F347495

General Info

Members Datasets Scaffolds Average Seq Length
234 186 468 346

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0044414|Ga0501034_0044414_3143_4300
Length 385
Sequence MDPTVMIMAKTGTGRSLRPPRRPPLSARTRALFLVLAALLATVPALALVVTAGGTAEAHGTPMKPGSRTFLCWQDALTDTGEIKPVNSACKAAAQIGGTTPFYNWFSVLRSDGAGRTRGFVPDGELCSGGNANFSGFDAARDDWPVTHLTSGATVDFSYNAWAAHPGWFYVYVSKDGYDPTQPLTWDDLEDEPFLSVDHPPLHGSPGTVEANYSWSGQLPSGKSGRHLIYMVWQRSDSAETFYSCSDVVFDGGNGEVTGVHQSGGGDGDDXGSTDPGSEPSDPVLGACTATRQTTGSWSGGYQSEVTVTNSGDVPMLGWMVDWTLPSGQKVDSLWSGNATYSGQDVMVHNADWNGSLDPGESATFGYVTTGADGDSTTSLPCQVG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
12 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
16 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
36 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
42 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
43 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
44 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
45 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
86 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
111 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
114 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
115 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
116 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
117 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
118 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
121 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
127 2558860280 Kutzneria sp. 744 Isolate Unclassified
128 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
129 2643221548 Streptomyces sp. Root55 Isolate Unclassified
130 2643221647 Streptomyces sp. Root369 Isolate Unclassified
131 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
132 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
133 2643221714 Streptomyces sp. Root264 Isolate Unclassified
134 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
135 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
136 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
137 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
138 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
139 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
140 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
141 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
142 2808606448 Streptomyces sp. 193411 Isolate Unclassified
143 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
144 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
145 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
146 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
147 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
148 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
149 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
150 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
151 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
152 2867428634 Streptomyces sp. RP5T Isolate Unclassified
153 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
154 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
155 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
156 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
157 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
158 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
159 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
160 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
161 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
162 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
163 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
164 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
165 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
166 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
167 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
168 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
169 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
170 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
171 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
172 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
