F347983
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 235 | 168 | 470 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10007990|Ga0075364_100079909 |
| Length | 349 |
| Sequence | MIAVDSGLAPVGPCPLPAEGQTELRDLPAPAKLNLFLHVTGRRSDGYHLLQTVFTFVTLHDTVHLRRREDGLVQRVSALDGVPSDACLTVRAARALQVATGCAFGVDITLDKRVPAGGGLGXXSSDAATVLLGLNRLWGTGLSREALMALALPLGADVPVFVGGTAAFAEGVGERLQPLTLTPAWYVVVQPHAHVPTAAVFGDPCLTRDSSVVRIADFPTQHSLSPVDENADAGNRSKGIDPVALSRFGRNDLESVVFSRFSQVEQARQIMAQAVQRIGRQAGDVRMSGSGACLFVACDSQQQADTLKAEIAATIRASDEAAKAAPANAIQAVTVCAGIDKHPLQHWAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 82 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 83 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 89 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 90 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 93 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 94 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 97 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 98 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 99 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 100 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 102 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 103 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 133 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 134 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 135 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 136 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 137 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 143 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 144 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 145 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 147 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 148 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 149 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 151 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 152 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 153 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 155 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 156 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 157 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 158 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 159 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 160 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 161 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 162 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 163 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 164 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 165 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 166 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 167 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 168 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.19 |
| Metatranscriptomes | 0.85 |
| Isolates | 5.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 29.79 |
| Nodule | 0.85 |
| Rhizoplane | 0.43 |
| Rhizosphere | 57.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075364_10007990 | 3300006051 | Bacteria | 6303 |
| 2 | JGI25154J39366_1001995 | 3300002738 | Bacteria | 5978 |
| 3 | JGI25152J39213_1000224 | 3300002773 | Bacteria | 38367 |
