F347372

General Info

Members Datasets Scaffolds Average Seq Length
234 126 234 150

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0579309|Ga0466959_0579309_74_628
Length 184
Sequence MDGLHYFPPDDGRRHHRSVARVSFSAPNRIFIRKMRAVIQRVSHASVTIEGIVRSAIGKGLLVLVGIEDTDAAEDIDWLCAKIVNLRIFHDSAGIMNVSVRDIDGDILLVSQFTLHASTKKGNRPSYIRASKPDIAIPLYEQIVKTLAAQLGKPIGTGEFGADMKVELLNDGPVTILIDTKNKE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.71
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000018 3300003320 Bacteria 23416
2 rootH2_10003786 3300003320 Bacteria 46076
3 rootH2_10020473 3300003320 Bacteria 12354
4 rootH2_10090949 3300003320 Bacteria 5369
5 Ga0070683_100010781 3300005329 Bacteria 7865
6 Ga0070683_100631077 3300005329 Bacteria 1026
7 Ga0068869_100192719 3300005334 Bacteria 1603
8 Ga0070680_100150745 3300005336 Bacteria 1952
9 Ga0070680_100263146 3300005336 Bacteria 1459
10 Ga0070682_100054851 3300005337 Bacteria 2502
11 Ga0068868_100461745 3300005338 Unclassified 1106
12 Ga0068868_101042686 3300005338 Unclassified 750
13 Ga0070691_10013381 3300005341 Bacteria 3758
14 Ga0070691_10074361 3300005341 Unclassified 1653
15 Ga0070687_100034872 3300005343 Bacteria 2493
16 Ga0070669_100001567 3300005353 Bacteria 16563
17 Ga0070669_100069962 3300005353 Unclassified 2593
18 Ga0070675_101444877 3300005354 Bacteria 634
19 Ga0070688_100001624 3300005365 Bacteria 11252
20 Ga0070659_100005677 3300005366 Bacteria 8974
21 Ga0070659_100248510 3300005366 Bacteria 1474
22 Ga0070659_101053943 3300005366 Bacteria 715
23 Ga0070667_100090919 3300005367 Bacteria 2624
24 Ga0070667_100140971 3300005367 Bacteria 2111
25 Ga0070667_101801730 3300005367 Bacteria 576
26 Ga0070663_100520318 3300005455 Bacteria 990
27 Ga0070681_10061279 3300005458 Bacteria 3738
28 Ga0070681_10152638 3300005458 Bacteria 2236
29 Ga0070681_10234153 3300005458 Bacteria 1751
30 Ga0070679_100001044 3300005530 Bacteria 24138
31 Ga0070679_100029941 3300005530 Bacteria 5371
32 Ga0070679_100522883 3300005530 Bacteria 1130
33 Ga0070684_100014474 3300005535 Bacteria 6393
34 Ga0070697_100279873 3300005536 Bacteria 1431
35 Ga0068853_100738464 3300005539 Bacteria 940
36 Ga0070665_100927910 3300005548 Unclassified 883
37 Ga0068855_100003071 3300005563 Bacteria 20426
38 Ga0068855_100003485 3300005563 Bacteria 19266
39 Ga0068855_100118851 3300005563 Bacteria 3027
40 Ga0068855_100730072 3300005563 Bacteria 1058
41 Ga0068857_100111875 3300005577 Bacteria 2455
42 Ga0068857_100336643 3300005577 Bacteria 1396
43 Ga0068857_100624629 3300005577 Bacteria 1020
44 Ga0068854_100263234 3300005578 Bacteria 1381
45 Ga0068854_100376984 3300005578 Bacteria 1168
46 Ga0068854_100490651 3300005578 Bacteria 1033
47 Ga0068856_100108091 3300005614 Unclassified 2778
48 Ga0068856_100166701 3300005614 Bacteria 2214
49 Ga0068856_100587617 3300005614 Unclassified 1135
50 Ga0068852_100001453 3300005616 Bacteria 15992
51 Ga0068852_100023905 3300005616 Bacteria 4929
52 Ga0068852_100400803 3300005616 Bacteria 1349
53 Ga0068864_100089763 3300005618 Bacteria 2708
54 Ga0068861_100016681 3300005719 Bacteria 5201
55 Ga0068870_10094915 3300005840 Bacteria 1675
56 Ga0068863_100285588 3300005841 Unclassified 1599
57 Ga0068860_100000759 3300005843 Bacteria 36404
58 Ga0068862_101256380 3300005844 Bacteria 740
59 Ga0081540_1063441 3300005983 Bacteria 1748
60 Ga0097621_100237566 3300006237 Bacteria 1592
61 Ga0068865_100428113 3300006881 Bacteria 1090
