F347937

General Info

Members Datasets Scaffolds Average Seq Length
235 172 233 337

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100026041|Ga0068857_1000260414
Length 373
Sequence MRGFELGELRHEYLQCAIFDGDFGPTNNLMYEQSAPSLSTVPPVIERDPVAVLDQLAPRIRSLQEEIGKVIVGQEEVIAAALYALFCRGHCLLVGVPGLAKTLLVHSLARSLELSFSRIQFTPDLMPSDITGTEILEEDTSTGHRRFIFARGPVFAQVLLADEINRTPPKTQAALLEAMQEKTVTVAGKMYRLEEPFMALATQNPIEQEGTYLLPEAQLDRFLFELLVDYPSLEDERKVVEQHSFTPLDKLQPVLSRAEVLAFRDAIAQIPTAPNVIDYAVRLIRATRPNNGESPDYIKRWIRWGASPRASQYLILASRARAACQGRFNVACEDVAALAPLVLRHRLIRTFQADAEGKTTDEIIAKLLEDVAR

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2928963466 Dyella japonica 1073 Isolate Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
117 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
118 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0
Rhizoplane 8.94
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001016 3300002737 Bacteria 17505
2 JGI25151J46595_10000088 3300003187 Bacteria 124209
3 rootH2_10005586 3300003320 Bacteria 60566
4 rootH2_10198106 3300003320 Bacteria 3219
5 Ga0055542_1000187 3300003762 Bacteria 76099
6 Ga0055526_1000004 3300003771 Bacteria 355037
7 Ga0070658_10000518 3300005327 Bacteria 33463
8 Ga0070658_10015738 3300005327 Bacteria 6048
9 Ga0070658_10111112 3300005327 Bacteria 2271
10 Ga0070658_10164072 3300005327 Bacteria 1865
11 Ga0070683_100081857 3300005329 Bacteria 3023
12 Ga0070680_100014716 3300005336 Bacteria 6119
13 Ga0070660_100179994 3300005339 Bacteria 1710
14 Ga0070689_100002032 3300005340 Bacteria 13125
15 Ga0070661_100013778 3300005344 Bacteria 5681
16 Ga0070661_100089506 3300005344 Bacteria 2279
17 Ga0070661_100139247 3300005344 Bacteria 1828
18 Ga0070668_100003362 3300005347 Bacteria 11801
19 Ga0070671_100182497 3300005355 Bacteria 1777
20 Ga0070711_100057717 3300005439 Bacteria 2689
21 Ga0070663_100001292 3300005455 Bacteria 13723
22 Ga0070681_10017531 3300005458 Bacteria 7157
23 Ga0070681_10254135 3300005458 Bacteria 1669
24 Ga0070698_100395168 3300005471 Bacteria 1316
25 Ga0070684_100031061 3300005535 Bacteria 4545
26 Ga0070684_100061822 3300005535 Bacteria 3279
27 Ga0070672_100268672 3300005543 Bacteria 1439
28 Ga0070696_100032390 3300005546 Bacteria 3586
29 Ga0070665_100000027 3300005548 Bacteria 359314
30 Ga0070665_100234352 3300005548 Bacteria 1836
31 Ga0068855_100027313 3300005563 Bacteria 6829
32 Ga0070664_100009073 3300005564 Bacteria 8070
33 Ga0068857_100026041 3300005577 Bacteria 5152
34 Ga0068854_100063322 3300005578 Bacteria 2684
35 Ga0068856_100043028 3300005614 Bacteria 4443
36 Ga0068852_100004409 3300005616 Bacteria 9949
37 Ga0068852_100089803 3300005616 Bacteria 2747
38 Ga0068864_100138848 3300005618 Bacteria 2190
39 Ga0068863_100000233 3300005841 Bacteria 58900
40 Ga0068860_100051402 3300005843 Bacteria 3922
41 Ga0075368_10015835 3300006042 Bacteria 2802
42 Ga0075364_10068443 3300006051 Bacteria 2335
43 Ga0097621_100109502 3300006237 Bacteria 2333
44 Ga0097621_100261852 3300006237 Bacteria 1517
45 Ga0075434_100342187 3300006871 Bacteria 1517
46 Ga0075435_100267318 3300007076 Bacteria 1458
47 Ga0105240_10002444 3300009093 Bacteria 29867
48 Ga0105240_10336121 3300009093 Bacteria 1717
49 Ga0105245_10015069 3300009098 Bacteria 6736
50 Ga0105245_10113358 3300009098 Bacteria 2524
51 Ga0105245_10167174 3300009098 Bacteria 2092
52 Ga0105245_10224816 3300009098 Bacteria 1813
53 Ga0105242_10177332 3300009176 Bacteria 1878
54 Ga0105238_10013291 3300009551 Bacteria 8308
55 Ga0105238_10108821 3300009551 Bacteria 2753