| 4 | JGI25150J39212_1003199 | 3300002774 | Bacteria | 3879 |
| 5 | JGI25150J39212_1011201 | 3300002774 | Bacteria | 1635 |
| 6 | JGI25159J45721_1011592 | 3300002987 | Bacteria | 2150 |
| 7 | JGI25159J45721_1021715 | 3300002987 | Bacteria | 1204 |
| 8 | JGI25153J46596_10004513 | 3300003215 | Bacteria | 7491 |
| 9 | rootH1_10021305 | 3300003316 | Bacteria | 1972 |
| 10 | JGI25160J50197_1001176 | 3300003354 | Bacteria | 13335 |
| 11 | JGI25161J50226_1003233 | 3300003374 | Bacteria | 3815 |
| 12 | Ga0055529_1000473 | 3300003763 | Bacteria | 38342 |
| 13 | Ga0055526_1004613 | 3300003771 | Bacteria | 8216 |
| 14 | Ga0055526_1007594 | 3300003771 | Bacteria | 5596 |
| 15 | Ga0055537_1000038 | 3300003773 | Bacteria | 92762 |
| 16 | Ga0055537_1005266 | 3300003773 | Bacteria | 3506 |
| 17 | Ga0055537_1008757 | 3300003773 | Bacteria | 2298 |
| 18 | Ga0055524_1001031 | 3300003775 | Bacteria | 17211 |
| 19 | Ga0055524_1001453 | 3300003775 | Bacteria | 13555 |
| 20 | Ga0055524_1001929 | 3300003775 | Bacteria | 11171 |
| 21 | Ga0055534_1000074 | 3300003784 | Bacteria | 77272 |
| 22 | Ga0055534_1018573 | 3300003784 | Bacteria | 1207 |
| 23 | Ga0055528_1000231 | 3300003790 | Bacteria | 46568 |
| 24 | Ga0055528_1004830 | 3300003790 | Bacteria | 6407 |
| 25 | Ga0055530_10001965 | 3300003791 | Bacteria | 13987 |
| 26 | Ga0055543_1000924 | 3300004625 | Bacteria | 13678 |
| 27 | Ga0065165_1002806 | 3300005262 | Bacteria | 13678 |
| 28 | Ga0065704_10076112 | 3300005289 | Bacteria | 5260 |
| 29 | Ga0070661_100289250 | 3300005344 | Bacteria | 1273 |
| 30 | Ga0070671_100089649 | 3300005355 | Bacteria | 2574 |
| 31 | Ga0070667_100137522 | 3300005367 | Bacteria | 2137 |
| 32 | Ga0070667_100183998 | 3300005367 | Bacteria | 1849 |
| 33 | Ga0070698_100436871 | 3300005471 | Bacteria | 1244 |
| 34 | Ga0068853_100000225 | 3300005539 | Bacteria | 40087 |
| 35 | Ga0068853_100169525 | 3300005539 | Bacteria | 1974 |
| 36 | Ga0070665_100013080 | 3300005548 | Bacteria | 8356 |
| 37 | Ga0068855_100002951 | 3300005563 | Bacteria | 20789 |
| 38 | Ga0068864_100010250 | 3300005618 | Bacteria | 7740 |
| 39 | Ga0068864_100061645 | 3300005618 | Bacteria | 3249 |
| 40 | Ga0068863_100002342 | 3300005841 | Bacteria | 18834 |
| 41 | Ga0068863_100024593 | 3300005841 | Bacteria | 5743 |
| 42 | Ga0068858_100098982 | 3300005842 | Bacteria | 2719 |
| 43 | Ga0068860_100010719 | 3300005843 | Bacteria | 9050 |
| 44 | Ga0068860_100041214 | 3300005843 | Bacteria | 4411 |
| 45 | Ga0068862_100011728 | 3300005844 | Bacteria | 7234 |
| 46 | Ga0068862_100021433 | 3300005844 | Bacteria | 5399 |
| 47 | Ga0075365_10159647 | 3300006038 | Bacteria | 1570 |
| 48 | Ga0070712_100015351 | 3300006175 | Bacteria | 4930 |
| 49 | Ga0075366_10021409 | 3300006195 | Bacteria | 3758 |
| 50 | Ga0075366_10057150 | 3300006195 | Bacteria | 2319 |
| 51 | Ga0097621_100184012 | 3300006237 | Bacteria | 1806 |
| 52 | Ga0068871_100078059 | 3300006358 | Bacteria | 2737 |
| 53 | Ga0079104_1002320 | 3300006946 | Bacteria | 10466 |
| 54 | Ga0105242_10051306 | 3300009176 | Bacteria | 3361 |
| 55 | Ga0105248_10741838 | 3300009177 | Bacteria | 1108 |
| 56 | Ga0105237_10106640 | 3300009545 | Bacteria | 2794 |
| 57 | Ga0105249_10915859 | 3300009553 | Bacteria | 944 |
| 58 | Ga0105239_10009508 | 3300010375 | Bacteria | 10947 |