62 Ga0097620_100289920 3300006931 Bacteria 1730
63 Ga0105240_10000421 3300009093 Bacteria 78509
64 Ga0105240_10111479 3300009093 Bacteria 3309
65 Ga0105240_10119719 3300009093 Bacteria 3171
66 Ga0105240_10225962 3300009093 Unclassified 2178
67 Ga0105240_10672775 3300009093 Bacteria 1132
68 Ga0111539_10155409 3300009094 Bacteria 2677
69 Ga0105241_10174306 3300009174 Bacteria 1778
70 Ga0105241_10391956 3300009174 Unclassified 1216
71 Ga0105237_10000726 3300009545 Bacteria 45510
72 Ga0105237_10001602 3300009545 Bacteria 29373
73 Ga0105237_10012702 3300009545 Bacteria 8860
74 Ga0105237_10080429 3300009545 Bacteria 3249
75 Ga0105237_11102011 3300009545 Unclassified 801
76 Ga0105238_10052534 3300009551 Bacteria 4097
77 Ga0105238_10124217 3300009551 Unclassified 2560
78 Ga0105238_10425860 3300009551 Bacteria 1322
79 Ga0105249_10012787 3300009553 Bacteria 7402
80 Ga0105249_11391205 3300009553 Bacteria 773
81 Ga0105239_10000283 3300010375 Bacteria 74612
82 Ga0105239_10004632 3300010375 Bacteria 16343
83 Ga0105239_10009358 3300010375 Bacteria 11058
84 Ga0105239_10028577 3300010375 Bacteria 6131
85 Ga0105239_10461787 3300010375 Bacteria 1441
86 Ga0105239_10664685 3300010375 Bacteria 1190
87 Ga0157373_10247782 3300013100 Bacteria 1260
88 Ga0157371_10013472 3300013102 Bacteria 6207
89 Ga0157371_10027381 3300013102 Bacteria 4135
90 Ga0157370_10192967 3300013104 Unclassified 1891
91 Ga0157370_10439767 3300013104 Unclassified 1199
92 Ga0157370_10843393 3300013104 Bacteria 833
93 Ga0157369_10108659 3300013105 Bacteria 2950
94 Ga0157369_10477090 3300013105 Bacteria 1291
95 Ga0157374_10000013 3300013296 Bacteria 461240
96 Ga0157378_10081649 3300013297 Unclassified 2922
97 Ga0157378_10488364 3300013297 Bacteria 1228
98 Ga0163162_10027956 3300013306 Bacteria 5579
99 Ga0157372_10019020 3300013307 Bacteria 7393
100 Ga0157372_10022657 3300013307 Bacteria 6798
101 Ga0157372_10038565 3300013307 Bacteria 5273
102 Ga0157372_10180679 3300013307 Unclassified 2442
103 Ga0157372_10205421 3300013307 Bacteria 2283
104 Ga0163163_10056046 3300014325 Bacteria 3896
105 Ga0157380_10115181 3300014326 Bacteria 2266
106 Ga0157377_10354451 3300014745 Bacteria 985
107 Ga0157376_10002704 3300014969 Bacteria 12073
108 Ga0182006_1004008 3300015261 Bacteria 7351
109 Ga0209257_1000007 3300025304 Bacteria 1564415
110 Ga0207688_10014454 3300025901 Bacteria 4291
111 Ga0207647_10066664 3300025904 Bacteria 2182
112 Ga0207647_10090674 3300025904 Unclassified 1823
113 Ga0207705_10066606 3300025909 Bacteria 2605
114 Ga0207705_10231644 3300025909 Bacteria 1405
115 Ga0207705_10468880 3300025909 Bacteria 977
116 Ga0207654_10561205 3300025911 Bacteria 812
117 Ga0207707_10041615 3300025912 Bacteria 4011
118 Ga0207707_10116929 3300025912 Bacteria 2330
119 Ga0207707_10223027 3300025912 Bacteria 1641
120 Ga0207707_10344071 3300025912 Bacteria 1286
121 Ga0207695_10000051 3300025913 Bacteria 399641
122 Ga0207695_10000056 3300025913 Bacteria 382433
123 Ga0207695_10000081 3300025913 Bacteria 284797
124 Ga0207695_10000156 3300025913 Bacteria 204576
125 Ga0207695_10029169 3300025913 Bacteria 6104
126 Ga0207695_10080012 3300025913 Bacteria 3310
127 Ga0207695_10095146 3300025913 Bacteria 2984
128 Ga0207671_10009059 3300025914 Bacteria 8367
129 Ga0207671_10045293 3300025914 Bacteria 3253
130 Ga0207671_10047105 3300025914 Bacteria 3190
131 Ga0207660_10016547 3300025917 Bacteria 4883
