F347306

General Info

Members Datasets Scaffolds Average Seq Length
234 162 210 121

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0199662|Ga0436364_0199662_937_1359
Length 140
Sequence VAGLSNEQLATEPKGGKTTMTQQKTGFDFEALRRGVEQLDADVLISLYADDAELRIVNRYTTPSSPRELRGKEEITEYLRDVCGRAMTHRIENEVVGAERVAFNEACKYPDGTRVLCAATLEVREGKISRQVNVEAWDEQ

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
5 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
6 2808606448 Streptomyces sp. 193411 Isolate Unclassified
7 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
8 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
9 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
10 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
11 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
12 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
13 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
14 2867428634 Streptomyces sp. RP5T Isolate Unclassified
15 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
16 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
17 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
18 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
19 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
20 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
21 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
22 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
54 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
55 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
56 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
63 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
64 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
160 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
161 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
162 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.18
Metatranscriptomes 2.14
Isolates 10.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0.85
Rhizoplane 3.42
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 14.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1069166 3300003308 Bacteria 609
2 rootH1_10005029 3300003316 Bacteria 23039
3 rootH1_10016338 3300003316 Bacteria 1598
4 rootH1_10016338 3300003323 Unclassified 4934
5 rootL2_10054571 3300003322 Bacteria 2861
6 rootL2_10185719 3300003322 Bacteria 1207
7 rootH1_10038652 3300003323 Bacteria 3429
8 rootH1_10108163 3300003323 Bacteria 1880
9 Ga0007427J51700_104909 3300003559 Bacteria 1469
10 Ga0007429J51699_1029732 3300003579 Bacteria 925
11 Ga0075363_100041780 3300006048 Bacteria 2419
12 Ga0075363_100198116 3300006048 Bacteria 1147
13 Ga0075370_10903484 3300006353 Bacteria 540
14 Ga0105250_10276231 3300009092 Bacteria 722
15 Ga0157375_11564574 3300013308 Unclassified 779
16 Ga0183367_1004 3300015688 Bacteria 716880
17 Ga0206350_11626542 3300020080 Bacteria 504
18 Ga0213875_10011281 3300021388 Bacteria 4451
19 Ga0213875_10299399 3300021388 Unclassified 761
20 Ga0307515_10152684 3300028794 Bacteria 2404
21 Ga0307511_10055606 3300030521 Bacteria 3105
22 Ga0307512_10051724 3300030522 Bacteria 3283
23 Ga0316180_1184525 3300030736 Unclassified 508
24 Ga0307513_10953358 3300031456 Bacteria 566
25 Ga0307408_101728139 3300031548 Bacteria 597
26 Ga0307408_101728492 3300031548 Bacteria 597
27 Ga0307508_10102841 3300031616 Bacteria 2453
28 Ga0307514_10038801 3300031649 Bacteria 3764
29 Ga0307514_10196386 3300031649 Bacteria 1276
30 Ga0307409_100734544 3300031995 Bacteria 990