56 Ga0105249_10000007 3300009553 Bacteria 349503
57 Ga0105249_10161449 3300009553 Bacteria 2166
58 Ga0105239_10263728 3300010375 Bacteria 1936
59 Ga0157373_10000259 3300013100 Bacteria 43071
60 Ga0157371_10018568 3300013102 Bacteria 5138
61 Ga0157370_10000553 3300013104 Bacteria 46638
62 Ga0157370_10015113 3300013104 Bacteria 7864
63 Ga0157369_10019822 3300013105 Bacteria 7525
64 Ga0157369_10328697 3300013105 Bacteria 1589
65 Ga0163162_10465152 3300013306 Bacteria 1396
66 Ga0157372_10034536 3300013307 Bacteria 5560
67 Ga0157372_10050783 3300013307 Bacteria 4613
68 Ga0157372_10213885 3300013307 Bacteria 2234
69 Ga0157372_10258127 3300013307 Bacteria 2024
70 Ga0157372_10399949 3300013307 Bacteria 1601
71 Ga0163163_10102288 3300014325 Bacteria 2888
72 Ga0163163_10136117 3300014325 Bacteria 2498
73 Ga0163163_10336972 3300014325 Bacteria 1563
74 Ga0157377_10222031 3300014745 Bacteria 1210
75 Ga0157379_10184490 3300014968 Bacteria 1885
76 Ga0207427_101993 3300025231 Bacteria 6215
77 Ga0209437_100270 3300025233 Bacteria 78319
78 Ga0209258_103530 3300025242 Bacteria 3328
79 Ga0209026_1003970 3300025250 Bacteria 4618
80 Ga0209148_1000005 3300025254 Bacteria 1806504
81 Ga0207705_10004464 3300025909 Bacteria 10569
82 Ga0207705_10015526 3300025909 Bacteria 5465
83 Ga0207705_10080120 3300025909 Bacteria 2379
84 Ga0207707_10010604 3300025912 Bacteria 8002
85 Ga0207695_10003493 3300025913 Bacteria 22094
86 Ga0207695_10003904 3300025913 Bacteria 20632
87 Ga0207695_10011246 3300025913 Bacteria 10853
88 Ga0207663_10174506 3300025916 Bacteria 1530
89 Ga0207660_10049407 3300025917 Bacteria 2982
90 Ga0207657_10003578 3300025919 Bacteria 16575
91 Ga0207657_10010462 3300025919 Bacteria 9256
92 Ga0207649_10022842 3300025920 Bacteria 3615
93 Ga0207649_10129011 3300025920 Bacteria 1715
94 Ga0207652_10304239 3300025921 Bacteria 1439
95 Ga0207694_10091903 3300025924 Bacteria 2395
96 Ga0207687_10352107 3300025927 Bacteria 1200
97 Ga0207700_10276878 3300025928 Bacteria 1442
98 Ga0207690_10127429 3300025932 Bacteria 1858
99 Ga0207709_10211499 3300025935 Bacteria 1392
100 Ga0207670_10009000 3300025936 Bacteria 5666
101 Ga0207670_10138390 3300025936 Bacteria 1793
102 Ga0207661_10041222 3300025944 Bacteria 3633
103 Ga0207661_10075188 3300025944 Bacteria 2771
104 Ga0207661_10340252 3300025944 Bacteria 1352
105 Ga0207679_10010640 3300025945 Bacteria 5929
106 Ga0207667_10023885 3300025949 Bacteria 6727
107 Ga0207667_10042424 3300025949 Bacteria 4835
108 Ga0207712_10000024 3300025961 Bacteria 275176
109 Ga0207668_10002843 3300025972 Bacteria 10146
110 Ga0207640_10019317 3300025981 Bacteria 4023
111 Ga0207639_10197728 3300026041 Bacteria 1722
112 Ga0207678_10000621 3300026067 Bacteria 32462
113 Ga0207678_10120478 3300026067 Bacteria 2239
114 Ga0207641_10000233 3300026088 Bacteria 71788
115 Ga0207641_10102223 3300026088 Bacteria 2527
116 Ga0207641_10498862 3300026088 Bacteria 1182
117 Ga0207674_10012972 3300026116 Bacteria 9292
118 Ga0207683_10512620 3300026121 Bacteria 1108
119 Ga0207698_10018713 3300026142 Bacteria 4727
120 Ga0207698_10153736 3300026142 Bacteria 2001
121 Ga0268266_10000050 3300028379 Bacteria 302778
122 Ga0268266_10189287 3300028379 Bacteria 1878
123 Ga0268264_10001828 3300028381 Bacteria 19434
124 Ga0268264_10002969 3300028381 Bacteria 14737
125 Ga0268264_10027199 3300028381 Bacteria 4671
126 Ga0265316_10186305 3300031344 Bacteria 1544
127 Ga0307408_100000052 3300031548 Bacteria 149094
128 Ga0307408_100001272 3300031548 Bacteria 18935