132 Ga0207660_11637445 3300025917 Bacteria 518
133 Ga0207657_10002529 3300025919 Bacteria 19785
134 Ga0207657_10054475 3300025919 Bacteria 3459
135 Ga0207652_10000051 3300025921 Bacteria 120327
136 Ga0207652_10001036 3300025921 Bacteria 25472
137 Ga0207652_10027938 3300025921 Bacteria 4705
138 Ga0207681_10059996 3300025923 Bacteria 2609
139 Ga0207681_10065692 3300025923 Bacteria 2509
140 Ga0207681_11063136 3300025923 Unclassified 679
141 Ga0207694_10178968 3300025924 Bacteria 1719
142 Ga0207694_10232809 3300025924 Unclassified 1505
143 Ga0207650_10262407 3300025925 Bacteria 1401
144 Ga0207650_10312077 3300025925 Bacteria 1286
145 Ga0207690_10007904 3300025932 Bacteria 6320
146 Ga0207690_10086326 3300025932 Bacteria 2205
147 Ga0207706_10020173 3300025933 Bacteria 5989
148 Ga0207704_10103319 3300025938 Bacteria 1906
149 Ga0207689_10079681 3300025942 Bacteria 2691
150 Ga0207661_10155820 3300025944 Bacteria 1978
151 Ga0207661_10356512 3300025944 Bacteria 1321
152 Ga0207667_10000180 3300025949 Bacteria 92094
153 Ga0207667_10001783 3300025949 Bacteria 27109
154 Ga0207667_10005333 3300025949 Bacteria 15670
155 Ga0207667_10155880 3300025949 Unclassified 2350
156 Ga0207712_10071949 3300025961 Bacteria 2488
157 Ga0207712_10752028 3300025961 Bacteria 854
158 Ga0207640_10167214 3300025981 Bacteria 1634
159 Ga0207658_10061986 3300025986 Bacteria 2797
160 Ga0207658_10601579 3300025986 Unclassified 988
161 Ga0207677_10415250 3300026023 Bacteria 1145
162 Ga0207677_10827247 3300026023 Bacteria 830
163 Ga0207639_10138696 3300026041 Bacteria 2023
164 Ga0207678_10335599 3300026067 Bacteria 1302
165 Ga0207678_10351518 3300026067 Unclassified 1271
166 Ga0207678_10428771 3300026067 Bacteria 1147
167 Ga0207702_10083067 3300026078 Unclassified 2786
168 Ga0207702_10175447 3300026078 Bacteria 1969
169 Ga0207702_10810758 3300026078 Unclassified 925
170 Ga0207641_10306908 3300026088 Unclassified 1501
171 Ga0207674_10012528 3300026116 Bacteria 9474
172 Ga0207674_10061101 3300026116 Bacteria 3808
173 Ga0207674_10536496 3300026116 Bacteria 1130
174 Ga0207674_10807822 3300026116 Unclassified 905
175 Ga0207675_100000085 3300026118 Bacteria 73716
176 Ga0207698_10033202 3300026142 Unclassified 3748
177 Ga0207698_10073898 3300026142 Bacteria 2717
178 Ga0207698_10233968 3300026142 Bacteria 1670
179 Ga0207428_10054199 3300027907 Bacteria 3194
180 Ga0268265_11510180 3300028380 Bacteria 675
181 Ga0268264_10011351 3300028381 Bacteria 7358
182 Ga0268264_10103163 3300028381 Unclassified 2483
183 Ga0307515_10000133 3300028794 Bacteria 176091
184 Ga0307515_10327645 3300028794 Bacteria 1193
185 Ga0265338_10020127 3300028800 Bacteria 7035
186 Ga0307511_10000758 3300030521 Bacteria 34462
187 Ga0307509_10473465 3300031507 Bacteria 942
188 Ga0265313_10004104 3300031595 Bacteria 11341
189 Ga0307514_10093110 3300031649 Bacteria 2190
190 Ga0307414_10001102 3300032004 Bacteria 13800
191 Ga0307414_10103803 3300032004 Unclassified 2146
192 Ga0307414_11395792 3300032004 Bacteria 651
193 Ga0307510_10001013 3300033180 Bacteria 29784
194 Ga0395899_0001120 3300037312 Bacteria 23944
195 Ga0395899_0115243 3300037312 Bacteria 1929
196 Ga0395900_0013336 3300037418 Bacteria 8402
197 Ga0395900_0045558 3300037418 Bacteria 4517
198 Ga0395900_0103546 3300037418 Bacteria 2923
199 Ga0395900_0114671 3300037418 Bacteria 2765
200 Ga0395898_0001697 3300037466 Bacteria 29404
201 Ga0395901_0062593 3300038443 Bacteria 3872