173 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
174 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
175 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
176 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
177 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
178 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
179 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
180 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
181 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
182 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
183 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
184 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
185 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
186 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 68.8
Metatranscriptomes 3.42
Isolates 27.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0.85
Rhizoplane 0.85
Rhizosphere 69.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0044414 3300049571 Bacteria 4495
2 JGI24737J22298_10033499 3300001990 Bacteria 1596
3 rootH1_10011340 3300003323 Bacteria 2881
4 Ga0070714_100033346 3300005435 Bacteria 4304
5 Ga0070663_100000420 3300005455 Bacteria 22378
6 Ga0070678_100263650 3300005456 Bacteria 1450
7 Ga0068854_100183066 3300005578 Bacteria 1638
8 Ga0081455_10056002 3300005937 Bacteria 3350
9 Ga0075363_100137975 3300006048 Bacteria 1371
10 Ga0075428_100000233 3300006844 Bacteria 54028
11 Ga0075428_100291363 3300006844 Bacteria 1755
12 Ga0075431_100014633 3300006847 Bacteria 7938
13 Ga0075431_100283620 3300006847 Bacteria 1677
14 Ga0075429_100066561 3300006880 Bacteria 3137
15 Ga0183367_1001 3300015688 Bacteria 1225545
16 Ga0206356_11900115 3300020070 Bacteria 1208
17 Ga0207426_1037412 3300025302 Bacteria 1535
18 Ga0207647_10155160 3300025904 Bacteria 1337
19 Ga0207668_10030726 3300025972 Bacteria 3532
20 Ga0207678_10000514 3300026067 Bacteria 35082
21 Ga0207683_10143076 3300026121 Bacteria 2155
22 Ga0209371_1012708 3300027312 Bacteria 2417
23 Ga0307517_10001330 3300028786 Bacteria 41532
24 Ga0307515_10001777 3300028794 Bacteria 48014
25 Ga0307515_10109756 3300028794 Bacteria 3237
26 Ga0307515_10138028 3300028794 Bacteria 2635
27 Ga0268256_1013879 3300030500 Bacteria 2417
28 Ga0307511_10000713 3300030521 Bacteria 35403
29 Ga0307511_10145179 3300030521 Bacteria 1381
30 Ga0307513_10108557 3300031456 Bacteria 2775
31 Ga0307509_10012236 3300031507 Bacteria 10292
32 Ga0307509_10020226 3300031507 Bacteria 7559
33 Ga0307508_10045254 3300031616 Bacteria 3932
34 Ga0307508_10091319 3300031616 Bacteria 2633
35 Ga0307508_10096051 3300031616 Bacteria 2554
36 Ga0307514_10044391 3300031649 Bacteria 3482
37 Ga0307514_10135808 3300031649 Bacteria 1683
38 Ga0307516_10011520 3300031730 Bacteria 9598
39 Ga0307516_10052155 3300031730 Bacteria 4006
40 Ga0307516_10154330 3300031730 Bacteria 2053
41 Ga0307516_10159413 3300031730 Bacteria 2008
42 Ga0307407_10164325 3300031903 Bacteria 1456
43 Ga0307409_100017851 3300031995 Bacteria 4745
44 Ga0307415_100000012 3300032126 Bacteria 84249
45 Ga0307507_10089547 3300033179 Bacteria 2647
46 Ga0307510_10016185 3300033180 Bacteria 8808
47 Ga0307510_10021531 3300033180 Bacteria 7512
48 Ga0395898_0001533 3300037466 Bacteria 31819
49 Ga0451837_0342941 3300041494 Bacteria 2755
50 Ga0451853_0651619 3300041512 Bacteria 12203
51 Ga0439433_0006440 3300041999 Bacteria 2527
52 Ga0439449_0000421 3300042007 Bacteria 15658
53 Ga0439457_002192 3300042014 Bacteria 5646
54 Ga0439457_004510 3300042014 Bacteria 3613
55 Ga0439457_008095 3300042014 Bacteria 2492
56 Ga0450898_003624 3300042134 Bacteria 2230
57 Ga0450899_002858 3300042135 Bacteria 1869
58 Ga0450900_001404 3300042136 Bacteria 2344
59 Ga0450903_002988 3300042138 Bacteria 2953
60 Ga0450907_016602 3300042146 Bacteria 1228
61 Ga0439458_0002746 3300042157 Bacteria 4243
62 Ga0450908_023766 3300042184 Bacteria 1072
63 Ga0466972_0002333 3300044658 Bacteria 9346
64 Ga0466965_0001745 3300044683 Bacteria 8970
65 Ga0466966_0214152 3300044684 Bacteria 1164
66 Ga0466961_0016555 3300044693 Bacteria 4738
67 Ga0466963_0000462 3300044694 Bacteria 18891
