F347327

General Info

Members Datasets Scaffolds Average Seq Length
234 156 468 166

Family's Representative Sequence

Representative Sequence 3300041411|Ga0439466_0001973|Ga0439466_0001973_3154_3642
Length 162
Sequence MNAVHIIFGPLGAGKSTLARQITAQLNAVSFSIDEWMQRLYGPDLPQPLSLEWVLPRVRRCEAQIWETCVQVLASGKDVVLDQGFMTKADRTQIRLQAHNAGYEVLSHFVNADKPLRRERVLQRNLEKGAGYSFEITAQMFEAMDARFEHPSPSELEECCNV

Samples

Sample ID Description Type Environment
1 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 2511231016 Pseudomonas sp. GM50 Isolate Nodule
152 2511231022 Pseudomonas sp. GM79 Isolate Nodule
153 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
154 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
155 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
156 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.26
Nodule 0.85
Rhizoplane 6.41
Rhizosphere 79.49
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439466_0001973 3300041411 Bacteria 8046
2 Ga0055531_10022022 3300003794 Bacteria 2446
3 Ga0070658_10044780 3300005327 Bacteria 3577
4 Ga0070658_10200023 3300005327 Bacteria 1685
5 Ga0070658_10363630 3300005327 Bacteria 1240
6 Ga0070670_100018217 3300005331 Bacteria 6026
7 Ga0070670_100351372 3300005331 Bacteria 1295
8 Ga0070666_10122584 3300005335 Bacteria 1803
9 Ga0070680_100529146 3300005336 Bacteria 1009
10 Ga0070680_101276109 3300005336 Bacteria 635
11 Ga0070682_100667942 3300005337 Bacteria 829
12 Ga0070660_100707503 3300005339 Bacteria 845
13 Ga0070661_100456512 3300005344 Bacteria 1017
14 Ga0070668_100012778 3300005347 Bacteria 6251
15 Ga0070669_100076047 3300005353 Bacteria 2491
16 Ga0070669_100850953 3300005353 Bacteria 777
17 Ga0070671_100001194 3300005355 Bacteria 19469
18 Ga0070671_100058052 3300005355 Bacteria 3221
19 Ga0070659_100000646 3300005366 Bacteria 25468
20 Ga0070659_100030944 3300005366 Bacteria 4143
21 Ga0070667_100011800 3300005367 Bacteria 7223
22 Ga0070663_100609873 3300005455 Bacteria 919
23 Ga0070662_100283208 3300005457 Bacteria 1342
24 Ga0070681_10017522 3300005458 Bacteria 7159
25 Ga0070681_10056912 3300005458 Bacteria 3890
26 Ga0070679_100117979 3300005530 Bacteria 2638
27 Ga0070684_100374455 3300005535 Unclassified 1311
28 Ga0070684_100836574 3300005535 Bacteria 861
29 Ga0068853_100061834 3300005539 Bacteria 3239
30 Ga0070665_100000580 3300005548 Bacteria 51067
31 Ga0070665_100028344 3300005548 Bacteria 5641
32 Ga0070665_100209855 3300005548 Bacteria 1948
33 Ga0068855_100072723 3300005563 Bacteria 3996
34 Ga0068855_100225250 3300005563 Bacteria 2101
35 Ga0068855_100333938 3300005563 Bacteria 1673
36 Ga0068855_100449967 3300005563 Bacteria 1405
37 Ga0070664_100370741 3300005564 Bacteria 1305
38 Ga0068856_101542073 3300005614 Bacteria 678
39 Ga0068859_100000523 3300005617 Bacteria 38137
40 Ga0068864_100011458 3300005618 Bacteria 7324
41 Ga0068864_101251648 3300005618 Bacteria 741
42 Ga0068861_100860505 3300005719 Bacteria 855
43 Ga0068863_100009525 3300005841 Bacteria 9472
44 Ga0068863_100027372 3300005841 Bacteria 5437
45 Ga0068863_100552707 3300005841 Bacteria 1137
46 Ga0068862_100052628 3300005844 Bacteria 3484
47 Ga0070717_11127439 3300006028 Bacteria 714
48 Ga0075368_10001584 3300006042 Bacteria 7304
49 Ga0075363_100082922 3300006048 Bacteria 1756
50 Ga0075364_10001209 3300006051 Bacteria 13867
51 Ga0075367_10005210 3300006178 Bacteria 6427
52 Ga0075366_10018594 3300006195 Bacteria 4013
53 Ga0097621_100317550 3300006237 Bacteria 1379
54 Ga0068871_100604426 3300006358 Bacteria 998
