F347643

General Info

Members Datasets Scaffolds Average Seq Length
234 163 203 405

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002784119|8002788079
Length 454
Sequence VICEPVRTAVGGYGGALKALAAHELGATVVRGLLERTGLASSDVDDVLFGSCYPTMEAPALGRVVALDAGLDIDVPGLQLDRRCGSGVQTVTMAAMLVQTGVADVVIAGGAESMSNAAFYSTEMRWGIRGGAVELRDALARGRLTAGGRRFPVPGGMIETAENLRREYEISRSEQDEFALRSHRRAVDAQRSGRFADEIIPVAVPARGGEVVVDADEHPRADTTIEKLAGLRPILGRSDPAATVTAGNASGQNDGAAACVVTHPDEAERLGLRPLARLVSWAVAGVEPARMGIGPVPATAKALERAGLTMADLDLIELNEAFAAQVLACGRAWGFGEKDWDRVNVNGSGISLGHPVGGAGGGGGPARGGGGGGGGAPRGGGVGLYGGARGQRNGGGQLVGPPGRAPGGPHTRDHGAGNAPARRAIRPGDAVHRRRPGNRRDTRTPRLSTQSTRA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2517572101 Frankia sp. DC12 Isolate Nodule
5 2547132424 Nocardia nova SH22a Isolate Unclassified
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2671180195 Frankia sp. CcI49 Isolate Nodule
10 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
11 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
12 2687453737 Frankia sp. BMG5.36 Isolate Nodule
13 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
14 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
15 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
16 2773857922 Frankia sp. CcI49 Isolate Nodule
17 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
18 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
19 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
20 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
21 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
22 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
153 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 8002775197 Frankia nepalensis CN7 Isolate Nodule
159 8002784119 Frankia sp. AgB1.9 Isolate Nodule
160 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
161 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
162 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
163 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.75
Metatranscriptomes 0
Isolates 13.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 6.41
Rhizoplane 4.7
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100019243 3300005336 Bacteria 5410
2 Ga0070667_100126610 3300005367 Bacteria 2226
3 Ga0070711_100090014 3300005439 Bacteria 2209
4 Ga0070681_10000016 3300005458 Bacteria 126919
5 Ga0070707_100011774 3300005468 Bacteria 8164
6 Ga0070699_100003408 3300005518 Bacteria 14064
7 Ga0070679_100000105 3300005530 Bacteria 65645
8 Ga0070665_100001693 3300005548 Bacteria 25360
9 Ga0068859_100000055 3300005617 Bacteria 119802
10 Ga0068859_100019514 3300005617 Bacteria 6811
11 Ga0068859_100052098 3300005617 Bacteria 4115
12 Ga0068864_100000832 3300005618 Bacteria 26051
13 Ga0068863_100000126 3300005841 Bacteria 80622
14 Ga0068863_100000749 3300005841 Bacteria 32440
15 Ga0068863_100034341 3300005841 Bacteria 4832
16 Ga0068858_100000196 3300005842 Bacteria 64743
17 Ga0068860_100001767 3300005843 Bacteria 23066
18 Ga0068862_100000087 3300005844 Bacteria 110040
19 Ga0081455_10000005 3300005937 Bacteria 327136
20 Ga0081455_10003956 3300005937 Bacteria 16827
21 Ga0081539_10001113 3300005985 Bacteria 48761
22 Ga0081539_10004439 3300005985 Bacteria 15486
23 Ga0070717_10166856 3300006028 Bacteria 1913
24 Ga0097620_100000055 3300006931 Bacteria 119802
25 Ga0097620_100019514 3300006931 Bacteria 6811
26 Ga0097620_100052098 3300006931 Bacteria 4115
27 Ga0105247_10000098 3300009101 Bacteria 94446
28 Ga0105247_10002015 3300009101 Bacteria 14064
29 Ga0105248_10000450 3300009177 Bacteria 46809
30 Ga0105248_10002505 3300009177 Bacteria 20436
31 Ga0105248_10158990 3300009177 Bacteria 2549
32 Ga0105249_10000259 3300009553 Bacteria 57099
