422332 219
96 3300028558 Ga0265326_10006064 Ga0265326_100060644 219
97 3300028563 Ga0265319_1011902 Ga0265319_10119021 219
98 3300028573 Ga0265334_10002814 Ga0265334_100028148 219
99 3300028577 Ga0265318_10003710 Ga0265318_100037102 219
100 3300028653 Ga0265323_10001095 Ga0265323_100010958 219
101 3300028666 Ga0265336_10000233 Ga0265336_1000023321 219
102 3300028800 Ga0265338_10000090 Ga0265338_1000009039 219
103 3300030521 Ga0307511_10059249 Ga0307511_100592493 219
104 3300031239 Ga0265328_10005461 Ga0265328_100054612 219
105 3300031250 Ga0265331_10003411 Ga0265331_1000341110 219
106 3300031251 Ga0265327_10053737 Ga0265327_100537371 219
107 3300031251 Ga0265327_10092587 Ga0265327_100925873 219
108 3300031344 Ga0265316_10044551 Ga0265316_100445514 219
109 3300031507 Ga0307509_10021121 Ga0307509_100211215 219
110 3300031616 Ga0307508_10000532 Ga0307508_100005326 219
111 3300031730 Ga0307516_10024016 Ga0307516_100240162 219
112 3300031730 Ga0307516_10275820 Ga0307516_102758202 219
113 3300033179 Ga0307507_10058583 Ga0307507_100585833 219
114 3300033544 Ga0316215_1007711 Ga0316215_10077112 219
115 3300034957 Ga0373938_0006313 Ga0373938_0006313_691_1350 219
116 3300035083 Ga0373926_0026704 Ga0373926_0026704_1123_1782 219
117 3300035084 Ga0373928_0080043 Ga0373928_0080043_109_768 219
118 3300035086 Ga0373934_0093931 Ga0373934_0093931_380_1039 219
119 3300035089 Ga0373944_0011227 Ga0373944_0011227_1159_1818 219
120 3300035090 Ga0373949_0041841 Ga0373949_0041841_126_785 219
121 3300035111 Ga0373923_0054055 Ga0373923_0054055_599_1258 219
122 3300035113 Ga0373936_0024234 Ga0373936_0024234_1081_1740 219
123 3300035114 Ga0373939_0036873 Ga0373939_0036873_294_953 219
124 3300035116 Ga0373945_0145014 Ga0373945_0145014_49_708 219
125 3300035118 Ga0373954_0235372 Ga0373954_0235372_15_674 219
126 3300035119 Ga0373956_0317908 Ga0373956_0317908_15_674 219
127 3300035171 Ga0373946_0040415 Ga0373946_0040415_674_1333 219
128 3300035172 Ga0373955_0059362 Ga0373955_0059362_1073_1732 219
129 3300035172 Ga0373955_0126784 Ga0373955_0126784_66_725 219
130 3300035241 Ga0373961_0028319 Ga0373961_0028319_296_955 219
131 3300035242 Ga0373962_0014428 Ga0373962_0014428_378_1037 219
132 3300035410 Ga0373924_0235678 Ga0373924_0235678_114_773 219
133 3300035691 Ga0373931_0038432 Ga0373931_0038432_856_1515 219
134 3300035695 Ga0373927_0046294 Ga0373927_0046294_1104_1763 219
135 3300035695 Ga0373927_0082798 Ga0373927_0082798_1132_1791 219
136 3300035695 Ga0373927_0129429 Ga0373927_0129429_205_864 219
137 3300035695 Ga0373927_0204158 Ga0373927_0204158_133_792 219
138 3300035724 Ga0373933_0095706 Ga0373933_0095706_366_1025 219
139 3300035725 Ga0373947_0061633 Ga0373947_0061633_994_1653 219
140 3300035725 Ga0373947_0065320 Ga0373947_0065320_829_1488 219
141 3300035725 Ga0373947_0506496 Ga0373947_0506496_49_708 219
142 3300036401 Ga0373937_0370153 Ga0373937_0370153_423_1082 219
143 3300036401 Ga0373937_0550597 Ga0373937_0550597_11_670 219
144 3300036459 Ga0372808_013027 Ga0372808_013027_272_931 219
145 3300037068 Ga0373925_0051869 Ga0373925_0051869_735_1394 219
146 3300037068 Ga0373925_0098092 Ga0373925_0098092_162_821 219
147 3300037418 Ga0395900_0018508 Ga0395900_0018508_1088_1747 219
148 3300037466 Ga0395898_0348509 Ga0395898_0348509_687_1346 219
149 3300037471 Ga0395905_1097638 Ga0395905_1097638_10_669 219
150 3300037853 Ga0436364_0945662 Ga0436364_0945662_597_1256 219
151 3300037853 Ga0436364_1406908 Ga0436364_1406908_93_755 219
152 3300039437 Ga0436365_0675790 Ga0436365_0675790_4407_5066 219
153 3300039438 Ga0436360_1259193 Ga0436360_1259193_207_866 219