202 Ga0395901_0328534 3300038443 Bacteria 1581
203 Ga0436360_0146578 3300039438 Bacteria 689
204 Ga0439439_0016144 3300041406 Unclassified 1827
205 Ga0451795_0089516 3300041456 Bacteria 1253
206 Ga0451795_0467188 3300041456 Unclassified 888
207 Ga0451807_2101291 3300041486 Unclassified 584
208 Ga0451807_2509534 3300041486 Unclassified 719
209 Ga0451847_1008741 3300041503 Bacteria 537
210 Ga0451855_0313388 3300041511 Unclassified 552
211 Ga0451855_1212610 3300041511 Bacteria 906
212 Ga0451855_1543451 3300041511 Bacteria 870
213 Ga0451853_2368613 3300041512 Bacteria 791
214 Ga0439462_0150419 3300042015 Bacteria 654
215 Ga0439434_0081566 3300042435 Unclassified 1027
216 Ga0466965_0027442 3300044683 Bacteria 2765
217 Ga0453684_0004858 3300044712 Bacteria 27581
218 Ga0453684_0006119 3300044712 Bacteria 23180
219 Ga0453684_1341019 3300044712 Bacteria 744
220 Ga0466968_0204687 3300044735 Bacteria 925
221 Ga0466970_0152435 3300044765 Bacteria 1276
222 Ga0466959_0579309 3300045049 Bacteria 756
223 Ga0466958_0061863 3300045836 Bacteria 2281
224 Ga0495643_0133695 3300046522 Unclassified 1243
225 Ga0495611_0254491 3300046648 Unclassified 814
226 Ga0495625_0757161 3300046660 Bacteria 569
227 Ga0495649_0042356 3300046694 Bacteria 2488
228 Ga0495649_0161846 3300046694 Bacteria 1173
229 Ga0495672_0005816 3300047320 Bacteria 9682
230 Ga0495686_0000010 3300047472 Bacteria 573229
231 Ga0501069_0170595 3300049585 Bacteria 1255
232 Ga0501044_0322531 3300049823 Bacteria 1469
233 nmdc:mga08y16_177043_c1 3300050511 Bacteria 2215
234 Ga0466962_0200545 3300061719 Bacteria 975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10000018 rootH2_100000184 150
2 3300003320 rootH2_10003786 rootH2_1000378620 150
3 3300003320 rootH2_10020473 rootH2_100204738 150
4 3300003320 rootH2_10090949 rootH2_100909495 150
5 3300005329 Ga0070683_100010781 Ga0070683_1000107819 150
6 3300005329 Ga0070683_100631077 Ga0070683_1006310771 150
7 3300005334 Ga0068869_100192719 Ga0068869_1001927191 150
8 3300005336 Ga0070680_100150745 Ga0070680_1001507452 150
9 3300005336 Ga0070680_100263146 Ga0070680_1002631462 150
10 3300005337 Ga0070682_100054851 Ga0070682_1000548514 150
11 3300005338 Ga0068868_100461745 Ga0068868_1004617451 150
12 3300005338 Ga0068868_101042686 Ga0068868_1010426861 150
13 3300005341 Ga0070691_10013381 Ga0070691_100133812 150
14 3300005341 Ga0070691_10074361 Ga0070691_100743612 150
15 3300005343 Ga0070687_100034872 Ga0070687_1000348724 150
16 3300005353 Ga0070669_100001567 Ga0070669_10000156710 150
17 3300005353 Ga0070669_100069962 Ga0070669_1000699623 150
18 3300005354 Ga0070675_101444877 Ga0070675_1014448771 150
19 3300005365 Ga0070688_100001624 Ga0070688_1000016249 150
20 3300005366 Ga0070659_100005677 Ga0070659_1000056774 150
21 3300005366 Ga0070659_100248510 Ga0070659_1002485102 150
22 3300005366 Ga0070659_101053943 Ga0070659_1010539431 150
23 3300005367 Ga0070667_100090919 Ga0070667_1000909192 150
24 3300005367 Ga0070667_100140971 Ga0070667_1001409712 150
25 3300005367 Ga0070667_101801730 Ga0070667_1018017301 150
26 3300005455 Ga0070663_100520318 Ga0070663_1005203181 150
27 3300005458 Ga0070681_10061279 Ga0070681_100612792 150
28 3300005458 Ga0070681_10152638 Ga0070681_101526382 150
29 3300005458 Ga0070681_10234153 Ga0070681_102341535 150
30 3300005530 Ga0070679_100001044 Ga0070679_1000010448 150
31 3300005530 Ga0070679_100029941 Ga0070679_1000299412 150