33 Ga0105249_10014295 3300009553 Bacteria 7020
34 Ga0105239_10001572 3300010375 Bacteria 30160
35 Ga0163163_10014980 3300014325 Bacteria 7147
36 Ga0163163_10053617 3300014325 Bacteria 3981
37 Ga0163163_10112453 3300014325 Bacteria 2752
38 Ga0163163_10151616 3300014325 Bacteria 2361
39 Ga0157379_10000015 3300014968 Bacteria 104289
40 Ga0207713_1030890 3300025735 Bacteria 2378
41 Ga0207710_10000065 3300025900 Bacteria 154842
42 Ga0207710_10001960 3300025900 Bacteria 9838
43 Ga0207707_10000027 3300025912 Bacteria 171601
44 Ga0207660_10000691 3300025917 Bacteria 22532
45 Ga0207652_10000217 3300025921 Bacteria 60702
46 Ga0207646_10011352 3300025922 Bacteria 8642
47 Ga0207664_10063713 3300025929 Bacteria 2947
48 Ga0207711_10000967 3300025941 Bacteria 27498
49 Ga0207711_10002076 3300025941 Bacteria 18096
50 Ga0207712_10000217 3300025961 Bacteria 57107
51 Ga0207712_10009925 3300025961 Bacteria 6034
52 Ga0207703_10000094 3300026035 Bacteria 104297
53 Ga0207703_10002559 3300026035 Bacteria 15710
54 Ga0207641_10000019 3300026088 Bacteria 295899
55 Ga0207641_10016639 3300026088 Bacteria 6021
56 Ga0207641_10019807 3300026088 Bacteria 5523
57 Ga0207676_10000457 3300026095 Bacteria 34360
58 Ga0209371_1019836 3300027312 Bacteria 1669
59 Ga0268266_10001878 3300028379 Bacteria 23728
60 Ga0268265_10000070 3300028380 Bacteria 138524
61 Ga0268265_10000121 3300028380 Bacteria 97688
62 Ga0268264_10000612 3300028381 Bacteria 42805
63 Ga0265337_1000277 3300028556 Bacteria 28060
64 Ga0265326_10002379 3300028558 Bacteria 6345
65 Ga0265319_1000214 3300028563 Bacteria 43892
66 Ga0265319_1006219 3300028563 Bacteria 5562
67 Ga0265334_10012823 3300028573 Bacteria 3515
68 Ga0265318_10012693 3300028577 Bacteria 3576
69 Ga0265323_10004429 3300028653 Bacteria 6052
70 Ga0265322_10018107 3300028654 Bacteria 2026
71 Ga0265336_10000043 3300028666 Bacteria 132135
72 Ga0265336_10001550 3300028666 Bacteria 10306
73 Ga0265338_10000142 3300028800 Bacteria 132135
74 Ga0265338_10001241 3300028800 Bacteria 42035
75 Ga0265324_10018074 3300029957 Bacteria 2556
76 Ga0307511_10065094 3300030521 Bacteria 2733
77 Ga0307511_10067072 3300030521 Bacteria 2667
78 Ga0265325_10089829 3300031241 Bacteria 1516
79 Ga0265340_10000006 3300031247 Bacteria 132135
80 Ga0265340_10009003 3300031247 Bacteria 5374
81 Ga0265327_10007929 3300031251 Bacteria 8042
82 Ga0265316_10021760 3300031344 Bacteria 5423
83 Ga0307513_10011193 3300031456 Bacteria 11168
84 Ga0307513_10163055 3300031456 Bacteria 2118
85 Ga0265313_10001572 3300031595 Bacteria 21174
86 Ga0265313_10019826 3300031595 Bacteria 3730
87 Ga0265342_10004114 3300031712 Bacteria 11594
88 Ga0307413_10010387 3300031824 Bacteria 4513
89 Ga0307518_10001517 3300031838 Bacteria 17175
90 Ga0307518_10014519 3300031838 Bacteria 5632
91 Ga0307510_10000524 3300033180 Bacteria 38226
92 Ga0307510_10129289 3300033180 Bacteria 2204
93 Ga0307510_10209883 3300033180 Bacteria 1471
94 Ga0307510_10236088 3300033180 Bacteria 1327
95 Ga0373925_0145658 3300037068 Bacteria 1857
96 Ga0439466_0011815 3300041411 Bacteria 3224
97 Ga0466969_0003475 3300044656 Bacteria 8376
98 Ga0466969_0004522 3300044656 Bacteria 7405
99 Ga0466972_0018763 3300044658 Bacteria 3457
100 Ga0466965_0000851 3300044683 Bacteria 11585
101 Ga0466965_0020084 3300044683 Bacteria 3209
102 Ga0466965_0060027 3300044683 Bacteria 1899
103 Ga0466966_0001238 3300044684 Bacteria 16360
104 Ga0466966_0047194 3300044684 Bacteria 2747
105 Ga0466961_0000516 3300044693 Bacteria 24570
106 Ga0466961_0047612 3300044693 Bacteria 2741
107 Ga0466963_0001605 3300044694 Bacteria 12298
108 Ga0466964_0004860 3300044706 Bacteria 4968
109 Ga0453684_0004754 3300044712 Bacteria 28043
110 Ga0466971_0003290 3300044719 Bacteria 6895