154 3300039450 Ga0436363_0297222 Ga0436363_0297222_100_759 219
155 3300039453 Ga0436362_0381540 Ga0436362_0381540_2461_3120 219
156 3300041443 Ga0451789_0085209 Ga0451789_0085209_93_764 219
157 3300044684 Ga0466966_0025192 Ga0466966_0025192_2614_3285 219
158 3300044693 Ga0466961_0055681 Ga0466961_0055681_382_1041 219
159 3300044694 Ga0466963_0018885 Ga0466963_0018885_223_882 219
160 3300044719 Ga0466971_0023985 Ga0466971_0023985_1955_2614 219
161 3300045049 Ga0466959_0011820 Ga0466959_0011820_2907_3578 219
162 3300045049 Ga0466959_0029891 Ga0466959_0029891_1291_1950 219
163 3300045976 Ga0466967_0788031 Ga0466967_0788031_92_751 219
164 3300046454 Ga0495592_0156511 Ga0495592_0156511_854_1513 219
165 3300046455 Ga0495603_0149482 Ga0495603_0149482_273_938 219
166 3300046459 Ga0495629_0155657 Ga0495629_0155657_168_827 219
167 3300046463 Ga0495653_0027894 Ga0495653_0027894_243_902 219
168 3300046472 Ga0495580_0063201 Ga0495580_0063201_262_921 219
169 3300046472 Ga0495580_0233855 Ga0495580_0233855_289_948 219
170 3300046473 Ga0495582_0160925 Ga0495582_0160925_366_1025 219
171 3300046475 Ga0495639_0044717 Ga0495639_0044717_725_1384 219
172 3300046475 Ga0495639_0118535 Ga0495639_0118535_222_881 219
173 3300046476 Ga0495662_0028254 Ga0495662_0028254_1228_1887 219
174 3300046477 Ga0495664_0176367 Ga0495664_0176367_391_1050 219
175 3300046477 Ga0495664_0243202 Ga0495664_0243202_378_1037 219
176 3300046511 Ga0495608_0234005 Ga0495608_0234005_145_804 219
177 3300046516 Ga0495628_0052069 Ga0495628_0052069_2284_2943 219
178 3300046516 Ga0495628_0088857 Ga0495628_0088857_1068_1727 219
179 3300046517 Ga0495630_0063778 Ga0495630_0063778_1197_1856 219
180 3300046531 Ga0495665_0040529 Ga0495665_0040529_1197_1856 219
181 3300046533 Ga0495640_0089497 Ga0495640_0089497_209_868 219
182 3300046543 Ga0495645_0097474 Ga0495645_0097474_1099_1758 219
183 3300046559 Ga0495667_0086135 Ga0495667_0086135_1270_1929 219
184 3300046660 Ga0495625_0019567 Ga0495625_0019567_280_945 219
185 3300046663 Ga0495635_0357644 Ga0495635_0357644_276_935 219
186 3300046674 Ga0495588_0049360 Ga0495588_0049360_883_1542 219
187 3300046678 Ga0495599_0143439 Ga0495599_0143439_336_995 219
188 3300046683 Ga0495658_0244451 Ga0495658_0244451_411_1070 219
189 3300046690 Ga0495624_0105137 Ga0495624_0105137_25_684 219
190 3300047315 Ga0495581_0062350 Ga0495581_0062350_968_1627 219
191 3300047315 Ga0495581_0328931 Ga0495581_0328931_185_844 219
192 3300047317 Ga0495604_0124294 Ga0495604_0124294_388_1047 219
193 3300047319 Ga0495674_0008725 Ga0495674_0008725_7098_7757 219
194 3300047319 Ga0495674_0428121 Ga0495674_0428121_114_773 219
195 3300047321 Ga0495676_0364502 Ga0495676_0364502_259_918 219
196 3300047471 Ga0495684_0146055 Ga0495684_0146055_235_894 219
197 3300047471 Ga0495684_0215395 Ga0495684_0215395_552_1211 219
198 3300047673 Ga0495593_0036902 Ga0495593_0036902_439_1098 219
199 3300048088 Ga0495602_0004249 Ga0495602_0004249_1933_2592 219
200 3300048089 Ga0495614_0104094 Ga0495614_0104094_465_1124 219
201 3300048903 Ga0496100_0515294 Ga0496100_0515294_32_691 219
202 3300048908 Ga0496105_0339390 Ga0496105_0339390_194_853 219
203 3300048909 Ga0496106_0016547 Ga0496106_0016547_4310_4969 219
204 3300048910 Ga0496107_0025590 Ga0496107_0025590_1431_2090 219
205 3300048911 Ga0496108_0062772 Ga0496108_0062772_84_743 219
206 3300048915 Ga0496112_0064908 Ga0496112_0064908_360_1019 219
207 3300048920 Ga0496117_0211239 Ga0496117_0211239_298_957 219
208 3300048921 Ga0496118_0001822 Ga0496118_0001822_14043_14702 219
209 3300048924 Ga0496121_0000707 Ga0496121_0000707_1043_1702 219