32 3300005530 Ga0070679_100522883 Ga0070679_1005228833 150
33 3300005535 Ga0070684_100014474 Ga0070684_1000144746 150
34 3300005536 Ga0070697_100279873 Ga0070697_1002798732 150
35 3300005539 Ga0068853_100738464 Ga0068853_1007384642 150
36 3300005548 Ga0070665_100927910 Ga0070665_1009279102 150
37 3300005563 Ga0068855_100003071 Ga0068855_10000307111 150
38 3300005563 Ga0068855_100003485 Ga0068855_10000348516 150
39 3300005563 Ga0068855_100118851 Ga0068855_1001188512 150
40 3300005563 Ga0068855_100730072 Ga0068855_1007300721 150
41 3300005577 Ga0068857_100111875 Ga0068857_1001118752 150
42 3300005577 Ga0068857_100336643 Ga0068857_1003366432 150
43 3300005577 Ga0068857_100624629 Ga0068857_1006246291 150
44 3300005578 Ga0068854_100263234 Ga0068854_1002632342 150
45 3300005578 Ga0068854_100376984 Ga0068854_1003769843 150
46 3300005578 Ga0068854_100490651 Ga0068854_1004906512 150
47 3300005614 Ga0068856_100108091 Ga0068856_1001080912 150
48 3300005614 Ga0068856_100166701 Ga0068856_1001667013 150
49 3300005614 Ga0068856_100587617 Ga0068856_1005876173 150
50 3300005616 Ga0068852_100001453 Ga0068852_1000014539 150
51 3300005616 Ga0068852_100023905 Ga0068852_1000239053 150
52 3300005616 Ga0068852_100400803 Ga0068852_1004008032 150
53 3300005618 Ga0068864_100089763 Ga0068864_1000897633 150
54 3300005719 Ga0068861_100016681 Ga0068861_1000166814 150
55 3300005840 Ga0068870_10094915 Ga0068870_100949151 150
56 3300005841 Ga0068863_100285588 Ga0068863_1002855883 150
57 3300005843 Ga0068860_100000759 Ga0068860_10000075922 150
58 3300005844 Ga0068862_101256380 Ga0068862_1012563801 150
59 3300005983 Ga0081540_1063441 Ga0081540_10634412 150
60 3300006237 Ga0097621_100237566 Ga0097621_1002375662 150
61 3300006881 Ga0068865_100428113 Ga0068865_1004281132 150
62 3300006931 Ga0097620_100289920 Ga0097620_1002899203 150
63 3300009093 Ga0105240_10000421 Ga0105240_1000042110 150
64 3300009093 Ga0105240_10111479 Ga0105240_101114793 150
65 3300009093 Ga0105240_10119719 Ga0105240_101197192 150
66 3300009093 Ga0105240_10225962 Ga0105240_102259622 150
67 3300009093 Ga0105240_10672775 Ga0105240_106727752 150
68 3300009094 Ga0111539_10155409 Ga0111539_101554095 150
69 3300009174 Ga0105241_10174306 Ga0105241_101743062 150
70 3300009174 Ga0105241_10391956 Ga0105241_103919562 150
71 3300009545 Ga0105237_10000726 Ga0105237_1000072626 150
72 3300009545 Ga0105237_10001602 Ga0105237_1000160210 150
73 3300009545 Ga0105237_10012702 Ga0105237_100127024 150
74 3300009545 Ga0105237_10080429 Ga0105237_100804292 150
75 3300009545 Ga0105237_11102011 Ga0105237_111020111 150
76 3300009551 Ga0105238_10052534 Ga0105238_100525342 150
77 3300009551 Ga0105238_10124217 Ga0105238_101242172 150
78 3300009551 Ga0105238_10425860 Ga0105238_104258602 150
79 3300009553 Ga0105249_10012787 Ga0105249_100127875 150
80 3300009553 Ga0105249_11391205 Ga0105249_113912052 150
81 3300010375 Ga0105239_10000283 Ga0105239_1000028356 150
82 3300010375 Ga0105239_10004632 Ga0105239_100046329 150
83 3300010375 Ga0105239_10009358 Ga0105239_100093581 150
84 3300010375 Ga0105239_10028577 Ga0105239_100285773 150
85 3300010375 Ga0105239_10461787 Ga0105239_104617872 150
86 3300010375 Ga0105239_10664685 Ga0105239_106646852 150
87 3300013100 Ga0157373_10247782 Ga0157373_102477821 150
88 3300013102 Ga0157371_10013472 Ga0157371_100134723 150
89 3300013102 Ga0157371_10027381 Ga0157371_100273812 150