111 Ga0466970_0000312 3300044765 Bacteria 23664
112 Ga0466970_0029019 3300044765 Bacteria 2910
113 Ga0466957_0001088 3300044842 Bacteria 14024
114 Ga0466957_0037391 3300044842 Bacteria 2923
115 Ga0466957_0065938 3300044842 Bacteria 2231
116 Ga0466960_0011918 3300044901 Bacteria 3657
117 Ga0466960_0023117 3300044901 Bacteria 2788
118 Ga0466959_0000567 3300045049 Bacteria 21529
119 Ga0466959_0008707 3300045049 Bacteria 7184
120 Ga0466958_0000357 3300045836 Bacteria 18437
121 Ga0466958_0029998 3300045836 Bacteria 3227
122 Ga0466967_0001461 3300045976 Bacteria 13741
123 Ga0466967_0003473 3300045976 Bacteria 10291
124 Ga0466967_0183946 3300045976 Bacteria 1972
125 Ga0495592_0104668 3300046454 Bacteria 2011
126 Ga0495603_0051164 3300046455 Bacteria 2455
127 Ga0495653_0080871 3300046463 Bacteria 2402
128 Ga0495582_0107593 3300046473 Bacteria 1565
129 Ga0495584_0014151 3300046491 Bacteria 4066
130 Ga0495594_0050042 3300046499 Bacteria 2298
131 Ga0495596_0000078 3300046500 Bacteria 67709
132 Ga0495618_0022665 3300046514 Bacteria 3880
133 Ga0495628_0001002 3300046516 Bacteria 25841
134 Ga0495630_0023226 3300046517 Bacteria 4583
135 Ga0495630_0255864 3300046517 Bacteria 1338
136 Ga0495637_0000085 3300046520 Bacteria 72965
137 Ga0495643_0000555 3300046522 Bacteria 46241
138 Ga0495648_0010359 3300046524 Bacteria 7104
139 Ga0495648_0061527 3300046524 Bacteria 2229
140 Ga0495640_0016031 3300046533 Bacteria 5618
141 Ga0495622_0056209 3300046557 Bacteria 1825
142 Ga0495633_0000847 3300046558 Bacteria 26761
143 Ga0495667_0073089 3300046559 Bacteria 2234
144 Ga0495634_0188900 3300046642 Bacteria 1286
145 Ga0495625_0144122 3300046660 Bacteria 1605
146 Ga0495657_0056576 3300046675 Bacteria 2611
147 Ga0495658_0004971 3300046683 Bacteria 6523
148 Ga0495658_0044589 3300046683 Bacteria 2486
149 Ga0495669_0003205 3300046684 Bacteria 6735
150 Ga0495671_0000249 3300046692 Bacteria 46241
151 Ga0495671_0036051 3300046692 Bacteria 2508
152 Ga0495600_0112415 3300046809 Bacteria 1774
153 Ga0495604_0101362 3300047317 Bacteria 2115
154 Ga0495674_0037882 3300047319 Bacteria 4332
155 Ga0495672_0001506 3300047320 Bacteria 22823
156 Ga0495672_0003243 3300047320 Bacteria 14119
157 Ga0495675_0084668 3300047444 Bacteria 1995
158 Ga0495681_0007760 3300047470 Bacteria 6803
159 Ga0495684_0008102 3300047471 Bacteria 8123
160 Ga0495614_0006922 3300048089 Bacteria 5071
161 Ga0496100_0242290 3300048903 Bacteria 1331
162 Ga0496101_0000094 3300048904 Bacteria 95577
163 Ga0496101_0011722 3300048904 Bacteria 5827
164 Ga0496102_0000014 3300048905 Bacteria 310241
165 Ga0496102_0000172 3300048905 Bacteria 87827
166 Ga0496102_0000506 3300048905 Bacteria 42785
167 Ga0496102_0103282 3300048905 Bacteria 2651
168 Ga0496103_0000004 3300048906 Bacteria 510080
169 Ga0496103_0000114 3300048906 Bacteria 87765
170 Ga0496103_0033710 3300048906 Bacteria 3129
171 Ga0496106_0027961 3300048909 Bacteria 4198
172 Ga0496116_0000069 3300048919 Bacteria 252643
173 Ga0496117_0000003 3300048920 Bacteria 1881097
174 Ga0496117_0026877 3300048920 Bacteria 4494
175 Ga0496118_0000001 3300048921 Bacteria 1881100
176 Ga0496118_0012762 3300048921 Bacteria 8025
177 Ga0496118_0024856 3300048921 Bacteria 5157
178 Ga0496119_0000389 3300048922 Bacteria 60683
179 Ga0496119_0000803 3300048922 Bacteria 42034
180 Ga0496119_0013737 3300048922 Bacteria 6417
181 Ga0496119_0016437 3300048922 Bacteria 5632
182 Ga0496120_0000085 3300048923 Bacteria 155343
183 Ga0496120_0000475 3300048923 Bacteria 62978
184 Ga0496121_0000032 3300048924 Bacteria 378997
185 Ga0496121_0000181 3300048924 Bacteria 140533
186 Ga0496121_0061067 3300048924 Bacteria 3096
187 Ga0496125_0052598 3300048928 Bacteria 3348
188 Ga0496126_0000067 3300048929 Bacteria 249091