31 Ga0307409_101427637 3300031995 Bacteria 719
32 Ga0307416_102669298 3300032002 Unclassified 596
33 Ga0307415_100302592 3300032126 Bacteria 1325
34 Ga0373937_1149459 3300036401 Bacteria 725
35 Ga0395900_0544348 3300037418 Bacteria 1106
36 Ga0395898_0001353 3300037466 Bacteria 35343
37 Ga0395905_0382845 3300037471 Bacteria 1301
38 Ga0436364_0178471 3300037853 Unclassified 2400
39 Ga0436364_0199662 3300037853 Bacteria 1681
40 Ga0436364_1371666 3300037853 Bacteria 1155
41 Ga0436364_1457976 3300037853 Bacteria 36311
42 Ga0439436_0003385 3300041404 Bacteria 4835
43 Ga0439439_0008356 3300041406 Bacteria 2444
44 Ga0451791_0839871 3300041451 Bacteria 1088
45 Ga0451797_1343887 3300041453 Bacteria 1258
46 Ga0451802_0675412 3300041460 Bacteria 1136
47 Ga0451843_0843053 3300041509 Bacteria 1138
48 Ga0451853_0762338 3300041512 Bacteria 3638
49 Ga0451853_1767468 3300041512 Bacteria 2668
50 Ga0451853_3726170 3300041512 Bacteria 2656
51 Ga0439442_014681 3300042002 Bacteria 1613
52 Ga0439442_055185 3300042002 Bacteria 840
53 Ga0439449_0024796 3300042007 Bacteria 2242
54 Ga0439449_0035582 3300042007 Bacteria 1853
55 Ga0439449_0068539 3300042007 Bacteria 1308
56 Ga0439457_006648 3300042014 Bacteria 2814
57 Ga0439457_120238 3300042014 Bacteria 620
58 Ga0450894_000536 3300042131 Bacteria 6430
59 Ga0450895_005925 3300042132 Bacteria 991
60 Ga0450898_000362 3300042134 Bacteria 5197
61 Ga0450899_013451 3300042135 Bacteria 924
62 Ga0439458_0018768 3300042157 Bacteria 1587
63 Ga0450908_001788 3300042184 Bacteria 4195
64 Ga0466972_0034725 3300044658 Bacteria 2469
65 Ga0466972_0317373 3300044658 Bacteria 728
66 Ga0466963_0612344 3300044694 Bacteria 769
67 Ga0466971_0028261 3300044719 Bacteria 2510
68 Ga0466959_0982384 3300045049 Unclassified 562
69 Ga0466958_0716446 3300045836 Bacteria 652
70 Ga0466967_0165663 3300045976 Bacteria 2077
71 Ga0466967_2227487 3300045976 Bacteria 544
72 Ga0495617_059224 3300046452 Bacteria 1268
73 Ga0495592_0009684 3300046454 Bacteria 7253
74 Ga0495603_0015772 3300046455 Bacteria 4568
75 Ga0495603_0023558 3300046455 Bacteria 3723
76 Ga0495603_0027211 3300046455 Bacteria 3452
77 Ga0495590_0118128 3300046457 Bacteria 949
78 Ga0495629_0017892 3300046459 Bacteria 5079
79 Ga0495629_0104536 3300046459 Bacteria 1975
80 Ga0495629_0122255 3300046459 Bacteria 1813
81 Ga0495638_0098281 3300046460 Bacteria 1754
82 Ga0495638_0275158 3300046460 Bacteria 917
83 Ga0495651_0032841 3300046462 Bacteria 4048
84 Ga0495580_0047003 3300046472 Bacteria 3061
85 Ga0495582_0084637 3300046473 Bacteria 1763
86 Ga0495605_0002415 3300046474 Bacteria 11546
87 Ga0495605_0050614 3300046474 Bacteria 2026
88 Ga0495639_0004345 3300046475 Bacteria 6079
89 Ga0495639_0707493 3300046475 Bacteria 520
90 Ga0495662_0003724 3300046476 Bacteria 7679
91 Ga0495662_0046934 3300046476 Bacteria 2085
92 Ga0495662_0163897 3300046476 Bacteria 1095
93 Ga0495585_0147533 3300046492 Bacteria 1228
94 Ga0495594_0042016 3300046499 Bacteria 2503
95 Ga0495594_0050142 3300046499 Bacteria 2295
96 Ga0495596_0079242 3300046500 Bacteria 1275
97 Ga0495607_0030528 3300046501 Bacteria 3307
98 Ga0495583_0039117 3300046506 Bacteria 2236
99 Ga0495583_0042243 3300046506 Bacteria 2130
100 Ga0495583_0079009 3300046506 Bacteria 1432
101 Ga0495606_0019299 3300046507 Bacteria 5077
102 Ga0495608_0283720 3300046511 Bacteria 1027
103 Ga0495610_0060146 3300046512 Bacteria 1810
104 Ga0495616_0005693 3300046513 Bacteria 7634
105 Ga0495618_0105712 3300046514 Bacteria 1802