129 Ga0316575_10006087 3300031665 Bacteria 4326
130 Ga0316579_10010237 3300031691 Bacteria 3959
131 Ga0316578_10005718 3300031728 Bacteria 6062
132 Ga0316577_10000385 3300031733 Bacteria 16802
133 Ga0307413_10134271 3300031824 Bacteria 1699
134 Ga0307406_10001403 3300031901 Bacteria 13384
135 Ga0307407_10000092 3300031903 Bacteria 31591
136 Ga0307412_10000070 3300031911 Bacteria 107229
137 Ga0307409_100068654 3300031995 Bacteria 2804
138 Ga0307409_100144444 3300031995 Bacteria 2055
139 Ga0307414_10000054 3300032004 Bacteria 121082
140 Ga0307414_10008678 3300032004 Bacteria 5785
141 Ga0307411_10113540 3300032005 Bacteria 1944
142 Ga0316583_10007370 3300032133 Bacteria 3961
143 Ga0316585_10005181 3300032137 Bacteria 3670
144 Ga0373926_0024318 3300035083 Bacteria 2109
145 Ga0373942_0023942 3300035207 Bacteria 1563
146 Ga0373931_0151739 3300035691 Bacteria 1351
147 Ga0373935_0001155 3300035692 Bacteria 14467
148 Ga0373935_0027624 3300035692 Bacteria 3508
149 Ga0373927_0071142 3300035695 Bacteria 2251
150 Ga0373947_0015446 3300035725 Bacteria 4383
151 Ga0373937_0110957 3300036401 Bacteria 2551
152 Ga0373937_0168781 3300036401 Bacteria 2053
153 Ga0316582_0000504 3300036647 Bacteria 14741
154 Ga0316582_0017673 3300036647 Bacteria 4132
155 Ga0316584_0012810 3300036712 Bacteria 5920
156 Ga0316584_0037778 3300036712 Bacteria 3589
157 Ga0373925_0009109 3300037068 Bacteria 7223
158 Ga0395900_0016175 3300037418 Bacteria 7599
159 Ga0395900_0081772 3300037418 Bacteria 3318
160 Ga0395898_0144486 3300037466 Bacteria 2277
161 Ga0395905_0085272 3300037471 Bacteria 2960
162 Ga0395901_0089746 3300038443 Bacteria 3216
163 Ga0436365_0190110 3300039437 Bacteria 1239
164 Ga0450890_000037 3300042127 Bacteria 30729
165 Ga0450892_000003 3300042130 Bacteria 25759
166 Ga0450893_0000398 3300042532 Bacteria 6121
167 Ga0450893_0001111 3300042532 Bacteria 4057
168 Ga0450893_0002756 3300042532 Bacteria 2749
169 Ga0466971_0108610 3300044719 Bacteria 1279
170 Ga0466957_0055661 3300044842 Bacteria 2418
171 Ga0451576_0017411 3300045051 Bacteria 7901
172 Ga0451576_0095657 3300045051 Bacteria 3090
173 Ga0495651_0025207 3300046462 Bacteria 4628
174 Ga0495653_0011894 3300046463 Bacteria 7110
175 Ga0495662_0016684 3300046476 Bacteria 3558
176 Ga0495608_0249117 3300046511 Bacteria 1108
177 Ga0495628_0056086 3300046516 Bacteria 3102
178 Ga0495630_0001581 3300046517 Bacteria 15844
179 Ga0495644_0024948 3300046523 Bacteria 2272
180 Ga0495640_0030755 3300046533 Bacteria 3840
181 Ga0495586_0024424 3300046535 Bacteria 3231
182 Ga0495587_0090120 3300046536 Bacteria 1772
183 Ga0495667_0041546 3300046559 Bacteria 3049
184 Ga0495656_0042671 3300046615 Bacteria 1900
185 Ga0495668_0001829 3300046616 Bacteria 19233
186 Ga0495634_0038747 3300046642 Bacteria 3248
187 Ga0495634_0109011 3300046642 Bacteria 1782
188 Ga0495646_0037924 3300046680 Bacteria 2978
189 Ga0495613_0023174 3300046689 Bacteria 4625
190 Ga0495624_0045557 3300046690 Bacteria 2791
191 Ga0495670_0093748 3300046691 Bacteria 1539
192 Ga0495674_0038817 3300047319 Bacteria 4271
193 Ga0495672_0002088 3300047320 Bacteria 18749
194 Ga0495680_0275782 3300047322 Bacteria 1186
195 Ga0495675_0045427 3300047444 Bacteria 2797
196 Ga0495602_0028322 3300048088 Bacteria 5364
197 Ga0496100_0078959 3300048903 Bacteria 2216
198 Ga0496101_0009934 3300048904 Bacteria 6272
199 Ga0496102_0122717 3300048905 Bacteria 2427
200 Ga0496103_0011875 3300048906 Bacteria 5170
201 Ga0496104_0002127 3300048907 Bacteria 17189