55 Ga0068865_100000146 3300006881 Bacteria 37910
56 Ga0097620_100000523 3300006931 Bacteria 38137
57 Ga0105240_10047308 3300009093 Bacteria 5444
58 Ga0105240_10054587 3300009093 Bacteria 5007
59 Ga0105240_10109536 3300009093 Bacteria 3344
60 Ga0105240_11991696 3300009093 Bacteria 604
61 Ga0105245_12327442 3300009098 Bacteria 589
62 Ga0105247_10033152 3300009101 Bacteria 3140
63 Ga0105248_10001816 3300009177 Bacteria 23730
64 Ga0105248_10005714 3300009177 Bacteria 13661
65 Ga0105248_10323311 3300009177 Bacteria 1737
66 Ga0105248_11404249 3300009177 Bacteria 790
67 Ga0105248_11764273 3300009177 Bacteria 702
68 Ga0105238_10210603 3300009551 Bacteria 1920
69 Ga0105238_10852964 3300009551 Bacteria 928
70 Ga0105238_11015460 3300009551 Bacteria 850
71 Ga0105249_10284846 3300009553 Bacteria 1652
72 Ga0105239_10104470 3300010375 Bacteria 3136
73 Ga0105239_10329298 3300010375 Bacteria 1723
74 Ga0105239_11519405 3300010375 Bacteria 774
75 Ga0157370_11194585 3300013104 Bacteria 686
76 Ga0163162_10163536 3300013306 Bacteria 2348
77 Ga0157375_10095838 3300013308 Bacteria 3039
78 Ga0163163_10034411 3300014325 Bacteria 4906
79 Ga0163163_10038238 3300014325 Bacteria 4675
80 Ga0163163_10662226 3300014325 Bacteria 1107
81 Ga0163163_11317810 3300014325 Bacteria 784
82 Ga0182008_10415296 3300014497 Bacteria 725
83 Ga0157379_10004017 3300014968 Bacteria 12536
84 Ga0157376_10620369 3300014969 Bacteria 1078
85 Ga0213876_10160150 3300021384 Bacteria 1197
86 Ga0209026_1000919 3300025250 Bacteria 15050
87 Ga0209148_1024486 3300025254 Bacteria 953
88 Ga0209257_1006696 3300025304 Bacteria 7295
89 Ga0207710_10017700 3300025900 Bacteria 3023
90 Ga0207680_10104117 3300025903 Bacteria 1829
91 Ga0207680_10279763 3300025903 Bacteria 1159
92 Ga0207705_10075303 3300025909 Bacteria 2451
93 Ga0207705_10151969 3300025909 Bacteria 1735
94 Ga0207705_10216813 3300025909 Bacteria 1452
95 Ga0207705_10308459 3300025909 Bacteria 1214
96 Ga0207707_11027971 3300025912 Bacteria 675
97 Ga0207695_10001797 3300025913 Bacteria 33844
98 Ga0207695_10003826 3300025913 Bacteria 20862
99 Ga0207695_10091792 3300025913 Bacteria 3049
100 Ga0207660_10019575 3300025917 Bacteria 4526
101 Ga0207660_10032981 3300025917 Bacteria 3578
102 Ga0207657_10018553 3300025919 Bacteria 6633
103 Ga0207657_10168613 3300025919 Bacteria 1775
104 Ga0207657_10551444 3300025919 Bacteria 901
105 Ga0207652_10124009 3300025921 Bacteria 2300
106 Ga0207652_10128983 3300025921 Bacteria 2254
107 Ga0207681_10007027 3300025923 Bacteria 6908
108 Ga0207681_11039896 3300025923 Bacteria 687
109 Ga0207694_10010842 3300025924 Bacteria 6879
110 Ga0207694_10690701 3300025924 Bacteria 860
111 Ga0207650_10638625 3300025925 Bacteria 897
112 Ga0207690_10001096 3300025932 Bacteria 17232
113 Ga0207690_10023037 3300025932 Bacteria 3882
114 Ga0207704_10000529 3300025938 Bacteria 16999
115 Ga0207704_10901658 3300025938 Bacteria 743
116 Ga0207711_10001186 3300025941 Bacteria 24752
117 Ga0207711_10009296 3300025941 Bacteria 8205
118 Ga0207711_10499881 3300025941 Bacteria 1133
119 Ga0207667_10058101 3300025949 Bacteria 4059
120 Ga0207667_10286537 3300025949 Bacteria 1683
121 Ga0207667_10371584 3300025949 Bacteria 1457
122 Ga0207712_10375699 3300025961 Bacteria 1188
123 Ga0207668_10009060 3300025972 Bacteria 5947
124 Ga0207658_10009641 3300025986 Bacteria 6554
125 Ga0207703_10001385 3300026035 Bacteria 22148
126 Ga0207703_10096622 3300026035 Bacteria 2495
127 Ga0207639_10058147 3300026041 Bacteria 2972