68 Ga0466963_0036604 3300044694 Bacteria 3201
69 Ga0466964_0016756 3300044706 Bacteria 2800
70 Ga0466970_0003494 3300044765 Bacteria 7663
71 Ga0466970_0013450 3300044765 Bacteria 4195
72 Ga0466970_0105585 3300044765 Bacteria 1536
73 Ga0466958_0002713 3300045836 Bacteria 8971
74 Ga0466967_0002112 3300045976 Bacteria 12195
75 Ga0466967_0132260 3300045976 Bacteria 2317
76 Ga0466967_0331047 3300045976 Bacteria 1471
77 Ga0495603_0072697 3300046455 Bacteria 2020
78 Ga0495629_0039152 3300046459 Bacteria 3337
79 Ga0495629_0143116 3300046459 Bacteria 1663
80 Ga0495629_0226323 3300046459 Bacteria 1289
81 Ga0495638_0039232 3300046460 Bacteria 3007
82 Ga0495638_0183001 3300046460 Bacteria 1194
83 Ga0495662_0015003 3300046476 Bacteria 3764
84 Ga0495662_0100505 3300046476 Bacteria 1415
85 Ga0495585_0078648 3300046492 Bacteria 1789
86 Ga0495594_0011836 3300046499 Bacteria 4538
87 Ga0495594_0032983 3300046499 Bacteria 2813
88 Ga0495594_0084726 3300046499 Bacteria 1772
89 Ga0495606_0002180 3300046507 Bacteria 23512
90 Ga0495620_0032355 3300046515 Bacteria 2384
91 Ga0495631_0031161 3300046518 Bacteria 2415
92 Ga0495632_0036306 3300046519 Bacteria 2508
93 Ga0495637_0081984 3300046520 Bacteria 1285
94 Ga0495648_0101386 3300046524 Bacteria 1588
95 Ga0495652_0174837 3300046529 Bacteria 1654
96 Ga0495597_0006388 3300046542 Bacteria 6099
97 Ga0495622_0071696 3300046557 Bacteria 1598
98 Ga0495633_0073559 3300046558 Bacteria 1593
99 Ga0495668_0000270 3300046616 Bacteria 73208
100 Ga0495668_0048374 3300046616 Bacteria 2360
101 Ga0495668_0177583 3300046616 Bacteria 1166
102 Ga0495634_0096894 3300046642 Bacteria 1910
103 Ga0495625_0000413 3300046660 Bacteria 64679
104 Ga0495625_0039276 3300046660 Bacteria 3457
105 Ga0495625_0043337 3300046660 Bacteria 3263
106 Ga0495625_0152244 3300046660 Bacteria 1554
107 Ga0495588_0006062 3300046674 Bacteria 5424
108 Ga0495588_0047841 3300046674 Bacteria 2196
109 Ga0495657_0027457 3300046675 Bacteria 4016
110 Ga0495657_0085991 3300046675 Bacteria 2027
111 Ga0495671_0075650 3300046692 Bacteria 1651
112 Ga0495589_0008250 3300046794 Bacteria 5441
113 Ga0495589_0106452 3300046794 Bacteria 1355
114 Ga0495660_0029596 3300046810 Bacteria 3088
115 Ga0495660_0154540 3300046810 Bacteria 1130
116 Ga0495581_0041212 3300047315 Bacteria 2672
117 Ga0495636_0045862 3300047318 Bacteria 1822
118 Ga0495683_0041721 3300047323 Bacteria 2314
119 Ga0495687_013976 3300047443 Bacteria 4154
120 Ga0495687_054380 3300047443 Bacteria 1680
121 Ga0495677_0098761 3300047445 Bacteria 1104
122 Ga0495685_001021 3300047447 Bacteria 8536
123 Ga0495685_051743 3300047447 Bacteria 1392
124 Ga0495681_0000526 3300047470 Bacteria 29214
125 Ga0495681_0007486 3300047470 Bacteria 6964
126 Ga0495686_0093350 3300047472 Bacteria 1825
127 Ga0495686_0154907 3300047472 Bacteria 1343
128 Ga0495626_0000153 3300048091 Bacteria 85626
129 Ga0495626_0010401 3300048091 Bacteria 4965
130 Ga0496108_0183789 3300048911 Bacteria 1811
131 Ga0501308_004449 3300049128 Bacteria 1352
132 Ga0501308_005046 3300049128 Bacteria 1299
133 Ga0501304_003708 3300049160 Bacteria 1130
134 Ga0501307_005070 3300049162 Bacteria 1374
135 Ga0501031_0009096 3300049568 Bacteria 6460
136 Ga0501032_0006272 3300049569 Bacteria 8757
137 Ga0501033_0132827 3300049570 Bacteria 1802
138 Ga0501034_0002224 3300049571 Bacteria 23920
139 Ga0501036_0011036 3300049572 Bacteria 7472
140 Ga0501037_0065486 3300049573 Bacteria 2647
141 Ga0501043_0018102 3300049579 Bacteria 5524
142 Ga0501047_0020941 3300049581 Bacteria 6281
143 Ga0501047_0173815 3300049581 Bacteria 2022
144 Ga0501048_0004550 3300049582 Bacteria 10547
145 Ga0501035_0034999 3300049822 Bacteria 4562
146 Ga0501035_0364478 3300049822 Bacteria 1207
147 Ga0501044_0082383 3300049823 Bacteria 3255
148 nmdc:mga06z11_18231_c1 3300050494 Bacteria 3202
149 nmdc:mga04h51_13468_c1 3300050495 Bacteria 2316
150 nmdc:mga07m45_90288_c1 3300050496 Bacteria 1755
151 nmdc:mga09592_48740_c1 3300050508 Bacteria 3571
152 nmdc:mga0qj67_194217_c1 3300050509 Bacteria 1649
153 nmdc:mga06r32_171999_c1 3300050510 Bacteria 2150
154 Ga0500610_0183213 3300053079 Bacteria 1023
155 Ga0495655_0020809 3300053083 Bacteria 1477