189 Ga0501070_0026836 3300049586 Bacteria 4830
190 Ga0501072_0197725 3300049588 Bacteria 1603
191 Ga0501074_0002677 3300049590 Bacteria 12474
192 Ga0501080_0005044 3300049742 Bacteria 11764
193 Ga0495601_0009641 3300053077 Bacteria 5715
194 Ga0495595_0027464 3300053084 Bacteria 2536
195 Ga0495619_0008164 3300053085 Bacteria 6624
196 Ga0500583_0015100 3300053092 Bacteria 3046
197 Ga0500604_0000020 3300053151 Bacteria 77143
198 Ga0500637_0015312 3300053178 Bacteria 4063
199 Ga0500587_000040 3300053739 Bacteria 11023
200 Ga0501082_0124411 3300060353 Bacteria 2236
201 Ga0466962_0000459 3300061719 Bacteria 17670
202 Ga0466962_0004969 3300061719 Bacteria 6395
203 Ga0466962_0005125 3300061719 Bacteria 6304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0188900 Ga0495634_0188900_140_1255 370
2 3300046473 Ga0495582_0107593 Ga0495582_0107593_26_1147 372
3 3300044683 Ga0466965_0060027 Ga0466965_0060027_573_1802 383
4 3300048905 Ga0496102_0000014 Ga0496102_0000014_126425_127585 384
5 3300048906 Ga0496103_0000004 Ga0496103_0000004_126931_128091 384
6 3300048919 Ga0496116_0000069 Ga0496116_0000069_127882_129042 384
7 3300048920 Ga0496117_0000003 Ga0496117_0000003_1325334_1326494 384
8 3300048921 Ga0496118_0000001 Ga0496118_0000001_1325337_1326497 384
9 3300005937 Ga0081455_10000005 Ga0081455_10000005289 388
10 3300044842 Ga0466957_0037391 Ga0466957_0037391_1390_2598 389
11 3300044712 Ga0453684_0004754 Ga0453684_0004754_6962_8134 390
12 3300048905 Ga0496102_0103282 Ga0496102_0103282_27_1199 390
13 iso_pu_bacteria 8002784119 8002788079 392
14 3300031251 Ga0265327_10007929 Ga0265327_100079292 398
15 iso_pu_bacteria 3001889506 3001892288 398
16 iso_pu_bacteria 8053945823 8053953905 398
17 iso_pu_bacteria 8056207758 8056209529 398
18 iso_pu_bacteria 2501025502 2501083027 399
19 iso_pu_bacteria 2508501039 2508675137 399
20 iso_pu_bacteria 2508501039 2508676358 399
21 iso_pu_bacteria 2510917013 2511090996 399
22 iso_pu_bacteria 2517572101 2517763303 399
23 iso_pu_bacteria 2547132424 2548695027 399
24 iso_pu_bacteria 2671180195 2671833404 399
25 iso_pu_bacteria 2675902999 2676198519 399
26 iso_pu_bacteria 2684623035 2686536900 399
27 iso_pu_bacteria 2687453737 2689956814 399
28 iso_pu_bacteria 2687453737 2689957115 399
29 iso_pu_bacteria 2687453743 2689993607 399
30 iso_pu_bacteria 2758568016 2758639547 399
31 iso_pu_bacteria 2773857921 2774843097 399
32 iso_pu_bacteria 2773857922 2774851560 399
33 iso_pu_bacteria 2795385472 2795797029 399
34 iso_pu_bacteria 2862507626 2862516583 399
35 iso_pu_bacteria 8002775197 8002779550 399
36 iso_pu_bacteria 8002784119 8002785097 399
37 iso_pu_bacteria 8054913762 8054915453 399
38 iso_pu_bacteria 8055157932 8055159748 399
39 3300045836 Ga0466958_0029998 Ga0466958_0029998_1691_2896 400
40 3300049586 Ga0501070_0026836 Ga0501070_0026836_2727_3941 400
41 3300049588 Ga0501072_0197725 Ga0501072_0197725_278_1492 400
42 3300049590 Ga0501074_0002677 Ga0501074_0002677_890_2104 400
43 3300049742 Ga0501080_0005044 Ga0501080_0005044_10418_11632 400
44 3300060353 Ga0501082_0124411 Ga0501082_0124411_973_2187 400
45 3300061719 Ga0466962_0005125 Ga0466962_0005125_4635_5840 400
46 3300005439 Ga0070711_100090014 Ga0070711_1000900142 401
47 3300005468 Ga0070707_100011774 Ga0070707_1000117745 401
48 3300005518 Ga0070699_100003408 Ga0070699_1000034084 401
49 3300005841 Ga0068863_100034341 Ga0068863_1000343413 401
50 3300006028 Ga0070717_10166856 Ga0070717_101668563 401
51 3300025922 Ga0207646_10011352 Ga0207646_100113524 401
52 3300026088 Ga0207641_10019807 Ga0207641_100198073 401
53 3300028556 Ga0265337_1000277 Ga0265337_100027724 401
54 3300028558 Ga0265326_10002379 Ga0265326_100023794 401