90 3300013104 Ga0157370_10192967 Ga0157370_101929674 150
91 3300013104 Ga0157370_10439767 Ga0157370_104397672 150
92 3300013104 Ga0157370_10843393 Ga0157370_108433931 150
93 3300013105 Ga0157369_10108659 Ga0157369_101086593 150
94 3300013105 Ga0157369_10477090 Ga0157369_104770902 150
95 3300013296 Ga0157374_10000013 Ga0157374_10000013100 150
96 3300013297 Ga0157378_10081649 Ga0157378_100816492 150
97 3300013297 Ga0157378_10488364 Ga0157378_104883642 150
98 3300013306 Ga0163162_10027956 Ga0163162_100279562 150
99 3300013307 Ga0157372_10019020 Ga0157372_100190205 150
100 3300013307 Ga0157372_10022657 Ga0157372_100226577 150
101 3300013307 Ga0157372_10038565 Ga0157372_100385653 150
102 3300013307 Ga0157372_10180679 Ga0157372_101806792 150
103 3300013307 Ga0157372_10205421 Ga0157372_102054212 150
104 3300014325 Ga0163163_10056046 Ga0163163_100560465 150
105 3300014326 Ga0157380_10115181 Ga0157380_101151814 150
106 3300014745 Ga0157377_10354451 Ga0157377_103544512 150
107 3300014969 Ga0157376_10002704 Ga0157376_100027043 150
108 3300015261 Ga0182006_1004008 Ga0182006_10040082 150
109 3300025304 Ga0209257_1000007 Ga0209257_1000007283 150
110 3300025901 Ga0207688_10014454 Ga0207688_100144545 150
111 3300025904 Ga0207647_10066664 Ga0207647_100666643 150
112 3300025904 Ga0207647_10090674 Ga0207647_100906743 150
113 3300025909 Ga0207705_10066606 Ga0207705_100666063 150
114 3300025909 Ga0207705_10231644 Ga0207705_102316442 150
115 3300025909 Ga0207705_10468880 Ga0207705_104688801 150
116 3300025911 Ga0207654_10561205 Ga0207654_105612051 150
117 3300025912 Ga0207707_10041615 Ga0207707_100416152 150
118 3300025912 Ga0207707_10116929 Ga0207707_101169292 150
119 3300025912 Ga0207707_10223027 Ga0207707_102230275 150
120 3300025912 Ga0207707_10344071 Ga0207707_103440712 150
121 3300025913 Ga0207695_10000051 Ga0207695_10000051148 150
122 3300025913 Ga0207695_10000056 Ga0207695_1000005694 150
123 3300025913 Ga0207695_10000081 Ga0207695_10000081148 150
124 3300025913 Ga0207695_10000156 Ga0207695_10000156123 150
125 3300025913 Ga0207695_10029169 Ga0207695_100291695 150
126 3300025913 Ga0207695_10080012 Ga0207695_100800122 150
127 3300025913 Ga0207695_10095146 Ga0207695_100951463 150
128 3300025914 Ga0207671_10009059 Ga0207671_100090592 150
129 3300025914 Ga0207671_10045293 Ga0207671_100452932 150
130 3300025914 Ga0207671_10047105 Ga0207671_100471054 150
131 3300025917 Ga0207660_10016547 Ga0207660_100165472 150
132 3300025917 Ga0207660_11637445 Ga0207660_116374451 150
133 3300025919 Ga0207657_10002529 Ga0207657_1000252911 150
134 3300025919 Ga0207657_10054475 Ga0207657_100544754 150
135 3300025921 Ga0207652_10000051 Ga0207652_1000005135 150
136 3300025921 Ga0207652_10001036 Ga0207652_100010367 150
137 3300025921 Ga0207652_10027938 Ga0207652_100279383 150
138 3300025923 Ga0207681_10059996 Ga0207681_100599963 150
139 3300025923 Ga0207681_10065692 Ga0207681_100656924 150
140 3300025923 Ga0207681_11063136 Ga0207681_110631361 150
141 3300025924 Ga0207694_10178968 Ga0207694_101789682 150
142 3300025924 Ga0207694_10232809 Ga0207694_102328091 150
143 3300025925 Ga0207650_10262407 Ga0207650_102624072 150
144 3300025925 Ga0207650_10312077 Ga0207650_103120771 150
145 3300025932 Ga0207690_10007904 Ga0207690_100079043 150
146 3300025932 Ga0207690_10086326 Ga0207690_100863262 150
147 3300025933 Ga0207706_10020173 Ga0207706_100201736 150
148 3300025938 Ga0207704_10103319 Ga0207704_101033194 150