128 Ga0207678_10458725 3300026067 Bacteria 1108
129 Ga0207702_10174747 3300026078 Bacteria 1973
130 Ga0207641_10010230 3300026088 Bacteria 7715
131 Ga0207641_10010554 3300026088 Bacteria 7579
132 Ga0207641_11301807 3300026088 Bacteria 727
133 Ga0207676_10042951 3300026095 Bacteria 3477
134 Ga0207676_10614258 3300026095 Bacteria 1046
135 Ga0207674_10172589 3300026116 Bacteria 2115
136 Ga0207675_102007971 3300026118 Bacteria 596
137 Ga0268266_10000003 3300028379 Bacteria 1701703
138 Ga0268266_10119451 3300028379 Bacteria 2344
139 Ga0268266_10462341 3300028379 Bacteria 1207
140 Ga0268265_10113031 3300028380 Bacteria 2221
141 Ga0268264_10146162 3300028381 Bacteria 2114
142 Ga0307517_10000710 3300028786 Bacteria 57392
143 Ga0307517_10040023 3300028786 Bacteria 5123
144 Ga0265327_10005427 3300031251 Bacteria 10633
145 Ga0307513_10000276 3300031456 Bacteria 74546
146 Ga0307513_10001313 3300031456 Bacteria 35941
147 Ga0307513_10002920 3300031456 Bacteria 23372
148 Ga0307513_10090650 3300031456 Bacteria 3117
149 Ga0307413_10316952 3300031824 Bacteria 1189
150 Ga0307406_11230480 3300031901 Bacteria 651
151 Ga0307409_100200756 3300031995 Bacteria 1784
152 Ga0307411_10682439 3300032005 Bacteria 893
153 Ga0307510_10011803 3300033180 Bacteria 10365
154 Ga0373926_0344881 3300035083 Archaea 584
155 Ga0373944_0011662 3300035089 Bacteria 2411
156 Ga0373936_0013845 3300035113 Bacteria 3079
157 Ga0373946_0178166 3300035171 Unclassified 1007
158 Ga0373927_0000188 3300035695 Bacteria 49189
159 Ga0373927_0168805 3300035695 Bacteria 1434
160 Ga0373925_0000247 3300037068 Bacteria 57283
161 Ga0373925_0328485 3300037068 Bacteria 1239
162 Ga0395899_0002291 3300037312 Bacteria 15619
163 Ga0395900_0000237 3300037418 Bacteria 86507
164 Ga0395898_0004468 3300037466 Bacteria 15287
165 Ga0395898_0053636 3300037466 Bacteria 3938
166 Ga0395905_0063856 3300037471 Bacteria 3445
167 Ga0395905_0375552 3300037471 Bacteria 1315
168 Ga0395905_0409327 3300037471 Bacteria 1252
169 Ga0395905_0711789 3300037471 Bacteria 906
170 Ga0395905_0935888 3300037471 Bacteria 769
171 Ga0395901_0000028 3300038443 Bacteria 242653
172 Ga0395901_0075104 3300038443 Bacteria 3526
173 Ga0395901_1575401 3300038443 Bacteria 611
174 Ga0436365_0553205 3300039437 Bacteria 1381
175 Ga0439432_121998 3300042006 Bacteria 771
176 Ga0439451_000065 3300042009 Bacteria 19343
177 Ga0439452_002491 3300042010 Bacteria 6770
178 Ga0466970_0122520 3300044765 Bacteria 1425
179 Ga0466957_0165254 3300044842 Bacteria 1439
180 Ga0466958_0330777 3300045836 Bacteria 980
181 Ga0495584_0000809 3300046491 Bacteria 20576
182 Ga0495583_0000434 3300046506 Bacteria 63052
183 Ga0495583_0104887 3300046506 Bacteria 1203
184 Ga0495610_0010656 3300046512 Bacteria 5692
185 Ga0495628_0112289 3300046516 Bacteria 2095
186 Ga0495631_0045130 3300046518 Bacteria 1941
187 Ga0495648_0016341 3300046524 Bacteria 5353
188 Ga0495642_0105849 3300046528 Bacteria 1200
189 Ga0495645_0012506 3300046543 Bacteria 5982
190 Ga0495668_0216482 3300046616 Bacteria 1049
191 Ga0495611_0006011 3300046648 Bacteria 5178
192 Ga0495625_0018962 3300046660 Bacteria 5353
193 Ga0495588_0128955 3300046674 Bacteria 1334
194 Ga0495669_0000004 3300046684 Bacteria 208878
195 Ga0495669_0000438 3300046684 Bacteria 19819
196 Ga0495669_0228610 3300046684 Bacteria 892
197 Ga0495670_0013960 3300046691 Bacteria 3951
198 Ga0495671_0000061 3300046692 Bacteria 107050
199 Ga0495672_0094781 3300047320 Bacteria 1631
200 Ga0495683_0001875 3300047323 Bacteria 13182