| 59 | Ga0105246_10091884 | 3300011119 | Bacteria | 2189 |
| 60 | Ga0157370_10237015 | 3300013104 | Bacteria | 1689 |
| 61 | Ga0157375_10306349 | 3300013308 | Bacteria | 1752 |
| 62 | Ga0163163_10001631 | 3300014325 | Bacteria | 18871 |
| 63 | Ga0157379_10001561 | 3300014968 | Bacteria | 18868 |
| 64 | Ga0157379_10023043 | 3300014968 | Bacteria | 5520 |
| 65 | Ga0157379_10041091 | 3300014968 | Bacteria | 4128 |
| 66 | Ga0182006_1000141 | 3300015261 | Bacteria | 77478 |
| 67 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 68 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 69 | Ga0213872_10000735 | 3300021361 | Bacteria | 24387 |
| 70 | Ga0213872_10041803 | 3300021361 | Bacteria | 2091 |
| 71 | Ga0209436_100797 | 3300025208 | Bacteria | 12952 |
| 72 | Ga0209436_101578 | 3300025208 | Bacteria | 7687 |
| 73 | Ga0209437_105469 | 3300025233 | Bacteria | 2161 |
| 74 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 75 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 76 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 77 | Ga0209565_1000123 | 3300025263 | Bacteria | 111069 |
| 78 | Ga0209565_1003210 | 3300025263 | Bacteria | 5411 |
| 79 | Ga0209565_1013045 | 3300025263 | Bacteria | 1958 |
| 80 | Ga0209455_1000563 | 3300025272 | Bacteria | 24795 |
| 81 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 82 | Ga0209130_1001646 | 3300025284 | Bacteria | 13692 |
| 83 | Ga0209130_1002777 | 3300025284 | Bacteria | 8234 |
| 84 | Ga0209130_1011412 | 3300025284 | Bacteria | 2380 |
| 85 | Ga0209675_1000117 | 3300025291 | Bacteria | 111087 |
| 86 | Ga0209675_1001690 | 3300025291 | Bacteria | 12237 |
| 87 | Ga0209675_1029580 | 3300025291 | Bacteria | 1317 |
| 88 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 89 | Ga0209564_1000780 | 3300025295 | Bacteria | 44199 |
| 90 | Ga0209564_1001271 | 3300025295 | Bacteria | 27762 |
| 91 | Ga0209564_1016913 | 3300025295 | Bacteria | 2875 |
| 92 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 93 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 94 | Ga0209050_1000795 | 3300025298 | Bacteria | 44648 |
| 95 | Ga0209256_1000288 | 3300025299 | Bacteria | 88470 |
| 96 | Ga0209256_1000674 | 3300025299 | Bacteria | 46225 |
| 97 | Ga0209256_1003939 | 3300025299 | Bacteria | 9768 |
| 98 | Ga0209256_1009037 | 3300025299 | Bacteria | 4459 |
| 99 | Ga0207426_1001270 | 3300025302 | Bacteria | 22014 |
| 100 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 101 | Ga0207645_10071023 | 3300025907 | Bacteria | 2228 |
| 102 | Ga0207671_10081160 | 3300025914 | Bacteria | 2432 |
| 103 | Ga0207686_10009825 | 3300025934 | Bacteria | 5200 |
| 104 | Ga0207711_10139801 | 3300025941 | Bacteria | 2178 |
| 105 | Ga0207667_10015938 | 3300025949 | Bacteria | 8512 |
| 106 | Ga0207658_10082707 | 3300025986 | Bacteria | 2466 |
| 107 | Ga0207703_10017115 | 3300026035 | Bacteria | 5653 |
| 108 | Ga0207639_10000208 | 3300026041 | Bacteria | 44428 |
| 109 | Ga0207639_10341167 | 3300026041 | Bacteria | 1336 |
| 110 | Ga0207678_10251319 | 3300026067 | Bacteria | 1514 |
| 111 | Ga0207641_10007225 | 3300026088 | Bacteria | 9253 |
| 112 | Ga0207641_10068380 | 3300026088 | Bacteria | 3045 |
| 113 | Ga0207676_10012702 | 3300026095 | Bacteria | 6041 |
| 114 | Ga0209281_1005643 | 3300027111 | Bacteria | 3425 |