202 Ga0496104_0045727 3300048907 Bacteria 4119
203 Ga0496104_0182602 3300048907 Bacteria 2008
204 Ga0496104_0556661 3300048907 Bacteria 1057
205 Ga0496108_0004897 3300048911 Bacteria 10810
206 Ga0496109_0002824 3300048912 Bacteria 14552
207 Ga0496109_0122205 3300048912 Bacteria 2426
208 Ga0496109_0244802 3300048912 Bacteria 1688
209 Ga0496111_0000809 3300048914 Bacteria 16789
210 Ga0496111_0016593 3300048914 Bacteria 5078
211 Ga0496113_0152308 3300048916 Bacteria 1825
212 Ga0496113_0338997 3300048916 Bacteria 1206
213 Ga0496114_0006731 3300048917 Bacteria 9055
214 Ga0496114_0007761 3300048917 Bacteria 8488
215 Ga0496114_0011946 3300048917 Bacteria 6948
216 Ga0496115_0116602 3300048918 Bacteria 2196
217 Ga0496125_0000109 3300048928 Bacteria 193628
218 Ga0501031_0000362 3300049568 Bacteria 26494
219 Ga0501039_0000474 3300049575 Bacteria 29046
220 Ga0501043_0000189 3300049579 Bacteria 56045
221 Ga0501047_0000930 3300049581 Bacteria 29899
222 Ga0501070_0001976 3300049586 Bacteria 18060
223 Ga0501079_0097418 3300049741 Bacteria 2280
224 Ga0501081_0032517 3300049743 Bacteria 3539
225 Ga0501035_0000261 3300049822 Bacteria 62560
226 nmdc:mga06z11_73251_c1 3300050494 Bacteria 1818
227 nmdc:mga0rr50_251416_c1 3300050513 Bacteria 1468
228 Ga0495601_0147637 3300053077 Bacteria 1535
229 Ga0495619_0049638 3300053085 Bacteria 2768
230 Ga0500556_0009832 3300053104 Bacteria 2791
231 Ga0500559_0001809 3300053136 Bacteria 11697
232 Ga0500568_0001363 3300053139 Bacteria 15871
233 Ga0530510_0062186 3300061734 Bacteria 2703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100001272 Ga0307408_10000127212 284
2 3300031901 Ga0307406_10001403 Ga0307406_100014039 284
3 3300031995 Ga0307409_100068654 Ga0307409_1000686542 284
4 3300031995 Ga0307409_100144444 Ga0307409_1001444441 284
5 3300048907 Ga0496104_0556661 Ga0496104_0556661_17_928 286
6 3300053136 Ga0500559_0001809 Ga0500559_0001809_744_1736 287
7 3300035083 Ga0373926_0024318 Ga0373926_0024318_508_1566 294
8 3300035692 Ga0373935_0001155 Ga0373935_0001155_9529_10587 294
9 3300035695 Ga0373927_0071142 Ga0373927_0071142_378_1436 294
10 3300035725 Ga0373947_0015446 Ga0373947_0015446_650_1708 294
11 3300037068 Ga0373925_0009109 Ga0373925_0009109_3311_4369 294
12 3300046517 Ga0495630_0001581 Ga0495630_0001581_9187_10245 294
13 3300035692 Ga0373935_0027624 Ga0373935_0027624_382_1524 295
14 3300047322 Ga0495680_0275782 Ga0495680_0275782_137_1090 299
15 3300053077 Ga0495601_0147637 Ga0495601_0147637_280_1233 299
16 3300031548 Ga0307408_100000052 Ga0307408_100000052126 303
17 3300031903 Ga0307407_10000092 Ga0307407_1000009222 303
18 3300031911 Ga0307412_10000070 Ga0307412_1000007049 303
19 3300032005 Ga0307411_10113540 Ga0307411_101135402 303
20 3300042127 Ga0450890_000037 Ga0450890_000037_20653_21630 303
21 3300042130 Ga0450892_000003 Ga0450892_000003_4782_5759 303
22 3300042532 Ga0450893_0000398 Ga0450893_0000398_1982_2959 303
23 3300042532 Ga0450893_0002756 Ga0450893_0002756_1300_2268 304
24 3300003320 rootH2_10005586 rootH2_1000558622 305
25 3300042532 Ga0450893_0001111 Ga0450893_0001111_3065_4042 305
26 3300005841 Ga0068863_100000233 Ga0068863_1000002333 308
27 3300026088 Ga0207641_10000233 Ga0207641_1000023325 308
28 3300044719 Ga0466971_0108610 Ga0466971_0108610_166_1167 308
29 3300044842 Ga0466957_0055661 Ga0466957_0055661_194_1195 308
30 3300005548 Ga0070665_100000027 Ga0070665_10000002741 309
31 3300009093 Ga0105240_10002444 Ga0105240_1000244413 309
32 3300025913 Ga0207695_10003904 Ga0207695_1000390416 309
