F347983

General Info

Members Datasets Scaffolds Average Seq Length
235 168 470 285

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10007990|Ga0075364_100079909
Length 349
Sequence MIAVDSGLAPVGPCPLPAEGQTELRDLPAPAKLNLFLHVTGRRSDGYHLLQTVFTFVTLHDTVHLRRREDGLVQRVSALDGVPSDACLTVRAARALQVATGCAFGVDITLDKRVPAGGGLGXXSSDAATVLLGLNRLWGTGLSREALMALALPLGADVPVFVGGTAAFAEGVGERLQPLTLTPAWYVVVQPHAHVPTAAVFGDPCLTRDSSVVRIADFPTQHSLSPVDENADAGNRSKGIDPVALSRFGRNDLESVVFSRFSQVEQARQIMAQAVQRIGRQAGDVRMSGSGACLFVACDSQQQADTLKAEIAATIRASDEAAKAAPANAIQAVTVCAGIDKHPLQHWAE

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
151 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
152 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
156 2643221585 Pelomonas sp. Root662 Isolate Unclassified
157 2643221638 Duganella sp. Root336D2 Isolate Unclassified
158 2643221656 Pelomonas sp. Root405 Isolate Unclassified
159 2738541297 Duganella sp. GV083 Isolate Unclassified
160 2738541357 Duganella sp. GV053 Isolate Unclassified
161 2738543003 Duganella sp. GV066 Isolate Unclassified
162 2738543026 Duganella sp. GV089 Isolate Unclassified
163 2738543029 Duganella sp. GV039 Isolate Unclassified
164 2821131069 Duganella sp. 1224 Isolate Unclassified
165 2857564685 Duganella sp. R-74599 Isolate Unclassified
166 2919476304 Duganella sp. 3397 Isolate Unclassified
167 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
168 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0.85
Isolates 5.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.79
Nodule 0.85
Rhizoplane 0.43
Rhizosphere 57.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10007990 3300006051 Bacteria 6303
2 JGI25154J39366_1001995 3300002738 Bacteria 5978
3 JGI25152J39213_1000224 3300002773 Bacteria 38367
4 JGI25150J39212_1003199 3300002774 Bacteria 3879
5 JGI25150J39212_1011201 3300002774 Bacteria 1635
6 JGI25159J45721_1011592 3300002987 Bacteria 2150
7 JGI25159J45721_1021715 3300002987 Bacteria 1204
8 JGI25153J46596_10004513 3300003215 Bacteria 7491
9 rootH1_10021305 3300003316 Bacteria 1972
10 JGI25160J50197_1001176 3300003354 Bacteria 13335
11 JGI25161J50226_1003233 3300003374 Bacteria 3815
12 Ga0055529_1000473 3300003763 Bacteria 38342
13 Ga0055526_1004613 3300003771 Bacteria 8216
14 Ga0055526_1007594 3300003771 Bacteria 5596
15 Ga0055537_1000038 3300003773 Bacteria 92762
16 Ga0055537_1005266 3300003773 Bacteria 3506
17 Ga0055537_1008757 3300003773 Bacteria 2298
18 Ga0055524_1001031 3300003775 Bacteria 17211
19 Ga0055524_1001453 3300003775 Bacteria 13555
20 Ga0055524_1001929 3300003775 Bacteria 11171
21 Ga0055534_1000074 3300003784 Bacteria 77272
22 Ga0055534_1018573 3300003784 Bacteria 1207
23 Ga0055528_1000231 3300003790 Bacteria 46568
24 Ga0055528_1004830 3300003790 Bacteria 6407
25 Ga0055530_10001965 3300003791 Bacteria 13987
26 Ga0055543_1000924 3300004625 Bacteria 13678
27 Ga0065165_1002806 3300005262 Bacteria 13678
28 Ga0065704_10076112 3300005289 Bacteria 5260
29 Ga0070661_100289250 3300005344 Bacteria 1273
30 Ga0070671_100089649 3300005355 Bacteria 2574
31 Ga0070667_100137522 3300005367 Bacteria 2137
32 Ga0070667_100183998 3300005367 Bacteria 1849
33 Ga0070698_100436871 3300005471 Bacteria 1244
34 Ga0068853_100000225 3300005539 Bacteria 40087
35 Ga0068853_100169525 3300005539 Bacteria 1974
36 Ga0070665_100013080 3300005548 Bacteria 8356
37 Ga0068855_100002951 3300005563 Bacteria 20789
38 Ga0068864_100010250 3300005618 Bacteria 7740
39 Ga0068864_100061645 3300005618 Bacteria 3249
40 Ga0068863_100002342 3300005841 Bacteria 18834
41 Ga0068863_100024593 3300005841 Bacteria 5743
42 Ga0068858_100098982 3300005842 Bacteria 2719