55 3300028563 Ga0265319_1000214 Ga0265319_10002148 401
56 3300028563 Ga0265319_1006219 Ga0265319_10062193 401
57 3300028573 Ga0265334_10012823 Ga0265334_100128233 401
58 3300028577 Ga0265318_10012693 Ga0265318_100126932 401
59 3300028653 Ga0265323_10004429 Ga0265323_100044292 401
60 3300028654 Ga0265322_10018107 Ga0265322_100181072 401
61 3300028666 Ga0265336_10000043 Ga0265336_1000004348 401
62 3300028666 Ga0265336_10001550 Ga0265336_100015508 401
63 3300028800 Ga0265338_10000142 Ga0265338_10000142101 401
64 3300028800 Ga0265338_10001241 Ga0265338_100012414 401
65 3300029957 Ga0265324_10018074 Ga0265324_100180742 401
66 3300031241 Ga0265325_10089829 Ga0265325_100898292 401
67 3300031247 Ga0265340_10000006 Ga0265340_1000000648 401
68 3300031247 Ga0265340_10009003 Ga0265340_100090033 401
69 3300031344 Ga0265316_10021760 Ga0265316_100217601 401
70 3300031595 Ga0265313_10001572 Ga0265313_1000157215 401
71 3300031595 Ga0265313_10019826 Ga0265313_100198262 401
72 3300031712 Ga0265342_10004114 Ga0265342_100041145 401
73 3300031824 Ga0307413_10010387 Ga0307413_100103875 401
74 3300037068 Ga0373925_0145658 Ga0373925_0145658_68_1279 401
75 3300044683 Ga0466965_0020084 Ga0466965_0020084_148_1359 401
76 3300045976 Ga0466967_0003473 Ga0466967_0003473_531_1742 401
77 3300046500 Ga0495596_0000078 Ga0495596_0000078_27076_28284 401
78 3300046517 Ga0495630_0255864 Ga0495630_0255864_50_1258 401
79 3300046684 Ga0495669_0003205 Ga0495669_0003205_1502_2710 401
80 3300047320 Ga0495672_0001506 Ga0495672_0001506_13302_14510 401
81 3300005336 Ga0070680_100019243 Ga0070680_1000192433 402
82 3300005367 Ga0070667_100126610 Ga0070667_1001266102 402
83 3300005458 Ga0070681_10000016 Ga0070681_10000016115 402
84 3300005530 Ga0070679_100000105 Ga0070679_10000010556 402
85 3300005548 Ga0070665_100001693 Ga0070665_1000016933 402
86 3300005617 Ga0068859_100000055 Ga0068859_100000055122 402
87 3300005617 Ga0068859_100019514 Ga0068859_1000195142 402
88 3300005617 Ga0068859_100052098 Ga0068859_1000520983 402
89 3300005618 Ga0068864_100000832 Ga0068864_10000083217 402
90 3300005841 Ga0068863_100000126 Ga0068863_1000001269 402
91 3300005841 Ga0068863_100000749 Ga0068863_10000074925 402
92 3300005842 Ga0068858_100000196 Ga0068858_10000019648 402
93 3300005843 Ga0068860_100001767 Ga0068860_10000176720 402
94 3300005844 Ga0068862_100000087 Ga0068862_10000008739 402
95 3300005937 Ga0081455_10003956 Ga0081455_100039568 402
96 3300005985 Ga0081539_10001113 Ga0081539_1000111342 402
97 3300005985 Ga0081539_10004439 Ga0081539_100044391 402
98 3300006931 Ga0097620_100000055 Ga0097620_1000000555 402
99 3300006931 Ga0097620_100019514 Ga0097620_1000195142 402
100 3300006931 Ga0097620_100052098 Ga0097620_1000520983 402
101 3300009101 Ga0105247_10000098 Ga0105247_1000009871 402
102 3300009101 Ga0105247_10002015 Ga0105247_100020154 402
103 3300009177 Ga0105248_10000450 Ga0105248_1000045027 402
104 3300009177 Ga0105248_10002505 Ga0105248_100025055 402
105 3300009177 Ga0105248_10158990 Ga0105248_101589901 402
106 3300009553 Ga0105249_10000259 Ga0105249_1000025911 402
107 3300009553 Ga0105249_10014295 Ga0105249_100142953 402
108 3300010375 Ga0105239_10001572 Ga0105239_1000157216 402
109 3300014325 Ga0163163_10014980 Ga0163163_100149803 402
110 3300014325 Ga0163163_10053617 Ga0163163_100536174 402
111 3300014325 Ga0163163_10112453 Ga0163163_101124534 402
112 3300014325 Ga0163163_10151616 Ga0163163_101516162 402
113 3300014968 Ga0157379_10000015 Ga0157379_1000001554 402
114 3300025735 Ga0207713_1030890 Ga0207713_10308904 402
115 3300025900 Ga0207710_10000065 Ga0207710_1000006576 402
116 3300025900 Ga0207710_10001960 Ga0207710_100019601 402
117 3300025912 Ga0207707_10000027 Ga0207707_1000002714 402