33 3300026088 Ga0207641_10498862 Ga0207641_104988621 309
34 3300028379 Ga0268266_10000050 Ga0268266_10000050243 309
35 3300005458 Ga0070681_10254135 Ga0070681_102541351 310
36 3300005535 Ga0070684_100031061 Ga0070684_1000310612 311
37 3300005564 Ga0070664_100009073 Ga0070664_1000090736 311
38 3300025945 Ga0207679_10010640 Ga0207679_100106402 311
39 3300031344 Ga0265316_10186305 Ga0265316_101863052 311
40 3300061734 Ga0530510_0062186 Ga0530510_0062186_510_1532 311
41 3300005843 Ga0068860_100051402 Ga0068860_1000514023 312
42 3300028381 Ga0268264_10002969 Ga0268264_100029692 312
43 3300036401 Ga0373937_0168781 Ga0373937_0168781_1011_2009 312
44 3300025928 Ga0207700_10276878 Ga0207700_102768782 313
45 3300046511 Ga0495608_0249117 Ga0495608_0249117_10_1014 313
46 3300048917 Ga0496114_0011946 Ga0496114_0011946_3308_4303 313
47 3300006237 Ga0097621_100261852 Ga0097621_1002618522 314
48 3300005577 Ga0068857_100026041 Ga0068857_1000260414 315
49 3300006042 Ga0075368_10015835 Ga0075368_100158352 315
50 3300009098 Ga0105245_10224816 Ga0105245_102248162 315
51 3300026088 Ga0207641_10102223 Ga0207641_101022233 315
52 3300026116 Ga0207674_10012972 Ga0207674_100129724 315
53 3300045051 Ga0451576_0017411 Ga0451576_0017411_2541_3572 315
54 3300047444 Ga0495675_0045427 Ga0495675_0045427_1492_2499 315
55 3300050494 nmdc:mga06z11_73251_c1 nmdc:mga06z11_73251_c1_456_1469 315
56 3300005439 Ga0070711_100057717 Ga0070711_1000577171 316
57 3300006871 Ga0075434_100342187 Ga0075434_1003421872 316
58 3300009098 Ga0105245_10167174 Ga0105245_101671742 316
59 3300009176 Ga0105242_10177332 Ga0105242_101773322 316
60 3300025916 Ga0207663_10174506 Ga0207663_101745062 316
61 3300025927 Ga0207687_10352107 Ga0207687_103521072 316
62 3300035207 Ga0373942_0023942 Ga0373942_0023942_176_1312 316
63 3300045051 Ga0451576_0095657 Ga0451576_0095657_87_1136 316
64 3300047320 Ga0495672_0002088 Ga0495672_0002088_2685_3707 316
65 3300048916 Ga0496113_0338997 Ga0496113_0338997_132_1133 316
66 3300053139 Ga0500568_0001363 Ga0500568_0001363_451_1533 316
67 3300005355 Ga0070671_100182497 Ga0070671_1001824972 317
68 3300005458 Ga0070681_10017531 Ga0070681_100175318 317
69 3300005471 Ga0070698_100395168 Ga0070698_1003951681 317
70 3300005614 Ga0068856_100043028 Ga0068856_1000430282 317
71 3300009098 Ga0105245_10015069 Ga0105245_100150697 317
72 3300009098 Ga0105245_10113358 Ga0105245_101133582 317
73 3300009553 Ga0105249_10161449 Ga0105249_101614492 317
74 3300010375 Ga0105239_10263728 Ga0105239_102637282 317
75 3300013306 Ga0163162_10465152 Ga0163162_104651522 317
76 3300013307 Ga0157372_10213885 Ga0157372_102138853 317
77 3300014325 Ga0163163_10336972 Ga0163163_103369721 317
78 3300014745 Ga0157377_10222031 Ga0157377_102220312 317
79 3300025912 Ga0207707_10010604 Ga0207707_100106042 317
80 3300025913 Ga0207695_10011246 Ga0207695_100112467 317
81 3300025921 Ga0207652_10304239 Ga0207652_103042391 317
82 3300025935 Ga0207709_10211499 Ga0207709_102114991 317
83 3300025936 Ga0207670_10138390 Ga0207670_101383903 317
84 3300026121 Ga0207683_10512620 Ga0207683_105126201 317
85 3300028381 Ga0268264_10001828 Ga0268264_100018287 317
86 3300036401 Ga0373937_0110957 Ga0373937_0110957_328_1341 317
87 3300037418 Ga0395900_0016175 Ga0395900_0016175_2213_3217 317
88 3300037418 Ga0395900_0081772 Ga0395900_0081772_320_1333 317
89 3300037466 Ga0395898_0144486 Ga0395898_0144486_202_1206 317
90 3300037471 Ga0395905_0085272 Ga0395905_0085272_1442_2455 317