201 Ga0495677_0092253 3300047445 Bacteria 1142
202 Ga0495685_191653 3300047447 Unclassified 657
203 Ga0495681_0053770 3300047470 Bacteria 1884
204 Ga0495626_0039616 3300048091 Bacteria 2229
205 Ga0496100_0399079 3300048903 Bacteria 1047
206 Ga0496101_0130645 3300048904 Bacteria 1907
207 Ga0496102_0577472 3300048905 Bacteria 1047
208 Ga0496107_0067288 3300048910 Bacteria 2599
209 Ga0496108_0009213 3300048911 Bacteria 7992
210 Ga0496110_0080069 3300048913 Bacteria 2910
211 Ga0496112_0029791 3300048915 Bacteria 5281
212 Ga0496112_0062714 3300048915 Bacteria 3667
213 Ga0496113_0118706 3300048916 Bacteria 2066
214 Ga0496113_0599719 3300048916 Bacteria 882
215 Ga0496113_1062931 3300048916 Bacteria 636
216 Ga0496115_0025609 3300048918 Bacteria 4595
217 Ga0496115_0029669 3300048918 Bacteria 4297
218 Ga0496115_0137116 3300048918 Bacteria 2018
219 Ga0496115_0225884 3300048918 Bacteria 1544
220 nmdc:mga00v17_672_c1 3300050491 Bacteria 18838
221 nmdc:mga0k408_16354_c1 3300050493 Bacteria 4116
222 nmdc:mga06z11_16690_c1 3300050494 Bacteria 3314
223 nmdc:mga04h51_625_c1 3300050495 Bacteria 8292
224 nmdc:mga07m45_8644_c1 3300050496 Bacteria 5244
225 nmdc:mga07m45_99844_c1 3300050496 Bacteria 1667
226 Ga0500641_0314985 3300053096 Bacteria 638
227 Ga0500562_007990 3300053108 Bacteria 2670
228 Ga0500595_024127 3300053119 Bacteria 2127
229 2511325536 2511231016 Bacteria 6704427
230 2511362513 2511231022 Bacteria 6719296
231 2643999011 2643221598 Bacteria 4578346
232 2644086348 2643221614 Bacteria 4260023
233 2644344846 2643221661 Bacteria 4267604
234 2644367589 2643221666 Bacteria 4265935
235 Ga0439466_0001973
236 Ga0055531_10022022
237 Ga0070658_10044780
238 Ga0070658_10200023
239 Ga0070658_10363630
240 Ga0070670_100018217
241 Ga0070670_100351372
242 Ga0070666_10122584
243 Ga0070680_100529146
244 Ga0070680_101276109
245 Ga0070682_100667942
246 Ga0070660_100707503
247 Ga0070661_100456512
248 Ga0070668_100012778
249 Ga0070669_100076047
250 Ga0070669_100850953
251 Ga0070671_100001194
252 Ga0070671_100058052
253 Ga0070659_100000646
254 Ga0070659_100030944
255 Ga0070667_100011800
256 Ga0070663_100609873
257 Ga0070662_100283208
258 Ga0070681_10017522
259 Ga0070681_10056912
260 Ga0070679_100117979
261 Ga0070684_100374455
262 Ga0070684_100836574
263 Ga0068853_100061834
264 Ga0070665_100000580
265 Ga0070665_100028344
266 Ga0070665_100209855
267 Ga0068855_100072723
268 Ga0068855_100225250
269 Ga0068855_100333938
270 Ga0068855_100449967
271 Ga0070664_100370741
272 Ga0068856_101542073
273 Ga0068859_100000523
274 Ga0068864_100011458
275 Ga0068864_101251648
276 Ga0068861_100860505
277 Ga0068863_100009525
278 Ga0068863_100027372
279 Ga0068863_100552707
280 Ga0068862_100052628
281 Ga0070717_11127439
282 Ga0075368_10001584
283 Ga0075363_100082922
284 Ga0075364_10001209
285 Ga0075367_10005210
286 Ga0075366_10018594
287 Ga0097621_100317550
288 Ga0068871_100604426
289 Ga0068865_100000146
290 Ga0097620_100000523
291 Ga0105240_10047308
292 Ga0105240_10054587
293 Ga0105240_10109536
294 Ga0105240_11991696
295 Ga0105245_12327442
296 Ga0105247_10033152
297 Ga0105248_10001816
298 Ga0105248_10005714
299 Ga0105248_10323311
300 Ga0105248_11404249
301 Ga0105248_11764273
302 Ga0105238_10210603
303 Ga0105238_10852964
304 Ga0105238_11015460
305 Ga0105249_10284846
306 Ga0105239_10104470
307 Ga0105239_10329298
308 Ga0105239_11519405
309 Ga0157370_11194585
310 Ga0163162_10163536
311 Ga0157375_10095838
312 Ga0163163_10034411
313 Ga0163163_10038238
314 Ga0163163_10662226
315 Ga0163163_11317810