118 3300025917 Ga0207660_10000691 Ga0207660_100006913 402
119 3300025921 Ga0207652_10000217 Ga0207652_1000021718 402
120 3300025929 Ga0207664_10063713 Ga0207664_100637132 402
121 3300025941 Ga0207711_10000967 Ga0207711_100009678 402
122 3300025941 Ga0207711_10002076 Ga0207711_100020765 402
123 3300025961 Ga0207712_10000217 Ga0207712_1000021743 402
124 3300025961 Ga0207712_10009925 Ga0207712_100099252 402
125 3300026035 Ga0207703_10000094 Ga0207703_1000009454 402
126 3300026035 Ga0207703_10002559 Ga0207703_100025598 402
127 3300026088 Ga0207641_10000019 Ga0207641_10000019216 402
128 3300026088 Ga0207641_10016639 Ga0207641_100166393 402
129 3300026095 Ga0207676_10000457 Ga0207676_1000045713 402
130 3300027312 Ga0209371_1019836 Ga0209371_10198361 402
131 3300028379 Ga0268266_10001878 Ga0268266_100018782 402
132 3300028380 Ga0268265_10000070 Ga0268265_10000070118 402
133 3300028380 Ga0268265_10000121 Ga0268265_1000012156 402
134 3300028381 Ga0268264_10000612 Ga0268264_1000061231 402
135 3300030521 Ga0307511_10065094 Ga0307511_100650942 402
136 3300030521 Ga0307511_10067072 Ga0307511_100670722 402
137 3300031456 Ga0307513_10011193 Ga0307513_1001119313 402
138 3300031456 Ga0307513_10163055 Ga0307513_101630551 402
139 3300031838 Ga0307518_10001517 Ga0307518_1000151712 402
140 3300031838 Ga0307518_10014519 Ga0307518_100145193 402
141 3300033180 Ga0307510_10000524 Ga0307510_1000052432 402
142 3300033180 Ga0307510_10129289 Ga0307510_101292892 402
143 3300033180 Ga0307510_10209883 Ga0307510_102098831 402
144 3300033180 Ga0307510_10236088 Ga0307510_102360881 402
145 3300041411 Ga0439466_0011815 Ga0439466_0011815_1482_2696 402
146 3300044656 Ga0466969_0003475 Ga0466969_0003475_5166_6410 402
147 3300044656 Ga0466969_0004522 Ga0466969_0004522_3669_4892 402
148 3300044658 Ga0466972_0018763 Ga0466972_0018763_1389_2633 402
149 3300044683 Ga0466965_0000851 Ga0466965_0000851_3690_4934 402
150 3300044684 Ga0466966_0001238 Ga0466966_0001238_5579_6823 402
151 3300044684 Ga0466966_0047194 Ga0466966_0047194_679_1902 402
152 3300044693 Ga0466961_0000516 Ga0466961_0000516_11787_13031 402
153 3300044693 Ga0466961_0047612 Ga0466961_0047612_899_2110 402
154 3300044694 Ga0466963_0001605 Ga0466963_0001605_9564_10808 402
155 3300044706 Ga0466964_0004860 Ga0466964_0004860_1525_2769 402
156 3300044719 Ga0466971_0003290 Ga0466971_0003290_5319_6563 402
157 3300044765 Ga0466970_0000312 Ga0466970_0000312_11573_12817 402
158 3300044765 Ga0466970_0029019 Ga0466970_0029019_1154_2368 402
159 3300044842 Ga0466957_0001088 Ga0466957_0001088_12236_13480 402
160 3300044842 Ga0466957_0065938 Ga0466957_0065938_385_1596 402
161 3300044901 Ga0466960_0011918 Ga0466960_0011918_2099_3319 402
162 3300044901 Ga0466960_0023117 Ga0466960_0023117_1487_2746 402
163 3300045049 Ga0466959_0000567 Ga0466959_0000567_17765_19009 402
164 3300045049 Ga0466959_0008707 Ga0466959_0008707_3176_4399 402
165 3300045836 Ga0466958_0000357 Ga0466958_0000357_16861_18105 402
166 3300045976 Ga0466967_0001461 Ga0466967_0001461_6137_7381 402
167 3300045976 Ga0466967_0183946 Ga0466967_0183946_608_1837 402
168 3300046454 Ga0495592_0104668 Ga0495592_0104668_68_1288 402
169 3300046455 Ga0495603_0051164 Ga0495603_0051164_990_2201 402
170 3300046463 Ga0495653_0080871 Ga0495653_0080871_382_1602 402
171 3300046491 Ga0495584_0014151 Ga0495584_0014151_1136_2347 402
172 3300046499 Ga0495594_0050042 Ga0495594_0050042_690_1940 402
173 3300046514 Ga0495618_0022665 Ga0495618_0022665_345_1565 402
174 3300046516 Ga0495628_0001002 Ga0495628_0001002_17216_18439 402
175 3300046517 Ga0495630_0023226 Ga0495630_0023226_3034_4254 402
176 3300046520 Ga0495637_0000085 Ga0495637_0000085_6422_7633 402