91 3300038443 Ga0395901_0089746 Ga0395901_0089746_903_1907 317
92 3300039437 Ga0436365_0190110 Ga0436365_0190110_21_1031 317
93 3300046462 Ga0495651_0025207 Ga0495651_0025207_1027_2040 317
94 3300046463 Ga0495653_0011894 Ga0495653_0011894_4485_5498 317
95 3300046476 Ga0495662_0016684 Ga0495662_0016684_1209_2222 317
96 3300046516 Ga0495628_0056086 Ga0495628_0056086_1966_2979 317
97 3300046523 Ga0495644_0024948 Ga0495644_0024948_740_1744 317
98 3300046533 Ga0495640_0030755 Ga0495640_0030755_919_1932 317
99 3300046535 Ga0495586_0024424 Ga0495586_0024424_85_1098 317
100 3300046536 Ga0495587_0090120 Ga0495587_0090120_83_1093 317
101 3300046559 Ga0495667_0041546 Ga0495667_0041546_838_1851 317
102 3300046615 Ga0495656_0042671 Ga0495656_0042671_386_1405 317
103 3300046642 Ga0495634_0038747 Ga0495634_0038747_1405_2418 317
104 3300046642 Ga0495634_0109011 Ga0495634_0109011_235_1254 317
105 3300046680 Ga0495646_0037924 Ga0495646_0037924_1027_2040 317
106 3300046689 Ga0495613_0023174 Ga0495613_0023174_1913_2926 317
107 3300046690 Ga0495624_0045557 Ga0495624_0045557_1115_2128 317
108 3300046691 Ga0495670_0093748 Ga0495670_0093748_43_1047 317
109 3300047319 Ga0495674_0038817 Ga0495674_0038817_2181_3194 317
110 3300048088 Ga0495602_0028322 Ga0495602_0028322_163_1176 317
111 3300048903 Ga0496100_0078959 Ga0496100_0078959_888_1907 317
112 3300048904 Ga0496101_0009934 Ga0496101_0009934_1174_2193 317
113 3300048905 Ga0496102_0122717 Ga0496102_0122717_1104_2123 317
114 3300048906 Ga0496103_0011875 Ga0496103_0011875_3597_4616 317
115 3300048907 Ga0496104_0002127 Ga0496104_0002127_1212_2231 317
116 3300048907 Ga0496104_0045727 Ga0496104_0045727_1154_2173 317
117 3300048907 Ga0496104_0182602 Ga0496104_0182602_361_1380 317
118 3300048911 Ga0496108_0004897 Ga0496108_0004897_1107_2126 317
119 3300048912 Ga0496109_0002824 Ga0496109_0002824_9406_10425 317
120 3300048912 Ga0496109_0122205 Ga0496109_0122205_733_1752 317
121 3300048912 Ga0496109_0244802 Ga0496109_0244802_115_1134 317
122 3300048914 Ga0496111_0000809 Ga0496111_0000809_13694_14713 317
123 3300048914 Ga0496111_0016593 Ga0496111_0016593_2142_3161 317
124 3300048916 Ga0496113_0152308 Ga0496113_0152308_187_1206 317
125 3300048917 Ga0496114_0006731 Ga0496114_0006731_7029_8048 317
126 3300048917 Ga0496114_0007761 Ga0496114_0007761_6544_7563 317
127 3300049741 Ga0501079_0097418 Ga0501079_0097418_597_1616 317
128 3300049743 Ga0501081_0032517 Ga0501081_0032517_151_1170 317
129 3300053085 Ga0495619_0049638 Ga0495619_0049638_1236_2255 317
130 3300005543 Ga0070672_100268672 Ga0070672_1002686722 318
131 3300007076 Ga0075435_100267318 Ga0075435_1002673182 318
132 3300014968 Ga0157379_10184490 Ga0157379_101844902 318
133 3300026067 Ga0207678_10120478 Ga0207678_101204781 318
134 3300031824 Ga0307413_10134271 Ga0307413_101342712 318
135 3300032004 Ga0307414_10000054 Ga0307414_1000005415 318
136 3300032004 Ga0307414_10008678 Ga0307414_100086782 318
137 3300050513 nmdc:mga0rr50_251416_c1 nmdc:mga0rr50_251416_c1_374_1432 318
138 3300005327 Ga0070658_10015738 Ga0070658_100157384 319
139 3300005327 Ga0070658_10111112 Ga0070658_101111123 319
140 3300005327 Ga0070658_10164072 Ga0070658_101640722 319
141 3300005329 Ga0070683_100081857 Ga0070683_1000818573 319
142 3300005336 Ga0070680_100014716 Ga0070680_1000147162 319
143 3300005344 Ga0070661_100089506 Ga0070661_1000895062 319
144 3300005535 Ga0070684_100061822 Ga0070684_1000618223 319
145 3300005546 Ga0070696_100032390 Ga0070696_1000323903 319
146 3300005563 Ga0068855_100027313 Ga0068855_1000273132 319