316 Ga0182008_10415296
317 Ga0157379_10004017
318 Ga0157376_10620369
319 Ga0213876_10160150
320 Ga0209026_1000919
321 Ga0209148_1024486
322 Ga0209257_1006696
323 Ga0207710_10017700
324 Ga0207680_10104117
325 Ga0207680_10279763
326 Ga0207705_10075303
327 Ga0207705_10151969
328 Ga0207705_10216813
329 Ga0207705_10308459
330 Ga0207707_11027971
331 Ga0207695_10001797
332 Ga0207695_10003826
333 Ga0207695_10091792
334 Ga0207660_10019575
335 Ga0207660_10032981
336 Ga0207657_10018553
337 Ga0207657_10168613
338 Ga0207657_10551444
339 Ga0207652_10124009
340 Ga0207652_10128983
341 Ga0207681_10007027
342 Ga0207681_11039896
343 Ga0207694_10010842
344 Ga0207694_10690701
345 Ga0207650_10638625
346 Ga0207690_10001096
347 Ga0207690_10023037
348 Ga0207704_10000529
349 Ga0207704_10901658
350 Ga0207711_10001186
351 Ga0207711_10009296
352 Ga0207711_10499881
353 Ga0207667_10058101
354 Ga0207667_10286537
355 Ga0207667_10371584
356 Ga0207712_10375699
357 Ga0207668_10009060
358 Ga0207658_10009641
359 Ga0207703_10001385
360 Ga0207703_10096622
361 Ga0207639_10058147
362 Ga0207678_10458725
363 Ga0207702_10174747
364 Ga0207641_10010230
365 Ga0207641_10010554
366 Ga0207641_11301807
367 Ga0207676_10042951
368 Ga0207676_10614258
369 Ga0207674_10172589
370 Ga0207675_102007971
371 Ga0268266_10000003
372 Ga0268266_10119451
373 Ga0268266_10462341
374 Ga0268265_10113031
375 Ga0268264_10146162
376 Ga0307517_10000710
377 Ga0307517_10040023
378 Ga0265327_10005427
379 Ga0307513_10000276
380 Ga0307513_10001313
381 Ga0307513_10002920
382 Ga0307513_10090650
383 Ga0307413_10316952
384 Ga0307406_11230480
385 Ga0307409_100200756
386 Ga0307411_10682439
387 Ga0307510_10011803
388 Ga0373926_0344881
389 Ga0373944_0011662
390 Ga0373936_0013845
391 Ga0373946_0178166
392 Ga0373927_0000188
393 Ga0373927_0168805
394 Ga0373925_0000247
395 Ga0373925_0328485
396 Ga0395899_0002291
397 Ga0395900_0000237
398 Ga0395898_0004468
399 Ga0395898_0053636
400 Ga0395905_0063856
401 Ga0395905_0375552
402 Ga0395905_0409327
403 Ga0395905_0711789
404 Ga0395905_0935888
405 Ga0395901_0000028
406 Ga0395901_0075104
407 Ga0395901_1575401
408 Ga0436365_0553205
409 Ga0439432_121998
410 Ga0439451_000065
411 Ga0439452_002491
412 Ga0466970_0122520
413 Ga0466957_0165254
414 Ga0466958_0330777
415 Ga0495584_0000809
416 Ga0495583_0000434
417 Ga0495583_0104887
418 Ga0495610_0010656
419 Ga0495628_0112289
420 Ga0495631_0045130
421 Ga0495648_0016341
422 Ga0495642_0105849
423 Ga0495645_0012506
424 Ga0495668_0216482
425 Ga0495611_0006011
426 Ga0495625_0018962
427 Ga0495588_0128955
428 Ga0495669_0000004
429 Ga0495669_0000438
430 Ga0495669_0228610
431 Ga0495670_0013960
432 Ga0495671_0000061
433 Ga0495672_0094781
434 Ga0495683_0001875
435 Ga0495677_0092253
436 Ga0495685_191653
437 Ga0495681_0053770
438 Ga0495626_0039616
439 Ga0496100_0399079
440 Ga0496101_0130645
441 Ga0496102_0577472
442 Ga0496107_0067288
443 Ga0496108_0009213
444 Ga0496110_0080069
445 Ga0496112_0029791
446 Ga0496112_0062714
447 Ga0496113_0118706
448 Ga0496113_0599719
449 Ga0496113_1062931
450 Ga0496115_0025609
451 Ga0496115_0029669
452 Ga0496115_0137116
453 Ga0496115_0225884
454 nmdc:mga00v17_672_c1
455 nmdc:mga0k408_16354_c1
456 nmdc:mga06z11_16690_c1
457 nmdc:mga04h51_625_c1
458 nmdc:mga07m45_8644_c1
459 nmdc:mga07m45_99844_c1
460 Ga0500641_0314985
461 Ga0500562_007990
462 Ga0500595_024127
463 2511325536
464 2511362513
465 2643999011
466 2644086348
467 2644344846
468 2644367589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13671