156 Ga0500578_0128179 3300053086 Bacteria 1592
157 Ga0500566_0043589 3300053094 Bacteria 2585
158 Ga0500654_010419 3300053099 Bacteria 6308
159 Ga0500560_001529 3300053107 Bacteria 4062
160 Ga0500561_0008376 3300053137 Bacteria 2057
161 Ga0500588_0001683 3300053146 Bacteria 4279
162 Ga0500600_0017929 3300053149 Bacteria 4274
163 Ga0500616_0053034 3300053153 Bacteria 2129
164 Ga0500633_0113490 3300053160 Bacteria 1005
165 Ga0587082_006922 3300059504 Bacteria 1530
166 Ga0587107_005524 3300059652 Bacteria 1341
167 Ga0587108_002853 3300059653 Bacteria 1186
168 Ga0466962_0000558 3300061719 Bacteria 16367
169 Ga0530510_0103430 3300061734 Bacteria 2083
170 2547409056 2547132111 Bacteria 8013147
171 2559423191 2558860280 Bacteria 11429938
172 2585307374 2582581313 Bacteria 10042643
173 2643761758 2643221548 Bacteria 8053412
174 2644264911 2643221647 Bacteria 10741251
175 2644442462 2643221678 Bacteria 9540101
176 2644460814 2643221682 Bacteria 6743283
177 2644626621 2643221714 Bacteria 9015452
178 2676490376 2675903060 Bacteria 10051191
179 2784586446 2784132148 Bacteria 8627943
180 2785340565 2784746763 Bacteria 9783172
181 2785372185 2784746768 Bacteria 10036182
182 2786673263 2786546132 Bacteria 10419719
183 2793983983 2791355406 Bacteria 11364898
184 2808844637 2808606359 Bacteria 9866990
185 2808914201 2808606375 Bacteria 9466072
186 2809229958 2808606448 Bacteria 8656184
187 2812355315 2811994879 Bacteria 9313447
188 2812476938 2811994917 Bacteria 7761064
189 2812478053 2811994917 Bacteria 7761064
190 2819696813 2818991463 Bacteria 7948711
191 2852638805 2852635781 Bacteria 8251373
192 2856741310 2856741275 Bacteria 8096094
193 2862284040 2862281513 Bacteria 9621493
194 2862387353 2862382967 Bacteria 10317375
195 2862508841 2862507626 Bacteria 9425308
196 2862514034 2862507626 Bacteria 9425308
197 2863409289 2863404153 Bacteria 9672205
198 2867437556 2867428634 Bacteria 9590268
199 2873159020 2873151551 Bacteria 8625867
200 2877678454 2877676314 Bacteria 9512378
201 2912716961 2912715099 Bacteria 9460473
202 2915774660 2915768154 Bacteria 8424322
203 2919474830 2919468124 Bacteria 9133025
204 2946046475 2946045630 Bacteria 8527308
205 2946070575 2946064051 Bacteria 8957905
206 2946078315 2946072368 Bacteria 8999607
207 2947226266 2947224130 Bacteria 9938529
208 2954010413 2954002825 Bacteria 9173742
209 2954383406 2954380949 Bacteria 10050426
210 2954679564 2954673503 Bacteria 9685905
211 2954684589 2954682443 Bacteria 9862841
212 2954694119 2954691527 Bacteria 10720516
213 2954709226 2954701450 Bacteria 10834262
214 2954713723 2954711539 Bacteria 10867210
215 2954723686 2954721474 Bacteria 10456478
216 2954738147 2954731030 Bacteria 10243860
217 2954742589 2954740390 Bacteria 10229294
218 2954757005 2954749733 Bacteria 10366972
219 2954761553 2954759201 Bacteria 9358192
220 2966600184 2966598605 Bacteria 7676064
221 2966605422 2966598605 Bacteria 7676064
222 2990067172 2990059506 Bacteria 9321252
223 3006497077 3006493962 Bacteria 8825450
224 8003315626 8003314358 Bacteria 10575343
225 8003320712 8003314358 Bacteria 10575343
226 8008563559 8008558824 Bacteria 10610750
227 8008581680 8008574985 Bacteria 7815457
228 8023628698 8023623736 Bacteria 8593882
229 8047895478 8047893842 Bacteria 11723082
230 8048136524 8048127548 Bacteria 11053136
231 8048363476 8048356638 Bacteria 11044339
232 8048372503 8048369669 Bacteria 11666822
233 8048381437 8048379754 Bacteria 11877923
234 8048409373 8048406513 Bacteria 8936924
235 Ga0501034_0044414
236 JGI24737J22298_10033499
237 rootH1_10011340
238 Ga0070714_100033346
239 Ga0070663_100000420
240 Ga0070678_100263650
241 Ga0068854_100183066
242 Ga0081455_10056002
243 Ga0075363_100137975
244 Ga0075428_100000233
245 Ga0075428_100291363
246 Ga0075431_100014633
247 Ga0075431_100283620
248 Ga0075429_100066561
249 Ga0183367_1001
250 Ga0206356_11900115
251 Ga0207426_1037412
252 Ga0207647_10155160
253 Ga0207668_10030726
254 Ga0207678_10000514
255 Ga0207683_10143076
256 Ga0209371_1012708
257 Ga0307517_10001330
258 Ga0307515_10001777
259 Ga0307515_10109756
260 Ga0307515_10138028
261 Ga0268256_1013879
262 Ga0307511_10000713
263 Ga0307511_10145179