| 115 | Ga0268265_10047955 | 3300028380 | Bacteria | 3204 |
| 116 | Ga0268264_10003897 | 3300028381 | Bacteria | 12784 |
| 117 | Ga0268264_10067240 | 3300028381 | Bacteria | 3024 |
| 118 | Ga0265323_10014668 | 3300028653 | Bacteria | 3096 |
| 119 | Ga0307515_10000257 | 3300028794 | Bacteria | 131732 |
| 120 | Ga0307515_10076511 | 3300028794 | Bacteria | 4438 |
| 121 | Ga0307511_10000545 | 3300030521 | Bacteria | 40394 |
| 122 | Ga0265327_10004733 | 3300031251 | Bacteria | 11879 |
| 123 | Ga0265327_10085686 | 3300031251 | Bacteria | 1547 |
| 124 | Ga0265316_10233910 | 3300031344 | Bacteria | 1352 |
| 125 | Ga0265316_10297660 | 3300031344 | Bacteria | 1176 |
| 126 | Ga0265316_10383769 | 3300031344 | Bacteria | 1013 |
| 127 | Ga0307509_10000009 | 3300031507 | Bacteria | 350890 |
| 128 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 129 | Ga0307408_100000531 | 3300031548 | Bacteria | 32967 |
| 130 | Ga0307408_100004170 | 3300031548 | Bacteria | 9847 |
| 131 | Ga0307408_100005814 | 3300031548 | Bacteria | 8206 |
| 132 | Ga0307408_100188878 | 3300031548 | Bacteria | 1658 |
| 133 | Ga0316576_10040851 | 3300031727 | Bacteria | 3335 |
| 134 | Ga0316576_10043502 | 3300031727 | Bacteria | 3240 |
| 135 | Ga0307406_10016876 | 3300031901 | Bacteria | 4248 |
| 136 | Ga0307412_10131448 | 3300031911 | Bacteria | 1819 |
| 137 | Ga0307415_100091947 | 3300032126 | Bacteria | 2199 |
| 138 | Ga0316580_10001573 | 3300032139 | Bacteria | 6023 |
| 139 | Ga0307507_10019570 | 3300033179 | Bacteria | 7620 |
| 140 | Ga0316592_1005089 | 3300033524 | Bacteria | 2479 |
| 141 | Ga0316588_1003562 | 3300033528 | Bacteria | 2859 |
| 142 | Ga0316574_0003610 | 3300035398 | Bacteria | 8011 |
| 143 | Ga0316582_0092282 | 3300036647 | Bacteria | 1995 |
| 144 | Ga0316584_0080253 | 3300036712 | Bacteria | 2444 |
| 145 | Ga0436361_0169339 | 3300039447 | Bacteria | 26126 |
| 146 | Ga0436361_0491913 | 3300039447 | Bacteria | 14451 |
| 147 | Ga0451793_0783927 | 3300041452 | Bacteria | 2409 |
| 148 | Ga0453684_0257873 | 3300044712 | Bacteria | 1999 |
| 149 | Ga0451576_0048065 | 3300045051 | Bacteria | 4484 |
| 150 | Ga0451576_0096010 | 3300045051 | Bacteria | 3083 |
| 151 | Ga0451576_0166129 | 3300045051 | Bacteria | 2303 |
| 152 | Ga0451576_0639036 | 3300045051 | Bacteria | 1118 |
| 153 | Ga0495617_000245 | 3300046452 | Bacteria | 32248 |
| 154 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 155 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 156 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 157 | Ga0495653_0173699 | 3300046463 | Bacteria | 1485 |
| 158 | Ga0495650_0000251 | 3300046471 | Bacteria | 105577 |
| 159 | Ga0495650_0000485 | 3300046471 | Bacteria | 60761 |
| 160 | Ga0495650_0039011 | 3300046471 | Bacteria | 2052 |
| 161 | Ga0495605_0000061 | 3300046474 | Bacteria | 145286 |
| 162 | Ga0495639_0018559 | 3300046475 | Bacteria | 3030 |
| 163 | Ga0495585_0002222 | 3300046492 | Bacteria | 14064 |
| 164 | Ga0495583_0002937 | 3300046506 | Bacteria | 13735 |
| 165 | Ga0495606_0000262 | 3300046507 | Bacteria | 92896 |
| 166 | Ga0495606_0010828 | 3300046507 | Bacteria | 7515 |
| 167 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 168 | Ga0495637_0000179 | 3300046520 | Bacteria | 49260 |
| 169 | Ga0495648_0000350 | 3300046524 | Bacteria | 50788 |