210 3300048927 Ga0496124_0009690 Ga0496124_0009690_4301_4960 219
211 3300048929 Ga0496126_0009966 Ga0496126_0009966_4961_5620 219
212 3300048929 Ga0496126_0013247 Ga0496126_0013247_2014_2673 219
213 3300049569 Ga0501032_0511911 Ga0501032_0511911_31_696 219
214 3300049581 Ga0501047_0010684 Ga0501047_0010684_2800_3459 219
215 3300049586 Ga0501070_0027622 Ga0501070_0027622_2906_3565 219
216 3300049589 Ga0501073_0185439 Ga0501073_0185439_228_887 219
217 3300049590 Ga0501074_0051571 Ga0501074_0051571_1478_2137 219
218 3300049742 Ga0501080_0311535 Ga0501080_0311535_77_736 219
219 3300050495 nmdc:mga04h51_78091_c1 nmdc:mga04h51_78091_c1_69_728 219
220 3300050511 nmdc:mga08y16_120865_c1 nmdc:mga08y16_120865_c1_895_1554 219
221 3300050512 nmdc:mga0n895_20767_c1 nmdc:mga0n895_20767_c1_4293_4952 219
222 3300050515 nmdc:mga0a205_4364_c1 nmdc:mga0a205_4364_c1_1556_2215 219
223 3300053077 Ga0495601_0298456 Ga0495601_0298456_217_876 219
224 3300053078 Ga0495612_0035868 Ga0495612_0035868_119_778 219
225 3300053085 Ga0495619_0056468 Ga0495619_0056468_1265_1924 219
226 3300053098 Ga0500650_0133484 Ga0500650_0133484_91_768 219
227 3300053111 Ga0500572_001810 Ga0500572_001810_2374_3033 219
228 3300053136 Ga0500559_0000491 Ga0500559_0000491_14431_15090 219
229 3300053148 Ga0500590_091829 Ga0500590_091829_196_855 219
230 3300053163 Ga0500639_021707 Ga0500639_021707_1266_1925 219
231 3300053177 Ga0500636_0232659 Ga0500636_0232659_53_712 219
232 3300053735 Ga0500596_000662 Ga0500596_000662_821_1480 219
233 3300053735 Ga0500596_002498 Ga0500596_002498_1346_2005 219
234 3300061719 Ga0466962_0048926 Ga0466962_0048926_194_853 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

75

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

11

76

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

81

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

129

197

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

109

202

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

125

207

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a4u-assembly1.cif.gz_A atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde 0.9026 2 208
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.9021 4 212
7odm-assembly1.cif.gz_AAA-2 amgstf1 y118s variant 0.8971 2 212
7obo-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.897 2 212
6zb6-assembly1.cif.gz_A crystal structure of lolium rigidum gstf in complex with s-(p-nitrobenzyl) glutathione 0.8961 1 212
ID Description Score Start End Superfamily
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.968 7 79 3.40.30.10
af_Q5ZCX6_5_69_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 6 65 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9594 4 80 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9569 7 78 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9505 3 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537QUM8-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.982 1 207 GO:0004364
GO:0005737
GO:0043295
AF-A0A150RKZ4-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9805 1 182 GO:0004364
GO:0005737
GO:0043295
AF-A0A3S0ED57-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.98 1 219 GO:0004364
GO:0005737
GO:0043295
AF-A0A0N0JTA3-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9787 1 214 GO:0004364
GO:0005737
GO:0043295
AF-A0A4Q2U908-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9757 1 215 GO:0004364
GO:0005737
GO:0043295

Feature Viewer

pLDDT pTM Quality
95.44 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map