106 Ga0495620_0006602 3300046515 Bacteria 6361
107 Ga0495620_0039702 3300046515 Bacteria 2077
108 Ga0495630_0066728 3300046517 Bacteria 2705
109 Ga0495630_0688739 3300046517 Bacteria 782
110 Ga0495630_1401397 3300046517 Unclassified 526
111 Ga0495637_0160312 3300046520 Bacteria 844
112 Ga0495643_0001303 3300046522 Bacteria 23710
113 Ga0495644_0209539 3300046523 Bacteria 752
114 Ga0495648_0098210 3300046524 Bacteria 1622
115 Ga0495648_0479746 3300046524 Bacteria 537
116 Ga0495666_0040781 3300046526 Bacteria 2250
117 Ga0495642_0191293 3300046528 Bacteria 891
118 Ga0495652_0082223 3300046529 Bacteria 2655
119 Ga0495654_0381213 3300046530 Bacteria 562
120 Ga0495640_0045627 3300046533 Bacteria 3040
121 Ga0495609_0124816 3300046538 Bacteria 1105
122 Ga0495597_0011458 3300046542 Bacteria 4298
123 Ga0495597_0041398 3300046542 Bacteria 2058
124 Ga0495622_0011638 3300046557 Bacteria 4066
125 Ga0495633_0118288 3300046558 Bacteria 1227
126 Ga0495667_0144760 3300046559 Bacteria 1531
127 Ga0495656_0424490 3300046615 Bacteria 698
128 Ga0495668_0010603 3300046616 Bacteria 5567
129 Ga0495634_0852105 3300046642 Bacteria 517
130 Ga0495611_0246488 3300046648 Bacteria 828
131 Ga0495611_0333095 3300046648 Bacteria 697
132 Ga0495625_0028367 3300046660 Bacteria 4198
133 Ga0495625_0042284 3300046660 Bacteria 3313
134 Ga0495625_0059250 3300046660 Bacteria 2717
135 Ga0495625_0083704 3300046660 Bacteria 2217
136 Ga0495635_0120516 3300046663 Bacteria 1789
137 Ga0495661_0060976 3300046665 Bacteria 2240
138 Ga0495588_0003126 3300046674 Bacteria 7161
139 Ga0495657_0038961 3300046675 Bacteria 3267
140 Ga0495657_0045547 3300046675 Bacteria 2976
141 Ga0495599_0178688 3300046678 Bacteria 1309
142 Ga0495613_0005827 3300046689 Bacteria 9223
143 Ga0495613_0011309 3300046689 Bacteria 6629
144 Ga0495613_0040041 3300046689 Bacteria 3473
145 Ga0495613_0040895 3300046689 Bacteria 3433
146 Ga0495670_0229958 3300046691 Bacteria 986
147 Ga0495649_0160541 3300046694 Bacteria 1178
148 Ga0495649_0299744 3300046694 Bacteria 818
149 Ga0495589_0013197 3300046794 Bacteria 4264
150 Ga0495589_0078007 3300046794 Bacteria 1613
151 Ga0495589_0131234 3300046794 Bacteria 1203
152 Ga0495589_0143528 3300046794 Bacteria 1142
153 Ga0495589_0210176 3300046794 Bacteria 916
154 Ga0495600_0203733 3300046809 Bacteria 1270
155 Ga0495660_0040641 3300046810 Bacteria 2576
156 Ga0495660_0058701 3300046810 Bacteria 2071
157 Ga0495581_0023796 3300047315 Bacteria 3549
158 Ga0495581_0061513 3300047315 Bacteria 2170
159 Ga0495581_0062980 3300047315 Bacteria 2143
160 Ga0495604_0055902 3300047317 Bacteria 3040
161 Ga0495636_0000910 3300047318 Bacteria 11010
162 Ga0495636_0001271 3300047318 Bacteria 9563
163 Ga0495636_0006511 3300047318 Bacteria 4592
164 Ga0495636_0027122 3300047318 Bacteria 2333
165 Ga0495636_0169925 3300047318 Bacteria 985
166 Ga0495672_0230864 3300047320 Bacteria 908
167 Ga0495676_0033424 3300047321 Bacteria 4331
168 Ga0495680_0014939 3300047322 Bacteria 6709
169 Ga0495687_001922 3300047443 Bacteria 17816
170 Ga0495687_024764 3300047443 Bacteria 2847
171 Ga0495687_045097 3300047443 Bacteria 1911
172 Ga0495687_045742 3300047443 Bacteria 1893
173 Ga0495675_0021718 3300047444 Bacteria 4089
174 Ga0495675_0080410 3300047444 Bacteria 2053
175 Ga0495675_0364204 3300047444 Bacteria 848
176 Ga0495677_0048589 3300047445 Bacteria 1559
177 Ga0495685_000851 3300047447 Bacteria 9285
178 Ga0495685_022196 3300047447 Bacteria 2184
179 Ga0495685_024984 3300047447 Bacteria 2056