| 170 | Ga0495648_0029750 | 3300046524 | Bacteria | 3620 |
| 171 | Ga0495642_0001394 | 3300046528 | Bacteria | 10821 |
| 172 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 173 | Ga0495654_0001046 | 3300046530 | Bacteria | 20265 |
| 174 | Ga0495654_0096322 | 3300046530 | Bacteria | 1367 |
| 175 | Ga0495597_0002718 | 3300046542 | Bacteria | 10912 |
| 176 | Ga0495622_0001922 | 3300046557 | Bacteria | 10209 |
| 177 | Ga0495633_0001353 | 3300046558 | Bacteria | 19214 |
| 178 | Ga0495633_0003452 | 3300046558 | Bacteria | 10508 |
| 179 | Ga0495633_0004606 | 3300046558 | Bacteria | 8688 |
| 180 | Ga0495633_0048680 | 3300046558 | Bacteria | 2001 |
| 181 | Ga0495668_0002105 | 3300046616 | Bacteria | 17216 |
| 182 | Ga0495668_0004696 | 3300046616 | Bacteria | 9580 |
| 183 | Ga0495625_0001192 | 3300046660 | Bacteria | 33259 |
| 184 | Ga0495625_0007112 | 3300046660 | Bacteria | 9829 |
| 185 | Ga0495661_0033783 | 3300046665 | Bacteria | 3224 |
| 186 | Ga0495670_0083614 | 3300046691 | Bacteria | 1628 |
| 187 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 188 | Ga0495660_0001903 | 3300046810 | Bacteria | 13643 |
| 189 | Ga0495672_0063954 | 3300047320 | Bacteria | 2109 |
| 190 | Ga0495683_0057983 | 3300047323 | Bacteria | 1924 |
| 191 | Ga0495679_017378 | 3300047446 | Bacteria | 2575 |
| 192 | Ga0495673_0000179 | 3300047469 | Bacteria | 102128 |
| 193 | Ga0495686_0000988 | 3300047472 | Bacteria | 34672 |
| 194 | Ga0495686_0001635 | 3300047472 | Bacteria | 23409 |
| 195 | Ga0496116_0038150 | 3300048919 | Bacteria | 3340 |
| 196 | Ga0496120_0115497 | 3300048923 | Bacteria | 1395 |
| 197 | Ga0496123_0008730 | 3300048926 | Bacteria | 9252 |
| 198 | Ga0496123_0033567 | 3300048926 | Bacteria | 3691 |
| 199 | Ga0496125_0001189 | 3300048928 | Bacteria | 39370 |
| 200 | Ga0496126_0001477 | 3300048929 | Bacteria | 36534 |
| 201 | Ga0496126_0012895 | 3300048929 | Bacteria | 8536 |
| 202 | Ga0495678_006030 | 3300049459 | Bacteria | 6529 |
| 203 | Ga0495678_075666 | 3300049459 | Bacteria | 1222 |
| 204 | Ga0501031_0002015 | 3300049568 | Bacteria | 12792 |
| 205 | Ga0501043_0033189 | 3300049579 | Bacteria | 4060 |
| 206 | Ga0501035_0016625 | 3300049822 | Bacteria | 6783 |
| 207 | Ga0501035_0051512 | 3300049822 | Bacteria | 3686 |
| 208 | Ga0501044_0000045 | 3300049823 | Bacteria | 148353 |
| 209 | nmdc:mga00v17_38820_c1 | 3300050491 | Bacteria | 2849 |
| 210 | nmdc:mga0k408_72762_c1 | 3300050493 | Bacteria | 2007 |
| 211 | nmdc:mga07m45_54819_c1 | 3300050496 | Bacteria | 2253 |
| 212 | Ga0500644_0159572 | 3300053088 | Bacteria | 910 |
| 213 | Ga0500646_0003914 | 3300053090 | Bacteria | 3788 |
| 214 | Ga0500562_026696 | 3300053108 | Bacteria | 1514 |
| 215 | Ga0500569_029503 | 3300053109 | Bacteria | 1529 |
| 216 | Ga0500618_000139 | 3300053125 | Bacteria | 60811 |
| 217 | Ga0500655_001368 | 3300053133 | Bacteria | 4614 |
| 218 | Ga0500586_017316 | 3300053145 | Bacteria | 2202 |
| 219 | Ga0500604_0005678 | 3300053151 | Bacteria | 3293 |
| 220 | Ga0500616_0139081 | 3300053153 | Bacteria | 1137 |
| 221 | Ga0500637_0142898 | 3300053178 | Bacteria | 1385 |
| 222 | 2643792030 | 2643221554 | Bacteria | 6603920 |
| 223 | 2643936584 | 2643221585 | Bacteria | 5812563 |
| 224 | 2644216488 | 2643221638 | Bacteria | 6579467 |
| 225 | 2644317940 | 2643221656 | Bacteria | 5809961 |