177 3300046522 Ga0495643_0000555 Ga0495643_0000555_14525_15736 402
178 3300046524 Ga0495648_0010359 Ga0495648_0010359_182_1393 402
179 3300046524 Ga0495648_0061527 Ga0495648_0061527_351_1562 402
180 3300046533 Ga0495640_0016031 Ga0495640_0016031_3260_4480 402
181 3300046557 Ga0495622_0056209 Ga0495622_0056209_183_1409 402
182 3300046558 Ga0495633_0000847 Ga0495633_0000847_9389_10600 402
183 3300046559 Ga0495667_0073089 Ga0495667_0073089_937_2157 402
184 3300046660 Ga0495625_0144122 Ga0495625_0144122_315_1535 402
185 3300046675 Ga0495657_0056576 Ga0495657_0056576_661_1881 402
186 3300046683 Ga0495658_0004971 Ga0495658_0004971_2970_4190 402
187 3300046683 Ga0495658_0044589 Ga0495658_0044589_319_1539 402
188 3300046692 Ga0495671_0000249 Ga0495671_0000249_14525_15736 402
189 3300046692 Ga0495671_0036051 Ga0495671_0036051_495_1706 402
190 3300046809 Ga0495600_0112415 Ga0495600_0112415_385_1605 402
191 3300047317 Ga0495604_0101362 Ga0495604_0101362_572_1792 402
192 3300047319 Ga0495674_0037882 Ga0495674_0037882_2043_3263 402
193 3300047320 Ga0495672_0003243 Ga0495672_0003243_11940_13157 402
194 3300047444 Ga0495675_0084668 Ga0495675_0084668_755_1975 402
195 3300047470 Ga0495681_0007760 Ga0495681_0007760_1577_2788 402
196 3300047471 Ga0495684_0008102 Ga0495684_0008102_4541_5761 402
197 3300048089 Ga0495614_0006922 Ga0495614_0006922_2917_4128 402
198 3300048903 Ga0496100_0242290 Ga0496100_0242290_62_1273 402
199 3300048904 Ga0496101_0000094 Ga0496101_0000094_7185_8414 402
200 3300048904 Ga0496101_0011722 Ga0496101_0011722_2760_3977 402
201 3300048905 Ga0496102_0000172 Ga0496102_0000172_15335_16552 402
202 3300048905 Ga0496102_0000506 Ga0496102_0000506_1619_2830 402
203 3300048906 Ga0496103_0000114 Ga0496103_0000114_15282_16499 402
204 3300048906 Ga0496103_0033710 Ga0496103_0033710_1251_2462 402
205 3300048909 Ga0496106_0027961 Ga0496106_0027961_1970_3199 402
206 3300048920 Ga0496117_0026877 Ga0496117_0026877_1079_2290 402
207 3300048921 Ga0496118_0012762 Ga0496118_0012762_6094_7305 402
208 3300048921 Ga0496118_0024856 Ga0496118_0024856_710_1927 402
209 3300048922 Ga0496119_0000389 Ga0496119_0000389_13450_14688 402
210 3300048922 Ga0496119_0000803 Ga0496119_0000803_36812_38041 402
211 3300048922 Ga0496119_0013737 Ga0496119_0013737_4849_6060 402
212 3300048922 Ga0496119_0016437 Ga0496119_0016437_1244_2461 402
213 3300048923 Ga0496120_0000085 Ga0496120_0000085_27639_28868 402
214 3300048923 Ga0496120_0000475 Ga0496120_0000475_13450_14688 402
215 3300048924 Ga0496121_0000032 Ga0496121_0000032_215654_216883 402
216 3300048924 Ga0496121_0000181 Ga0496121_0000181_73949_75160 402
217 3300048924 Ga0496121_0061067 Ga0496121_0061067_1095_2312 402
218 3300048928 Ga0496125_0052598 Ga0496125_0052598_879_2093 402
219 3300048929 Ga0496126_0000067 Ga0496126_0000067_184914_186143 402
220 3300053077 Ga0495601_0009641 Ga0495601_0009641_4020_5240 402
221 3300053084 Ga0495595_0027464 Ga0495595_0027464_388_1608 402
222 3300053085 Ga0495619_0008164 Ga0495619_0008164_3874_5094 402
223 3300053092 Ga0500583_0015100 Ga0500583_0015100_401_1612 402
224 3300053151 Ga0500604_0000020 Ga0500604_0000020_47475_48704 402
225 3300053178 Ga0500637_0015312 Ga0500637_0015312_2651_3862 402
226 3300053739 Ga0500587_000040 Ga0500587_000040_7533_8762 402
227 3300061719 Ga0466962_0000459 Ga0466962_0000459_5579_6823 402
228 3300061719 Ga0466962_0004969 Ga0466962_0004969_2437_3660 402
229 iso_pu_bacteria 2582581313 2585309572 402
230 iso_pu_bacteria 2643221647 2644266513 402
231 iso_pu_bacteria 2643221714 2644631506 402
232 iso_pu_bacteria 2954691527 2954692261 402
233 iso_pu_bacteria 2954701450 2954707328 402
234 iso_pu_bacteria 3002998708 3003008527 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00108