264 Ga0307513_10108557
265 Ga0307509_10012236
266 Ga0307509_10020226
267 Ga0307508_10045254
268 Ga0307508_10091319
269 Ga0307508_10096051
270 Ga0307514_10044391
271 Ga0307514_10135808
272 Ga0307516_10011520
273 Ga0307516_10052155
274 Ga0307516_10154330
275 Ga0307516_10159413
276 Ga0307407_10164325
277 Ga0307409_100017851
278 Ga0307415_100000012
279 Ga0307507_10089547
280 Ga0307510_10016185
281 Ga0307510_10021531
282 Ga0395898_0001533
283 Ga0451837_0342941
284 Ga0451853_0651619
285 Ga0439433_0006440
286 Ga0439449_0000421
287 Ga0439457_002192
288 Ga0439457_004510
289 Ga0439457_008095
290 Ga0450898_003624
291 Ga0450899_002858
292 Ga0450900_001404
293 Ga0450903_002988
294 Ga0450907_016602
295 Ga0439458_0002746
296 Ga0450908_023766
297 Ga0466972_0002333
298 Ga0466965_0001745
299 Ga0466966_0214152
300 Ga0466961_0016555
301 Ga0466963_0000462
302 Ga0466963_0036604
303 Ga0466964_0016756
304 Ga0466970_0003494
305 Ga0466970_0013450
306 Ga0466970_0105585
307 Ga0466958_0002713
308 Ga0466967_0002112
309 Ga0466967_0132260
310 Ga0466967_0331047
311 Ga0495603_0072697
312 Ga0495629_0039152
313 Ga0495629_0143116
314 Ga0495629_0226323
315 Ga0495638_0039232
316 Ga0495638_0183001
317 Ga0495662_0015003
318 Ga0495662_0100505
319 Ga0495585_0078648
320 Ga0495594_0011836
321 Ga0495594_0032983
322 Ga0495594_0084726
323 Ga0495606_0002180
324 Ga0495620_0032355
325 Ga0495631_0031161
326 Ga0495632_0036306
327 Ga0495637_0081984
328 Ga0495648_0101386
329 Ga0495652_0174837
330 Ga0495597_0006388
331 Ga0495622_0071696
332 Ga0495633_0073559
333 Ga0495668_0000270
334 Ga0495668_0048374
335 Ga0495668_0177583
336 Ga0495634_0096894
337 Ga0495625_0000413
338 Ga0495625_0039276
339 Ga0495625_0043337
340 Ga0495625_0152244
341 Ga0495588_0006062
342 Ga0495588_0047841
343 Ga0495657_0027457
344 Ga0495657_0085991
345 Ga0495671_0075650
346 Ga0495589_0008250
347 Ga0495589_0106452
348 Ga0495660_0029596
349 Ga0495660_0154540
350 Ga0495581_0041212
351 Ga0495636_0045862
352 Ga0495683_0041721
353 Ga0495687_013976
354 Ga0495687_054380
355 Ga0495677_0098761
356 Ga0495685_001021
357 Ga0495685_051743
358 Ga0495681_0000526
359 Ga0495681_0007486
360 Ga0495686_0093350
361 Ga0495686_0154907
362 Ga0495626_0000153
363 Ga0495626_0010401
364 Ga0496108_0183789
365 Ga0501308_004449
366 Ga0501308_005046
367 Ga0501304_003708
368 Ga0501307_005070
369 Ga0501031_0009096
370 Ga0501032_0006272
371 Ga0501033_0132827
372 Ga0501034_0002224
373 Ga0501036_0011036
374 Ga0501037_0065486
375 Ga0501043_0018102
376 Ga0501047_0020941
377 Ga0501047_0173815
378 Ga0501048_0004550
379 Ga0501035_0034999
380 Ga0501035_0364478
381 Ga0501044_0082383
382 nmdc:mga06z11_18231_c1
383 nmdc:mga04h51_13468_c1
384 nmdc:mga07m45_90288_c1
385 nmdc:mga09592_48740_c1
386 nmdc:mga0qj67_194217_c1
387 nmdc:mga06r32_171999_c1
388 Ga0500610_0183213
389 Ga0495655_0020809
390 Ga0500578_0128179
391 Ga0500566_0043589
392 Ga0500654_010419
393 Ga0500560_001529
394 Ga0500561_0008376
395 Ga0500588_0001683
396 Ga0500600_0017929
397 Ga0500616_0053034
398 Ga0500633_0113490
399 Ga0587082_006922
400 Ga0587107_005524
401 Ga0587108_002853
402 Ga0466962_0000558
403 Ga0530510_0103430
404 2547409056
405 2559423191
406 2585307374
407 2643761758
408 2644264911
409 2644442462
410 2644460814
411 2644626621
412 2676490376
413 2784586446
414 2785340565
415 2785372185
416 2786673263
417 2793983983
418 2808844637
419 2808914201
420 2809229958
421 2812355315
422 2812476938
423 2812478053
424 2819696813
425 2852638805
426 2856741310
427 2862284040
428 2862387353
429 2862508841
430 2862514034
431 2863409289
432 2867437556
433 2873159020
434 2877678454
435 2912716961
436 2915774660
437 2919474830
438 2946046475
439 2946070575
440 2946078315
441 2947226266
442 2954010413
443 2954383406
444 2954679564
445 2954684589
446 2954694119
447 2954709226
448 2954713723
449 2954723686
450 2954738147
451 2954742589
452 2954757005
453 2954761553
454 2966600184
455 2966605422
456 2990067172
457 3006497077
458 8003315626
459 8003320712
460 8008563559
461 8008581680
462 8023628698
463 8047895478
464 8048136524
465 8048363476
466 8048372503
467 8048381437
468 8048409373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03067