149 3300025942 Ga0207689_10079681 Ga0207689_100796813 150
150 3300025944 Ga0207661_10155820 Ga0207661_101558202 150
151 3300025944 Ga0207661_10356512 Ga0207661_103565123 150
152 3300025949 Ga0207667_10000180 Ga0207667_1000018077 150
153 3300025949 Ga0207667_10001783 Ga0207667_1000178321 150
154 3300025949 Ga0207667_10005333 Ga0207667_100053338 150
155 3300025949 Ga0207667_10155880 Ga0207667_101558802 150
156 3300025961 Ga0207712_10071949 Ga0207712_100719494 150
157 3300025961 Ga0207712_10752028 Ga0207712_107520282 150
158 3300025981 Ga0207640_10167214 Ga0207640_101672143 150
159 3300025986 Ga0207658_10061986 Ga0207658_100619863 150
160 3300025986 Ga0207658_10601579 Ga0207658_106015792 150
161 3300026023 Ga0207677_10415250 Ga0207677_104152501 150
162 3300026023 Ga0207677_10827247 Ga0207677_108272471 150
163 3300026041 Ga0207639_10138696 Ga0207639_101386962 150
164 3300026067 Ga0207678_10335599 Ga0207678_103355992 150
165 3300026067 Ga0207678_10351518 Ga0207678_103515182 150
166 3300026067 Ga0207678_10428771 Ga0207678_104287712 150
167 3300026078 Ga0207702_10083067 Ga0207702_100830672 150
168 3300026078 Ga0207702_10175447 Ga0207702_101754473 150
169 3300026078 Ga0207702_10810758 Ga0207702_108107582 150
170 3300026088 Ga0207641_10306908 Ga0207641_103069082 150
171 3300026116 Ga0207674_10012528 Ga0207674_1001252810 150
172 3300026116 Ga0207674_10061101 Ga0207674_100611014 150
173 3300026116 Ga0207674_10536496 Ga0207674_105364962 150
174 3300026116 Ga0207674_10807822 Ga0207674_108078222 150
175 3300026118 Ga0207675_100000085 Ga0207675_10000008512 150
176 3300026142 Ga0207698_10033202 Ga0207698_100332022 150
177 3300026142 Ga0207698_10073898 Ga0207698_100738982 150
178 3300026142 Ga0207698_10233968 Ga0207698_102339682 150
179 3300027907 Ga0207428_10054199 Ga0207428_100541994 150
180 3300028380 Ga0268265_11510180 Ga0268265_115101802 150
181 3300028381 Ga0268264_10011351 Ga0268264_100113516 150
182 3300028381 Ga0268264_10103163 Ga0268264_101031632 150
183 3300028794 Ga0307515_10000133 Ga0307515_1000013357 150
184 3300028794 Ga0307515_10327645 Ga0307515_103276451 150
185 3300028800 Ga0265338_10020127 Ga0265338_100201275 150
186 3300030521 Ga0307511_10000758 Ga0307511_1000075827 150
187 3300031507 Ga0307509_10473465 Ga0307509_104734652 150
188 3300031595 Ga0265313_10004104 Ga0265313_100041044 150
189 3300031649 Ga0307514_10093110 Ga0307514_100931102 150
190 3300032004 Ga0307414_10001102 Ga0307414_100011023 150
191 3300032004 Ga0307414_10103803 Ga0307414_101038032 150
192 3300032004 Ga0307414_11395792 Ga0307414_113957921 150
193 3300033180 Ga0307510_10001013 Ga0307510_1000101324 150
194 3300037312 Ga0395899_0001120 Ga0395899_0001120_2609_3061 150
195 3300037312 Ga0395899_0115243 Ga0395899_0115243_1458_1910 150
196 3300037418 Ga0395900_0013336 Ga0395900_0013336_2059_2511 150
197 3300037418 Ga0395900_0045558 Ga0395900_0045558_3997_4449 150
198 3300037418 Ga0395900_0103546 Ga0395900_0103546_1399_1851 150
199 3300037418 Ga0395900_0114671 Ga0395900_0114671_1399_1851 150
200 3300037466 Ga0395898_0001697 Ga0395898_0001697_7906_8358 150
201 3300038443 Ga0395901_0062593 Ga0395901_0062593_700_1152 150
202 3300038443 Ga0395901_0328534 Ga0395901_0328534_59_511 150
203 3300039438 Ga0436360_0146578 Ga0436360_0146578_211_663 150
204 3300041406 Ga0439439_0016144 Ga0439439_0016144_1317_1769 150
205 3300041456 Ga0451795_0089516 Ga0451795_0089516_626_1078 150