180 Ga0495685_055884 3300047447 Bacteria 1335
181 Ga0495685_060780 3300047447 Bacteria 1273
182 Ga0495685_133544 3300047447 Bacteria 811
183 Ga0495681_0029091 3300047470 Bacteria 2833
184 Ga0495686_0096830 3300047472 Bacteria 1785
185 Ga0495686_0099314 3300047472 Bacteria 1757
186 Ga0495593_0027409 3300047673 Bacteria 3137
187 Ga0495602_0070118 3300048088 Bacteria 3002
188 Ga0495614_0527273 3300048089 Bacteria 563
189 Ga0495626_0023817 3300048091 Bacteria 3009
190 Ga0496102_1225951 3300048905 Bacteria 670
191 Ga0496106_0431611 3300048909 Bacteria 1059
192 Ga0496108_0840532 3300048911 Bacteria 790
193 Ga0496109_0934110 3300048912 Bacteria 805
194 Ga0496109_1097236 3300048912 Bacteria 733
195 Ga0496121_0875564 3300048924 Bacteria 519
196 Ga0501305_075416 3300049161 Bacteria 599
197 Ga0495678_038331 3300049459 Bacteria 1940
198 Ga0495678_145318 3300049459 Bacteria 771
199 Ga0501033_0096072 3300049570 Bacteria 2165
200 Ga0501034_0041532 3300049571 Bacteria 4654
201 Ga0501070_0235937 3300049586 Bacteria 1498
202 Ga0501070_1513937 3300049586 Bacteria 507
203 Ga0501035_0073508 3300049822 Bacteria 3025
204 Ga0501035_0083140 3300049822 Bacteria 2825
205 Ga0501212_024692 3300049851 Bacteria 947
206 nmdc:mga03n38_32957_c1 3300050490 Bacteria 2200
207 nmdc:mga03n38_80909_c1 3300050490 Bacteria 1526
208 nmdc:mga0yw44_663436_c1 3300050492 Bacteria 709
209 nmdc:mga07m45_83966_c1 3300050496 Bacteria 1820
210 Ga0500600_0160294 3300053149 Bacteria 1107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2862281513 2862283799 112
2 3300021388 Ga0213875_10299399 Ga0213875_102993992 114
3 3300037853 Ga0436364_1371666 Ga0436364_1371666_208_555 114
4 3300003322 rootL2_10185719 rootL2_101857191 116
5 3300003323 rootH1_10108163 rootH1_101081633 116
6 3300006048 Ga0075363_100041780 Ga0075363_1000417804 116
7 3300015688 Ga0183367_1004 Ga0183367_1004647 116
8 3300036401 Ga0373937_1149459 Ga0373937_1149459_252_602 116
9 3300046517 Ga0495630_1401397 Ga0495630_1401397_78_428 116
10 3300049586 Ga0501070_0235937 Ga0501070_0235937_542_895 116
11 3300050490 nmdc:mga03n38_32957_c1 nmdc:mga03n38_32957_c1_1686_2039 116
12 3300050496 nmdc:mga07m45_83966_c1 nmdc:mga07m45_83966_c1_1439_1792 116
13 iso_pu_bacteria 2811994879 2812353834 116
14 iso_pu_bacteria 2852635781 2852639034 116
15 iso_pu_bacteria 2947224130 2947232742 116
16 3300049586 Ga0501070_1513937 Ga0501070_1513937_113_469 117
17 iso_pu_bacteria 2547132111 2547409364 117
18 iso_pu_bacteria 2582581314 2585312590 117
19 iso_pu_bacteria 2616644814 2616696426 117
20 iso_pu_bacteria 2784132148 2784592331 117
21 iso_pu_bacteria 2784746768 2785374050 117
22 iso_pu_bacteria 2808606448 2809235961 117
23 iso_pu_bacteria 2811994917 2812483095 117
24 iso_pu_bacteria 2862382967 2862387451 117
25 iso_pu_bacteria 2862507626 2862515873 117
26 iso_pu_bacteria 2863404153 2863410711 117
27 iso_pu_bacteria 2867428634 2867434807 117
28 iso_pu_bacteria 2877676314 2877677229 117
29 iso_pu_bacteria 2912715099 2912715558 117
30 iso_pu_bacteria 2946064051 2946071861 117
31 iso_pu_bacteria 2990059506 2990066805 117
32 iso_pu_bacteria 3006493962 3006499201 117
33 iso_pu_bacteria 8008558824 8008564747 117
34 iso_pu_bacteria 8008574985 8008575484 117
35 iso_pu_bacteria 8023623736 8023626614 117
36 iso_pu_bacteria 8056829672 8056834828 117
37 3300013308 Ga0157375_11564574 Ga0157375_115645741 118
38 3300021388 Ga0213875_10011281 Ga0213875_100112815 119
39 3300037853 Ga0436364_1457976 Ga0436364_1457976_10455_10817 119