LPMO_10

Lytic polysaccharide mono-oxygenase, cellulose-degrading

59

248

0.97

PF00553

CBM_2

Cellulose binding domain

288

385

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oy7-assembly4.cif.gz_D structure of cellulose active lpmo cels2 (sclpmo10c) in complex with copper. 0.9648 45 239
6if7-assembly1.cif.gz_A crystal structure of aa10 lytic polysaccharide monooxygenase from tectaria macrodonta 0.9583 45 236
4oy7-assembly4.cif.gz_D structure of cellulose active lpmo cels2 (sclpmo10c) in complex with copper. 0.9552 45 239
6if7-assembly1.cif.gz_A crystal structure of aa10 lytic polysaccharide monooxygenase from tectaria macrodonta 0.9481 45 236
7zjb-assembly1.cif.gz_B structural and functional characterization of the bacterial lytic polysaccharide monooxygenase sclpmo10d 0.9425 45 236
ID Description Score Start End Superfamily
4oy7F00 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1;chitin-binding protein cbp21 0.9639 45 238 2.70.50.50
6if7A00 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1;chitin-binding protein cbp21 0.9583 45 236 2.70.50.50
4oy7F00 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1;chitin-binding protein cbp21 0.9543 45 238 2.70.50.50
6if7A00 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1;chitin-binding protein cbp21 0.9481 45 236 2.70.50.50
3icgA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.872 260 356 2.60.40.290
ID Description Score Start End GO Terms
AF-A0A3D0R0U9-F1-model_v4 Chitin-binding protein 0.9525 39 150
AF-A0A4R4P8N9-F1-model_v4 Chitin-binding protein 0.9495 40 244
AF-A0A420UU61-F1-model_v4 Chitin-binding protein 0.9474 39 244
AF-A0A1I0L8S2-F1-model_v4 Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family 0.9464 257 356 GO:0004553
GO:0005975
GO:0016020
GO:0016810
GO:0030247
GO:0052689
AF-A0A1Q8CUZ1-F1-model_v4 Cell wall protein 0.9432 39 236

Map