206 3300041456 Ga0451795_0467188 Ga0451795_0467188_65_517 150
207 3300041486 Ga0451807_2101291 Ga0451807_2101291_61_513 150
208 3300041486 Ga0451807_2509534 Ga0451807_2509534_49_501 150
209 3300041503 Ga0451847_1008741 Ga0451847_1008741_28_480 150
210 3300041511 Ga0451855_0313388 Ga0451855_0313388_40_492 150
211 3300041511 Ga0451855_1212610 Ga0451855_1212610_404_856 150
212 3300041511 Ga0451855_1543451 Ga0451855_1543451_113_565 150
213 3300041512 Ga0451853_2368613 Ga0451853_2368613_41_493 150
214 3300042015 Ga0439462_0150419 Ga0439462_0150419_89_541 150
215 3300042435 Ga0439434_0081566 Ga0439434_0081566_527_979 150
216 3300044683 Ga0466965_0027442 Ga0466965_0027442_212_664 150
217 3300044712 Ga0453684_0004858 Ga0453684_0004858_19497_19949 150
218 3300044712 Ga0453684_0006119 Ga0453684_0006119_18828_19280 150
219 3300044712 Ga0453684_1341019 Ga0453684_1341019_251_703 150
220 3300044735 Ga0466968_0204687 Ga0466968_0204687_214_666 150
221 3300044765 Ga0466970_0152435 Ga0466970_0152435_792_1244 150
222 3300045049 Ga0466959_0579309 Ga0466959_0579309_74_628 150
223 3300045836 Ga0466958_0061863 Ga0466958_0061863_238_690 150
224 3300046522 Ga0495643_0133695 Ga0495643_0133695_47_499 150
225 3300046648 Ga0495611_0254491 Ga0495611_0254491_129_581 150
226 3300046660 Ga0495625_0757161 Ga0495625_0757161_54_506 150
227 3300046694 Ga0495649_0042356 Ga0495649_0042356_159_611 150
228 3300046694 Ga0495649_0161846 Ga0495649_0161846_83_535 150
229 3300047320 Ga0495672_0005816 Ga0495672_0005816_3576_4028 150
230 3300047472 Ga0495686_0000010 Ga0495686_0000010_219438_219890 150
231 3300049585 Ga0501069_0170595 Ga0501069_0170595_573_1025 150
232 3300049823 Ga0501044_0322531 Ga0501044_0322531_297_749 150
233 3300050511 nmdc:mga08y16_177043_c1 nmdc:mga08y16_177043_c1_1601_2053 150
234 3300061719 Ga0466962_0200545 Ga0466962_0200545_112_666 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

36

179

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmv-assembly3.cif.gz_E d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9207 1 147
3ko7-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-lysine 0.9136 1 148
3lmv-assembly3.cif.gz_E d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9075 1 147
3ko7-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-lysine 0.9014 1 148
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.8918 1 144
ID Description Score Start End Superfamily
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8923 1 147 3.50.80.10
af_F1QGC8_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8899 1 145 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8871 1 147 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8857 1 147 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.8849 1 145 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A7Y3ENM8-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9977 1 78 GO:0005737
GO:0051500
AF-A0A7Y3ENM8-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9851 1 78 GO:0005737
GO:0051500
AF-A0A2E6E5C7-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9701 1 80 GO:0005737
GO:0051500
AF-W0HR39-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9617 1 144 GO:0005737
GO:0051500
AF-A0A2E6E5C7-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9584 1 80 GO:0005737
GO:0051500

Feature Viewer

pLDDT pTM Quality
88.31 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map