40 3300049161 Ga0501305_075416 Ga0501305_075416_75_437 119
41 3300031548 Ga0307408_101728492 Ga0307408_1017284921 120
42 3300031995 Ga0307409_100734544 Ga0307409_1007345442 120
43 3300031995 Ga0307409_101427637 Ga0307409_1014276371 120
44 3300032002 Ga0307416_102669298 Ga0307416_1026692981 120
45 3300032126 Ga0307415_100302592 Ga0307415_1003025921 120
46 3300037853 Ga0436364_0199662 Ga0436364_0199662_937_1359 120
47 3300041404 Ga0439436_0003385 Ga0439436_0003385_2089_2451 120
48 3300041406 Ga0439439_0008356 Ga0439439_0008356_1347_1709 120
49 3300042002 Ga0439442_014681 Ga0439442_014681_141_503 120
50 3300042002 Ga0439442_055185 Ga0439442_055185_301_663 120
51 3300042007 Ga0439449_0024796 Ga0439449_0024796_384_746 120
52 3300042007 Ga0439449_0035582 Ga0439449_0035582_1246_1608 120
53 3300042007 Ga0439449_0068539 Ga0439449_0068539_905_1267 120
54 3300042014 Ga0439457_006648 Ga0439457_006648_474_836 120
55 3300046809 Ga0495600_0203733 Ga0495600_0203733_252_614 120
56 3300047444 Ga0495675_0021718 Ga0495675_0021718_672_1034 120
57 3300049571 Ga0501034_0041532 Ga0501034_0041532_3873_4235 120
58 3300049851 Ga0501212_024692 Ga0501212_024692_566_937 120
59 3300053149 Ga0500600_0160294 Ga0500600_0160294_484_846 120
60 iso_pu_bacteria 2954002825 2954009236 120
61 3300003316 rootH1_10016338 rootH1_100163384 121
62 3300006048 Ga0075363_100198116 Ga0075363_1001981162 121
63 3300006353 Ga0075370_10903484 Ga0075370_109034841 121
64 3300009092 Ga0105250_10276231 Ga0105250_102762311 121
65 3300020080 Ga0206350_11626542 Ga0206350_116265421 121
66 3300030521 Ga0307511_10055606 Ga0307511_100556062 121
67 3300030736 Ga0316180_1184525 Ga0316180_11845251 121
68 3300031548 Ga0307408_101728139 Ga0307408_1017281392 121
69 3300031616 Ga0307508_10102841 Ga0307508_101028413 121
70 3300037418 Ga0395900_0544348 Ga0395900_0544348_69_434 121
71 3300037466 Ga0395898_0001353 Ga0395898_0001353_27338_27703 121
72 3300037471 Ga0395905_0382845 Ga0395905_0382845_100_465 121
73 3300037853 Ga0436364_0178471 Ga0436364_0178471_1978_2343 121
74 3300041512 Ga0451853_0762338 Ga0451853_0762338_860_1225 121
75 3300042014 Ga0439457_120238 Ga0439457_120238_226_591 121
76 3300042131 Ga0450894_000536 Ga0450894_000536_1282_1647 121
77 3300042132 Ga0450895_005925 Ga0450895_005925_582_947 121
78 3300042134 Ga0450898_000362 Ga0450898_000362_1293_1658 121
79 3300042135 Ga0450899_013451 Ga0450899_013451_467_832 121
80 3300042157 Ga0439458_0018768 Ga0439458_0018768_575_943 121
81 3300042184 Ga0450908_001788 Ga0450908_001788_2704_3069 121
82 3300044658 Ga0466972_0034725 Ga0466972_0034725_885_1250 121
83 3300044694 Ga0466963_0612344 Ga0466963_0612344_357_743 121
84 3300044719 Ga0466971_0028261 Ga0466971_0028261_907_1272 121
85 3300045836 Ga0466958_0716446 Ga0466958_0716446_84_449 121
86 3300045976 Ga0466967_0165663 Ga0466967_0165663_428_814 121
87 3300045976 Ga0466967_2227487 Ga0466967_2227487_146_511 121
88 3300046452 Ga0495617_059224 Ga0495617_059224_323_688 121
89 3300046454 Ga0495592_0009684 Ga0495592_0009684_5043_5408 121
90 3300046455 Ga0495603_0015772 Ga0495603_0015772_3404_3769 121
91 3300046455 Ga0495603_0023558 Ga0495603_0023558_458_823 121
92 3300046455 Ga0495603_0027211 Ga0495603_0027211_1800_2165 121
93 3300046457 Ga0495590_0118128 Ga0495590_0118128_79_444 121
94 3300046459 Ga0495629_0017892 Ga0495629_0017892_682_1047 121
95 3300046459 Ga0495629_0104536 Ga0495629_0104536_771_1136 121
96 3300046459 Ga0495629_0122255 Ga0495629_0122255_907_1272 121