147 3300005616 Ga0068852_100004409 Ga0068852_1000044094 319
148 3300005618 Ga0068864_100138848 Ga0068864_1001388481 319
149 3300013104 Ga0157370_10015113 Ga0157370_100151135 319
150 3300013105 Ga0157369_10328697 Ga0157369_103286972 319
151 3300013307 Ga0157372_10258127 Ga0157372_102581271 319
152 3300013307 Ga0157372_10399949 Ga0157372_103999492 319
153 3300014325 Ga0163163_10136117 Ga0163163_101361172 319
154 3300025909 Ga0207705_10080120 Ga0207705_100801202 319
155 3300025917 Ga0207660_10049407 Ga0207660_100494072 319
156 3300025919 Ga0207657_10010462 Ga0207657_100104624 319
157 3300025920 Ga0207649_10022842 Ga0207649_100228423 319
158 3300025920 Ga0207649_10129011 Ga0207649_101290112 319
159 3300025932 Ga0207690_10127429 Ga0207690_101274292 319
160 3300025944 Ga0207661_10041222 Ga0207661_100412222 319
161 3300025944 Ga0207661_10075188 Ga0207661_100751883 319
162 3300025949 Ga0207667_10023885 Ga0207667_100238856 319
163 3300026041 Ga0207639_10197728 Ga0207639_101977282 319
164 3300026142 Ga0207698_10018713 Ga0207698_100187132 319
165 3300035691 Ga0373931_0151739 Ga0373931_0151739_93_1130 319
166 3300049568 Ga0501031_0000362 Ga0501031_0000362_20395_21396 319
167 3300049575 Ga0501039_0000474 Ga0501039_0000474_15157_16158 319
168 3300049579 Ga0501043_0000189 Ga0501043_0000189_42634_43635 319
169 3300049581 Ga0501047_0000930 Ga0501047_0000930_3840_4841 319
170 3300049586 Ga0501070_0001976 Ga0501070_0001976_15366_16367 319
171 3300049822 Ga0501035_0000261 Ga0501035_0000261_20419_21420 319
172 3300005347 Ga0070668_100003362 Ga0070668_1000033628 320
173 3300005548 Ga0070665_100234352 Ga0070665_1002343522 320
174 3300009553 Ga0105249_10000007 Ga0105249_10000007258 320
175 3300013100 Ga0157373_10000259 Ga0157373_1000025913 320
176 3300014325 Ga0163163_10102288 Ga0163163_101022882 320
177 3300025961 Ga0207712_10000024 Ga0207712_10000024218 320
178 3300025972 Ga0207668_10002843 Ga0207668_100028438 320
179 3300028379 Ga0268266_10189287 Ga0268266_101892872 320
180 3300006237 Ga0097621_100109502 Ga0097621_1001095021 321
181 3300013307 Ga0157372_10034536 Ga0157372_100345362 321
182 3300025944 Ga0207661_10340252 Ga0207661_103402521 321
183 3300048928 Ga0496125_0000109 Ga0496125_0000109_180480_181493 321
184 3300053104 Ga0500556_0009832 Ga0500556_0009832_642_1652 321
185 iso_pu_bacteria 2786546517 2787437153 321
186 3300006051 Ga0075364_10068443 Ga0075364_100684432 322
187 3300005339 Ga0070660_100179994 Ga0070660_1001799942 323
188 3300005455 Ga0070663_100001292 Ga0070663_10000129210 323
189 3300005578 Ga0068854_100063322 Ga0068854_1000633222 323
190 3300005616 Ga0068852_100089803 Ga0068852_1000898033 323
191 3300009093 Ga0105240_10336121 Ga0105240_103361211 323
192 3300009551 Ga0105238_10013291 Ga0105238_100132913 323
193 3300013102 Ga0157371_10018568 Ga0157371_100185684 323
194 3300013105 Ga0157369_10019822 Ga0157369_100198224 323
195 3300013307 Ga0157372_10050783 Ga0157372_100507834 323
196 3300025909 Ga0207705_10015526 Ga0207705_100155265 323
197 3300025913 Ga0207695_10003493 Ga0207695_1000349321 323
198 3300025919 Ga0207657_10003578 Ga0207657_1000357813 323
199 3300025924 Ga0207694_10091903 Ga0207694_100919032 323
200 3300025949 Ga0207667_10042424 Ga0207667_100424244 323
201 3300025981 Ga0207640_10019317 Ga0207640_100193173 323
202 3300026067 Ga0207678_10000621 Ga0207678_1000062112 323
203 3300026142 Ga0207698_10153736 Ga0207698_101537362 323
204 3300003320 rootH2_10198106 rootH2_101981062 324