| 226 | 2738826834 | 2738541297 | Bacteria | 6549566 |
| 227 | 2739150631 | 2738541357 | Bacteria | 6549408 |
| 228 | 2739192550 | 2738543003 | Bacteria | 6549560 |
| 229 | 2739319027 | 2738543026 | Bacteria | 6549408 |
| 230 | 2739337268 | 2738543029 | Bacteria | 6549249 |
| 231 | 2821135832 | 2821131069 | Bacteria | 6108407 |
| 232 | 2857568044 | 2857564685 | Bacteria | 6290584 |
| 233 | 2919477009 | 2919476304 | Bacteria | 5888696 |
| 234 | 2932426387 | 2932422444 | Bacteria | 4678430 |
| 235 | 8055228943 | 8055225921 | Bacteria | 3341787 |
| 236 | Ga0075364_10007990 | |||
| 237 | JGI25154J39366_1001995 | |||
| 238 | JGI25152J39213_1000224 | |||
| 239 | JGI25150J39212_1003199 | |||
| 240 | JGI25150J39212_1011201 | |||
| 241 | JGI25159J45721_1011592 | |||
| 242 | JGI25159J45721_1021715 | |||
| 243 | JGI25153J46596_10004513 | |||
| 244 | rootH1_10021305 | |||
| 245 | JGI25160J50197_1001176 | |||
| 246 | JGI25161J50226_1003233 | |||
| 247 | Ga0055529_1000473 | |||
| 248 | Ga0055526_1004613 | |||
| 249 | Ga0055526_1007594 | |||
| 250 | Ga0055537_1000038 | |||
| 251 | Ga0055537_1005266 | |||
| 252 | Ga0055537_1008757 | |||
| 253 | Ga0055524_1001031 | |||
| 254 | Ga0055524_1001453 | |||
| 255 | Ga0055524_1001929 | |||
| 256 | Ga0055534_1000074 | |||
| 257 | Ga0055534_1018573 | |||
| 258 | Ga0055528_1000231 | |||
| 259 | Ga0055528_1004830 | |||
| 260 | Ga0055530_10001965 | |||
| 261 | Ga0055543_1000924 | |||
| 262 | Ga0065165_1002806 | |||
| 263 | Ga0065704_10076112 | |||
| 264 | Ga0070661_100289250 | |||
| 265 | Ga0070671_100089649 | |||
| 266 | Ga0070667_100137522 | |||
| 267 | Ga0070667_100183998 | |||
| 268 | Ga0070698_100436871 | |||
| 269 | Ga0068853_100000225 | |||
| 270 | Ga0068853_100169525 | |||
| 271 | Ga0070665_100013080 | |||
| 272 | Ga0068855_100002951 | |||
| 273 | Ga0068864_100010250 | |||
| 274 | Ga0068864_100061645 | |||
| 275 | Ga0068863_100002342 | |||
| 276 | Ga0068863_100024593 | |||
| 277 | Ga0068858_100098982 | |||
| 278 | Ga0068860_100010719 | |||
| 279 | Ga0068860_100041214 | |||
| 280 | Ga0068862_100011728 | |||
| 281 | Ga0068862_100021433 | |||
| 282 | Ga0075365_10159647 | |||
| 283 | Ga0070712_100015351 | |||
| 284 | Ga0075366_10021409 | |||
| 285 | Ga0075366_10057150 | |||
| 286 | Ga0097621_100184012 | |||
| 287 | Ga0068871_100078059 | |||
| 288 | Ga0079104_1002320 | |||
| 289 | Ga0105242_10051306 | |||
| 290 | Ga0105248_10741838 | |||
| 291 | Ga0105237_10106640 | |||
| 292 | Ga0105249_10915859 | |||
| 293 | Ga0105239_10009508 | |||
| 294 | Ga0105246_10091884 | |||
| 295 | Ga0157370_10237015 | |||
| 296 | Ga0157375_10306349 | |||
| 297 | Ga0163163_10001631 | |||
| 298 | Ga0157379_10001561 | |||
| 299 | Ga0157379_10023043 | |||
| 300 | Ga0157379_10041091 | |||
| 301 | Ga0182006_1000141 | |||
| 302 | Ga0182005_1000016 | |||
| 303 | Ga0213872_10000006 | |||
| 304 | Ga0213872_10000735 | |||
| 305 | Ga0213872_10041803 | |||
| 306 | Ga0209436_100797 | |||
| 307 | Ga0209436_101578 | |||
| 308 | Ga0209437_105469 | |||
| 309 | Ga0207425_1000021 | |||
| 310 | Ga0209646_1000068 | |||
| 311 | Ga0209129_1000020 | |||
| 312 | Ga0209565_1000123 | |||
| 313 | Ga0209565_1003210 | |||
| 314 | Ga0209565_1013045 | |||
| 315 | Ga0209455_1000563 | |||
| 316 | Ga0209673_1000040 | |||
| 317 | Ga0209130_1001646 | |||