97 3300046460 Ga0495638_0098281 Ga0495638_0098281_883_1248 121
98 3300046460 Ga0495638_0275158 Ga0495638_0275158_248_613 121
99 3300046462 Ga0495651_0032841 Ga0495651_0032841_1286_1651 121
100 3300046472 Ga0495580_0047003 Ga0495580_0047003_835_1200 121
101 3300046473 Ga0495582_0084637 Ga0495582_0084637_513_878 121
102 3300046474 Ga0495605_0002415 Ga0495605_0002415_4400_4765 121
103 3300046474 Ga0495605_0050614 Ga0495605_0050614_1408_1773 121
104 3300046475 Ga0495639_0004345 Ga0495639_0004345_5513_5878 121
105 3300046475 Ga0495639_0707493 Ga0495639_0707493_56_421 121
106 3300046476 Ga0495662_0003724 Ga0495662_0003724_2574_2996 121
107 3300046476 Ga0495662_0046934 Ga0495662_0046934_997_1419 121
108 3300046476 Ga0495662_0163897 Ga0495662_0163897_323_688 121
109 3300046492 Ga0495585_0147533 Ga0495585_0147533_393_758 121
110 3300046499 Ga0495594_0042016 Ga0495594_0042016_1632_1997 121
111 3300046499 Ga0495594_0050142 Ga0495594_0050142_1853_2218 121
112 3300046500 Ga0495596_0079242 Ga0495596_0079242_815_1180 121
113 3300046501 Ga0495607_0030528 Ga0495607_0030528_960_1325 121
114 3300046506 Ga0495583_0039117 Ga0495583_0039117_917_1282 121
115 3300046506 Ga0495583_0042243 Ga0495583_0042243_1237_1602 121
116 3300046506 Ga0495583_0079009 Ga0495583_0079009_546_911 121
117 3300046507 Ga0495606_0019299 Ga0495606_0019299_4468_4833 121
118 3300046511 Ga0495608_0283720 Ga0495608_0283720_394_759 121
119 3300046512 Ga0495610_0060146 Ga0495610_0060146_635_1000 121
120 3300046513 Ga0495616_0005693 Ga0495616_0005693_2991_3356 121
121 3300046514 Ga0495618_0105712 Ga0495618_0105712_1080_1445 121
122 3300046515 Ga0495620_0006602 Ga0495620_0006602_5031_5396 121
123 3300046515 Ga0495620_0039702 Ga0495620_0039702_1635_2000 121
124 3300046517 Ga0495630_0066728 Ga0495630_0066728_251_616 121
125 3300046517 Ga0495630_0688739 Ga0495630_0688739_176_541 121
126 3300046520 Ga0495637_0160312 Ga0495637_0160312_323_688 121
127 3300046522 Ga0495643_0001303 Ga0495643_0001303_2850_3215 121
128 3300046523 Ga0495644_0209539 Ga0495644_0209539_63_428 121
129 3300046524 Ga0495648_0098210 Ga0495648_0098210_701_1066 121
130 3300046524 Ga0495648_0479746 Ga0495648_0479746_69_434 121
131 3300046526 Ga0495666_0040781 Ga0495666_0040781_332_697 121
132 3300046528 Ga0495642_0191293 Ga0495642_0191293_450_815 121
133 3300046529 Ga0495652_0082223 Ga0495652_0082223_2169_2534 121
134 3300046530 Ga0495654_0381213 Ga0495654_0381213_112_477 121
135 3300046533 Ga0495640_0045627 Ga0495640_0045627_2353_2718 121
136 3300046538 Ga0495609_0124816 Ga0495609_0124816_215_580 121
137 3300046542 Ga0495597_0011458 Ga0495597_0011458_2929_3294 121
138 3300046542 Ga0495597_0041398 Ga0495597_0041398_129_494 121
139 3300046557 Ga0495622_0011638 Ga0495622_0011638_481_846 121
140 3300046558 Ga0495633_0118288 Ga0495633_0118288_625_990 121
141 3300046559 Ga0495667_0144760 Ga0495667_0144760_687_1052 121
142 3300046615 Ga0495656_0424490 Ga0495656_0424490_230_595 121
143 3300046616 Ga0495668_0010603 Ga0495668_0010603_4414_4779 121
144 3300046642 Ga0495634_0852105 Ga0495634_0852105_123_488 121
145 3300046648 Ga0495611_0246488 Ga0495611_0246488_66_431 121
146 3300046648 Ga0495611_0333095 Ga0495611_0333095_301_666 121
147 3300046660 Ga0495625_0028367 Ga0495625_0028367_3638_4003 121
148 3300046660 Ga0495625_0059250 Ga0495625_0059250_381_746 121
149 3300046660 Ga0495625_0083704 Ga0495625_0083704_659_1024 121
150 3300046663 Ga0495635_0120516 Ga0495635_0120516_24_389 121