205 3300005327 Ga0070658_10000518 Ga0070658_1000051817 324
206 3300005344 Ga0070661_100139247 Ga0070661_1001392472 324
207 3300013104 Ga0157370_10000553 Ga0157370_100005534 324
208 3300025909 Ga0207705_10004464 Ga0207705_100044642 324
209 iso_pu_bacteria 2928963466 2928965845 325
210 3300036647 Ga0316582_0017673 Ga0316582_0017673_582_1565 326
211 3300036712 Ga0316584_0012810 Ga0316584_0012810_3549_4532 326
212 3300003187 JGI25151J46595_10000088 JGI25151J46595_1000008856 328
213 3300003771 Ga0055526_1000004 Ga0055526_1000004279 328
214 3300046616 Ga0495668_0001829 Ga0495668_0001829_17552_18541 328
215 3300002737 JGI25162J39368_1001016 JGI25162J39368_10010163 329
216 3300003762 Ga0055542_1000187 Ga0055542_100018757 329
217 3300005340 Ga0070689_100002032 Ga0070689_10000203211 329
218 3300005344 Ga0070661_100013778 Ga0070661_1000137784 329
219 3300009551 Ga0105238_10108821 Ga0105238_101088212 329
220 3300025231 Ga0207427_101993 Ga0207427_1019933 329
221 3300025233 Ga0209437_100270 Ga0209437_10027059 329
222 3300025242 Ga0209258_103530 Ga0209258_1035302 329
223 3300025250 Ga0209026_1003970 Ga0209026_10039703 329
224 3300025254 Ga0209148_1000005 Ga0209148_10000051284 329
225 3300025936 Ga0207670_10009000 Ga0207670_100090003 329
226 3300028381 Ga0268264_10027199 Ga0268264_100271993 329
227 3300031665 Ga0316575_10006087 Ga0316575_100060872 329
228 3300031691 Ga0316579_10010237 Ga0316579_100102372 329
229 3300031728 Ga0316578_10005718 Ga0316578_100057184 329
230 3300031733 Ga0316577_10000385 Ga0316577_1000038517 329
231 3300032133 Ga0316583_10007370 Ga0316583_100073704 329
232 3300032137 Ga0316585_10005181 Ga0316585_100051812 329
233 3300036647 Ga0316582_0000504 Ga0316582_0000504_6880_7875 329
234 3300036712 Ga0316584_0037778 Ga0316584_0037778_566_1561 329
235 3300048918 Ga0496115_0116602 Ga0496115_0116602_616_1605 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

90

224

0.98

PF17863

AAA_lid_2

AAA lid domain

298

367

0.96

PF07728

AAA_5

AAA domain (dynein-related subfamily)

90

222

0.81

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

58

244

0.8

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

91

230

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.925 17 328
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8764 17 328
4upb-assembly1.cif.gz_C electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.8351 15 296
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.821 15 324
3nbx-assembly1.cif.gz_X crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp 0.8162 15 317
ID Description Score Start End Superfamily
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9822 219 324 1.10.8.80
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9718 221 323 1.10.8.80
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9643 219 324 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9601 229 324 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9554 19 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1V5NTA5-F1-model_v4 ChlI/MoxR AAA lid domain-containing protein 0.9944 240 328
AF-X0UTW7-F1-model_v4 ATPase AAA-3 domain-containing protein 0.9892 17 158 GO:0005524
GO:0016887
AF-A0A645JSJ8-F1-model_v4 ChlI/MoxR AAA lid domain-containing protein 0.9881 229 328
AF-A0A7W1K3N1-F1-model_v4 AAA family ATPase 0.988 19 146 GO:0005524
GO:0016887
AF-A0A1C7Z357-F1-model_v4 ATPase AAA 0.9872 17 329 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.78 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map