AAA_33

AAA domain

4

151

0.92

PF07931

CPT

Chloramphenicol phosphotransferase-like protein

3

149

0.88

PF06414

Zeta_toxin

Zeta toxin

2

150

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rhm-assembly2.cif.gz_D crystal structure of a putative kinase (caur_3907) from chloroflexus aurantiacus j-10-fl at 1.70 a resolution 0.7996 1 163
2ia5-assembly2.cif.gz_H t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.7934 3 146
2ia5-assembly3.cif.gz_L t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.793 3 146
2ia5-assembly3.cif.gz_K t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.7916 3 146
2ia5-assembly2.cif.gz_F t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.7908 3 146
ID Description Score Start End Superfamily
af_Q9XWJ1_57_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8973 3 24 3.40.50.300
af_Q54TE2_1_167_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8369 1 162 3.40.50.300
af_Q54TE2_1_167_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8138 1 162 3.40.50.300
af_O13911_231_407_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7876 3 164 3.40.50.300
af_A0A0G2JUH4_338_483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7866 3 145 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A525L8Z9-F1-model_v4 ATP-binding protein 0.9689 1 165 GO:0005524
GO:0016020
AF-A0A328APK7-F1-model_v4 ATP-binding protein 0.9657 1 166
AF-A0A328AB15-F1-model_v4 ATP-binding protein 0.9633 1 166 GO:0005524
GO:0016020
AF-A0A328APK7-F1-model_v4 ATP-binding protein 0.9601 1 166
AF-A0A525L8Z9-F1-model_v4 ATP-binding protein 0.9575 1 165 GO:0005524
GO:0016020

Map