Thiolase_N

Thiolase, N-terminal domain

1

265

0.94

PF02803

Thiolase_C

Thiolase, C-terminal domain

272

362

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz4-assembly3.cif.gz_L crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis 0.9884 1 402
5bz4-assembly3.cif.gz_J crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis 0.9882 1 402
5bz4-assembly2.cif.gz_G crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis 0.9879 2 402
5bz4-assembly1.cif.gz_A crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis 0.9877 2 401
5byv-assembly2.cif.gz_H crystal structure of msm-13, a putative t1-like thiolase from mycobacterium smegmatis 0.9874 1 402
ID Description Score Start End Superfamily
4zrcA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9832 139 402 3.40.47.10
4zrcA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9777 139 402 3.40.47.10
5bz4J01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9726 1 277 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9669 282 395 3.40.47.10
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9652 159 401 3.40.47.10
ID Description Score Start End GO Terms
AF-W7IQJ3-F1-model_v4 Probable acetyl-CoA acetyltransferase 0.9919 2 401 GO:0003985
GO:0017000
AF-A0A356W6J1-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 0.9898 2 360 GO:0003985
AF-A0A810KGE3-F1-model_v4 deleted 0.9888 280 402
AF-X8E693-F1-model_v4 Thiolase, C-terminal domain protein 0.9886 265 389 GO:0003988
GO:0006635
GO:0010124
AF-K8XYR7-F1-model_v4 Probable acetyl-CoA acetyltransferase 0.9878 168 401 GO:0003985

Feature Viewer

pLDDT pTM Quality
94.61 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map