151 3300046665 Ga0495661_0060976 Ga0495661_0060976_1150_1515 121
152 3300046674 Ga0495588_0003126 Ga0495588_0003126_2540_2905 121
153 3300046675 Ga0495657_0038961 Ga0495657_0038961_2274_2696 121
154 3300046675 Ga0495657_0045547 Ga0495657_0045547_1782_2147 121
155 3300046678 Ga0495599_0178688 Ga0495599_0178688_276_641 121
156 3300046689 Ga0495613_0005827 Ga0495613_0005827_5520_5942 121
157 3300046689 Ga0495613_0011309 Ga0495613_0011309_4247_4612 121
158 3300046689 Ga0495613_0040041 Ga0495613_0040041_1837_2205 121
159 3300046689 Ga0495613_0040895 Ga0495613_0040895_2855_3220 121
160 3300046691 Ga0495670_0229958 Ga0495670_0229958_538_903 121
161 3300046694 Ga0495649_0160541 Ga0495649_0160541_802_1167 121
162 3300046694 Ga0495649_0299744 Ga0495649_0299744_307_672 121
163 3300046794 Ga0495589_0013197 Ga0495589_0013197_2153_2518 121
164 3300046794 Ga0495589_0078007 Ga0495589_0078007_288_653 121
165 3300046794 Ga0495589_0131234 Ga0495589_0131234_252_617 121
166 3300046794 Ga0495589_0143528 Ga0495589_0143528_686_1051 121
167 3300046794 Ga0495589_0210176 Ga0495589_0210176_33_398 121
168 3300046810 Ga0495660_0040641 Ga0495660_0040641_770_1135 121
169 3300046810 Ga0495660_0058701 Ga0495660_0058701_438_803 121
170 3300047315 Ga0495581_0023796 Ga0495581_0023796_757_1122 121
171 3300047315 Ga0495581_0061513 Ga0495581_0061513_1786_2151 121
172 3300047315 Ga0495581_0062980 Ga0495581_0062980_1160_1525 121
173 3300047317 Ga0495604_0055902 Ga0495604_0055902_2399_2764 121
174 3300047318 Ga0495636_0000910 Ga0495636_0000910_1328_1693 121
175 3300047318 Ga0495636_0001271 Ga0495636_0001271_1823_2188 121
176 3300047318 Ga0495636_0006511 Ga0495636_0006511_3326_3691 121
177 3300047318 Ga0495636_0027122 Ga0495636_0027122_1538_1903 121
178 3300047318 Ga0495636_0169925 Ga0495636_0169925_350_715 121
179 3300047320 Ga0495672_0230864 Ga0495672_0230864_489_854 121
180 3300047321 Ga0495676_0033424 Ga0495676_0033424_32_397 121
181 3300047322 Ga0495680_0014939 Ga0495680_0014939_2855_3220 121
182 3300047443 Ga0495687_001922 Ga0495687_001922_12693_13058 121
183 3300047443 Ga0495687_024764 Ga0495687_024764_1180_1545 121
184 3300047443 Ga0495687_045097 Ga0495687_045097_1339_1704 121
185 3300047443 Ga0495687_045742 Ga0495687_045742_85_450 121
186 3300047444 Ga0495675_0080410 Ga0495675_0080410_1584_1949 121
187 3300047444 Ga0495675_0364204 Ga0495675_0364204_37_459 121
188 3300047445 Ga0495677_0048589 Ga0495677_0048589_134_499 121
189 3300047447 Ga0495685_000851 Ga0495685_000851_6573_6938 121
190 3300047447 Ga0495685_022196 Ga0495685_022196_1237_1602 121
191 3300047447 Ga0495685_024984 Ga0495685_024984_1467_1832 121
192 3300047447 Ga0495685_055884 Ga0495685_055884_767_1132 121
193 3300047447 Ga0495685_060780 Ga0495685_060780_717_1082 121
194 3300047447 Ga0495685_133544 Ga0495685_133544_140_505 121
195 3300047470 Ga0495681_0029091 Ga0495681_0029091_1355_1720 121
196 3300047472 Ga0495686_0096830 Ga0495686_0096830_1226_1591 121
197 3300047472 Ga0495686_0099314 Ga0495686_0099314_1162_1527 121
198 3300047673 Ga0495593_0027409 Ga0495593_0027409_1929_2294 121
199 3300048088 Ga0495602_0070118 Ga0495602_0070118_2071_2436 121
200 3300048089 Ga0495614_0527273 Ga0495614_0527273_17_382 121
201 3300048091 Ga0495626_0023817 Ga0495626_0023817_927_1292 121
202 3300048905 Ga0496102_1225951 Ga0496102_1225951_115_480 121
203 3300048909 Ga0496106_0431611 Ga0496106_0431611_445_810 121
204 3300048911 Ga0496108_0840532 Ga0496108_0840532_133_498 121