| 318 | Ga0209130_1002777 | |||
| 319 | Ga0209130_1011412 | |||
| 320 | Ga0209675_1000117 | |||
| 321 | Ga0209675_1001690 | |||
| 322 | Ga0209675_1029580 | |||
| 323 | Ga0209564_1000121 | |||
| 324 | Ga0209564_1000780 | |||
| 325 | Ga0209564_1001271 | |||
| 326 | Ga0209564_1016913 | |||
| 327 | Ga0209758_1000077 | |||
| 328 | Ga0209050_1000050 | |||
| 329 | Ga0209050_1000795 | |||
| 330 | Ga0209256_1000288 | |||
| 331 | Ga0209256_1000674 | |||
| 332 | Ga0209256_1003939 | |||
| 333 | Ga0209256_1009037 | |||
| 334 | Ga0207426_1001270 | |||
| 335 | Ga0209257_1000075 | |||
| 336 | Ga0207645_10071023 | |||
| 337 | Ga0207671_10081160 | |||
| 338 | Ga0207686_10009825 | |||
| 339 | Ga0207711_10139801 | |||
| 340 | Ga0207667_10015938 | |||
| 341 | Ga0207658_10082707 | |||
| 342 | Ga0207703_10017115 | |||
| 343 | Ga0207639_10000208 | |||
| 344 | Ga0207639_10341167 | |||
| 345 | Ga0207678_10251319 | |||
| 346 | Ga0207641_10007225 | |||
| 347 | Ga0207641_10068380 | |||
| 348 | Ga0207676_10012702 | |||
| 349 | Ga0209281_1005643 | |||
| 350 | Ga0268265_10047955 | |||
| 351 | Ga0268264_10003897 | |||
| 352 | Ga0268264_10067240 | |||
| 353 | Ga0265323_10014668 | |||
| 354 | Ga0307515_10000257 | |||
| 355 | Ga0307515_10076511 | |||
| 356 | Ga0307511_10000545 | |||
| 357 | Ga0265327_10004733 | |||
| 358 | Ga0265327_10085686 | |||
| 359 | Ga0265316_10233910 | |||
| 360 | Ga0265316_10297660 | |||
| 361 | Ga0265316_10383769 | |||
| 362 | Ga0307509_10000009 | |||
| 363 | Ga0307408_100000029 | |||
| 364 | Ga0307408_100000531 | |||
| 365 | Ga0307408_100004170 | |||
| 366 | Ga0307408_100005814 | |||
| 367 | Ga0307408_100188878 | |||
| 368 | Ga0316576_10040851 | |||
| 369 | Ga0316576_10043502 | |||
| 370 | Ga0307406_10016876 | |||
| 371 | Ga0307412_10131448 | |||
| 372 | Ga0307415_100091947 | |||
| 373 | Ga0316580_10001573 | |||
| 374 | Ga0307507_10019570 | |||
| 375 | Ga0316592_1005089 | |||
| 376 | Ga0316588_1003562 | |||
| 377 | Ga0316574_0003610 | |||
| 378 | Ga0316582_0092282 | |||
| 379 | Ga0316584_0080253 | |||
| 380 | Ga0436361_0169339 | |||
| 381 | Ga0436361_0491913 | |||
| 382 | Ga0451793_0783927 | |||
| 383 | Ga0453684_0257873 | |||
| 384 | Ga0451576_0048065 | |||
| 385 | Ga0451576_0096010 | |||
| 386 | Ga0451576_0166129 | |||
| 387 | Ga0451576_0639036 | |||
| 388 | Ga0495617_000245 | |||
| 389 | Ga0495590_0000020 | |||
| 390 | Ga0495638_0000235 | |||
| 391 | Ga0495653_0000067 | |||
| 392 | Ga0495653_0173699 | |||
| 393 | Ga0495650_0000251 | |||
| 394 | Ga0495650_0000485 | |||
| 395 | Ga0495650_0039011 | |||
| 396 | Ga0495605_0000061 | |||
| 397 | Ga0495639_0018559 | |||
| 398 | Ga0495585_0002222 | |||
| 399 | Ga0495583_0002937 | |||
| 400 | Ga0495606_0000262 | |||
| 401 | Ga0495606_0010828 | |||
| 402 | Ga0495610_0000017 | |||
| 403 | Ga0495637_0000179 | |||
| 404 | Ga0495648_0000350 | |||
| 405 | Ga0495648_0029750 | |||
| 406 | Ga0495642_0001394 | |||
| 407 | Ga0495654_0000060 | |||
| 408 | Ga0495654_0001046 | |||
| 409 | Ga0495654_0096322 | |||
| 410 | Ga0495597_0002718 | |||
| 411 | Ga0495622_0001922 | |||
| 412 | Ga0495633_0001353 | |||
| 413 | Ga0495633_0003452 | |||
| 414 | Ga0495633_0004606 | |||
| 415 | Ga0495633_0048680 | |||
| 416 | Ga0495668_0002105 | |||
| 417 | Ga0495668_0004696 | |||
| 418 | Ga0495625_0001192 | |||
| 419 | Ga0495625_0007112 | |||