205 3300048912 Ga0496109_0934110 Ga0496109_0934110_311_676 121
206 3300048912 Ga0496109_1097236 Ga0496109_1097236_305_691 121
207 3300048924 Ga0496121_0875564 Ga0496121_0875564_14_379 121
208 3300049459 Ga0495678_038331 Ga0495678_038331_1061_1426 121
209 3300049459 Ga0495678_145318 Ga0495678_145318_277_642 121
210 3300049570 Ga0501033_0096072 Ga0501033_0096072_804_1169 121
211 3300049822 Ga0501035_0073508 Ga0501035_0073508_1478_1843 121
212 3300049822 Ga0501035_0083140 Ga0501035_0083140_1010_1375 121
213 3300050490 nmdc:mga03n38_80909_c1 nmdc:mga03n38_80909_c1_136_501 121
214 3300041453 Ga0451797_1343887 Ga0451797_1343887_542_913 122
215 3300041509 Ga0451843_0843053 Ga0451843_0843053_591_962 122
216 3300044658 Ga0466972_0317373 Ga0466972_0317373_152_520 122
217 3300045049 Ga0466959_0982384 Ga0466959_0982384_16_384 122
218 3300003316 rootH1_10005029 rootH1_100050298 123
219 3300003322 rootL2_10054571 rootL2_100545713 123
220 3300003323 rootH1_10038652 rootH1_100386523 123
221 3300031649 Ga0307514_10038801 Ga0307514_100388012 123
222 3300028794 Ga0307515_10152684 Ga0307515_101526843 124
223 3300030522 Ga0307512_10051724 Ga0307512_100517243 124
224 3300031456 Ga0307513_10953358 Ga0307513_109533581 124
225 3300031649 Ga0307514_10196386 Ga0307514_101963861 124
226 3300041451 Ga0451791_0839871 Ga0451791_0839871_316_690 124
227 3300041460 Ga0451802_0675412 Ga0451802_0675412_614_988 124
228 3300041512 Ga0451853_1767468 Ga0451853_1767468_2219_2593 124
229 3300041512 Ga0451853_3726170 Ga0451853_3726170_1979_2353 124
230 3300046660 Ga0495625_0042284 Ga0495625_0042284_2374_2748 124
231 3300050492 nmdc:mga0yw44_663436_c1 nmdc:mga0yw44_663436_c1_28_402 124
232 3300003308 Ga0006777J48905_1069166 Ga0006777J48905_10691661 125
233 3300003559 Ga0007427J51700_104909 Ga0007427J51700_1049091 125
234 3300003579 Ga0007429J51699_1029732 Ga0007429J51699_10297321 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

29

131

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tph-assembly1.cif.gz_A crystal structure of a de novo designed protein homodimer with curved beta-sheet 0.9127 12 118
5u35-assembly1.cif.gz_B crystal structure of a de novo designed protein with curved beta-sheet 0.8848 12 118
5trv-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.8669 11 115
3fh1-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (mll8193) from mesorhizobium loti at 1.60 a resolution 0.8476 11 118
4lmi-assembly1.cif.gz_A crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 0.8397 11 125
ID Description Score Start End Superfamily
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8397 11 125 3.10.450.50
3fh1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8264 11 121 3.10.450.50
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8257 11 121 3.10.450.50
af_Q58FW4_193_288_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8181 65 106 3.30.390.80
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8129 71 106 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A197SW16-F1-model_v4 SnoaL-like domain-containing protein 1.005 7 121
AF-A0A7Z0WFE9-F1-model_v4 SnoaL-like domain-containing protein 0.9995 5 121
AF-A0A2H5B5H0-F1-model_v4 SnoaL-like domain-containing protein 0.9967 6 121
AF-A0A536VCV9-F1-model_v4 Nuclear transport factor 2 family protein 0.992 11 121
AF-A0A840IGD9-F1-model_v4 Ketosteroid isomerase-like protein 0.9918 8 121 GO:0016853

Feature Viewer

pLDDT pTM Quality
93.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map