| 420 | Ga0495661_0033783 | |||
| 421 | Ga0495670_0083614 | |||
| 422 | Ga0495671_0000037 | |||
| 423 | Ga0495660_0001903 | |||
| 424 | Ga0495672_0063954 | |||
| 425 | Ga0495683_0057983 | |||
| 426 | Ga0495679_017378 | |||
| 427 | Ga0495673_0000179 | |||
| 428 | Ga0495686_0000988 | |||
| 429 | Ga0495686_0001635 | |||
| 430 | Ga0496116_0038150 | |||
| 431 | Ga0496120_0115497 | |||
| 432 | Ga0496123_0008730 | |||
| 433 | Ga0496123_0033567 | |||
| 434 | Ga0496125_0001189 | |||
| 435 | Ga0496126_0001477 | |||
| 436 | Ga0496126_0012895 | |||
| 437 | Ga0495678_006030 | |||
| 438 | Ga0495678_075666 | |||
| 439 | Ga0501031_0002015 | |||
| 440 | Ga0501043_0033189 | |||
| 441 | Ga0501035_0016625 | |||
| 442 | Ga0501035_0051512 | |||
| 443 | Ga0501044_0000045 | |||
| 444 | nmdc:mga00v17_38820_c1 | |||
| 445 | nmdc:mga0k408_72762_c1 | |||
| 446 | nmdc:mga07m45_54819_c1 | |||
| 447 | Ga0500644_0159572 | |||
| 448 | Ga0500646_0003914 | |||
| 449 | Ga0500562_026696 | |||
| 450 | Ga0500569_029503 | |||
| 451 | Ga0500618_000139 | |||
| 452 | Ga0500655_001368 | |||
| 453 | Ga0500586_017316 | |||
| 454 | Ga0500604_0005678 | |||
| 455 | Ga0500616_0139081 | |||
| 456 | Ga0500637_0142898 | |||
| 457 | 2643792030 | |||
| 458 | 2643936584 | |||
| 459 | 2644216488 | |||
| 460 | 2644317940 | |||
| 461 | 2738826834 | |||
| 462 | 2739150631 | |||
| 463 | 2739192550 | |||
| 464 | 2739319027 | |||
| 465 | 2739337268 | |||
| 466 | 2821135832 | |||
| 467 | 2857568044 | |||
| 468 | 2919477009 | |||
| 469 | 2932426387 | |||
| 470 | 8055228943 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ww4-assembly1.cif.gz_B | a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase | 0.9223 | 3 | 284 |
| 2ww4-assembly1.cif.gz_B | a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase | 0.916 | 3 | 284 |
| 1uek-assembly1.cif.gz_A | crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase | 0.8541 | 8 | 274 |
| 1uek-assembly1.cif.gz_A | crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase | 0.8334 | 8 | 274 |
| 4emd-assembly1.cif.gz_A | crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 | 0.7994 | 3 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ww4A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain | 0.9229 | 158 | 284 | 3.30.70.890 |
| 1oj4B01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9218 | 4 | 157 | 3.30.230.10 |
| 2ww4A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain | 0.9155 | 158 | 284 | 3.30.70.890 |
| 1oj4B01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8884 | 4 | 157 | 3.30.230.10 |
| af_Q2G0S8_1_157_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8442 | 1 | 156 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8CUH5-F1-model_v4 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) | 0.9847 | 1 | 284 |
GO:0005524
GO:0016114 GO:0019288 GO:0050515 |
| AF-A0A7V8CUH5-F1-model_v4 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) | 0.9813 | 1 | 284 |
GO:0005524
GO:0016114 GO:0019288 GO:0050515 |
| AF-A0A4Q3MJ56-F1-model_v4 | 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) | 0.9784 | 112 | 282 |
GO:0050515
|
| AF-A0A7C0VUX1-F1-model_v4 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) | 0.9704 | 105 | 283 |
GO:0005524
GO:0016114 GO:0050515 |
| AF-A7C1K6-F1-model_v4 | deleted | 0.9684 | 119 | 283 |
|