43 Ga0068860_100010719 3300005843 Bacteria 9050
44 Ga0068860_100041214 3300005843 Bacteria 4411
45 Ga0068862_100011728 3300005844 Bacteria 7234
46 Ga0068862_100021433 3300005844 Bacteria 5399
47 Ga0075365_10159647 3300006038 Bacteria 1570
48 Ga0070712_100015351 3300006175 Bacteria 4930
49 Ga0075366_10021409 3300006195 Bacteria 3758
50 Ga0075366_10057150 3300006195 Bacteria 2319
51 Ga0097621_100184012 3300006237 Bacteria 1806
52 Ga0068871_100078059 3300006358 Bacteria 2737
53 Ga0079104_1002320 3300006946 Bacteria 10466
54 Ga0105242_10051306 3300009176 Bacteria 3361
55 Ga0105248_10741838 3300009177 Bacteria 1108
56 Ga0105237_10106640 3300009545 Bacteria 2794
57 Ga0105249_10915859 3300009553 Bacteria 944
58 Ga0105239_10009508 3300010375 Bacteria 10947
59 Ga0105246_10091884 3300011119 Bacteria 2189
60 Ga0157370_10237015 3300013104 Bacteria 1689
61 Ga0157375_10306349 3300013308 Bacteria 1752
62 Ga0163163_10001631 3300014325 Bacteria 18871
63 Ga0157379_10001561 3300014968 Bacteria 18868
64 Ga0157379_10023043 3300014968 Bacteria 5520
65 Ga0157379_10041091 3300014968 Bacteria 4128
66 Ga0182006_1000141 3300015261 Bacteria 77478
67 Ga0182005_1000016 3300015265 Bacteria 346889
68 Ga0213872_10000006 3300021361 Bacteria 249845
69 Ga0213872_10000735 3300021361 Bacteria 24387
70 Ga0213872_10041803 3300021361 Bacteria 2091
71 Ga0209436_100797 3300025208 Bacteria 12952
72 Ga0209436_101578 3300025208 Bacteria 7687
73 Ga0209437_105469 3300025233 Bacteria 2161
74 Ga0207425_1000021 3300025245 Bacteria 367537
75 Ga0209646_1000068 3300025246 Bacteria 233765
76 Ga0209129_1000020 3300025258 Bacteria 457053
77 Ga0209565_1000123 3300025263 Bacteria 111069
78 Ga0209565_1003210 3300025263 Bacteria 5411
79 Ga0209565_1013045 3300025263 Bacteria 1958
80 Ga0209455_1000563 3300025272 Bacteria 24795
81 Ga0209673_1000040 3300025273 Bacteria 312633
82 Ga0209130_1001646 3300025284 Bacteria 13692
83 Ga0209130_1002777 3300025284 Bacteria 8234
84 Ga0209130_1011412 3300025284 Bacteria 2380
85 Ga0209675_1000117 3300025291 Bacteria 111087
86 Ga0209675_1001690 3300025291 Bacteria 12237
87 Ga0209675_1029580 3300025291 Bacteria 1317
88 Ga0209564_1000121 3300025295 Bacteria 204081
89 Ga0209564_1000780 3300025295 Bacteria 44199
90 Ga0209564_1001271 3300025295 Bacteria 27762
91 Ga0209564_1016913 3300025295 Bacteria 2875
92 Ga0209758_1000077 3300025297 Bacteria 268195
93 Ga0209050_1000050 3300025298 Bacteria 362578
94 Ga0209050_1000795 3300025298 Bacteria 44648
95 Ga0209256_1000288 3300025299 Bacteria 88470
96 Ga0209256_1000674 3300025299 Bacteria 46225
97 Ga0209256_1003939 3300025299 Bacteria 9768
98 Ga0209256_1009037 3300025299 Bacteria 4459
99 Ga0207426_1001270 3300025302 Bacteria 22014
100 Ga0209257_1000075 3300025304 Bacteria 324855
101 Ga0207645_10071023 3300025907 Bacteria 2228
102 Ga0207671_10081160 3300025914 Bacteria 2432
103 Ga0207686_10009825 3300025934 Bacteria 5200
104 Ga0207711_10139801 3300025941 Bacteria 2178
105 Ga0207667_10015938 3300025949 Bacteria 8512
106 Ga0207658_10082707 3300025986 Bacteria 2466
107 Ga0207703_10017115 3300026035 Bacteria 5653
108 Ga0207639_10000208 3300026041 Bacteria 44428
109 Ga0207639_10341167 3300026041 Bacteria 1336
110 Ga0207678_10251319 3300026067 Bacteria 1514
111 Ga0207641_10007225 3300026088 Bacteria 9253
112 Ga0207641_10068380 3300026088 Bacteria 3045
113 Ga0207676_10012702 3300026095 Bacteria 6041
114 Ga0209281_1005643 3300027111 Bacteria 3425
115 Ga0268265_10047955 3300028380 Bacteria 3204
116 Ga0268264_10003897 3300028381 Bacteria 12784
117 Ga0268264_10067240 3300028381 Bacteria 3024
118 Ga0265323_10014668 3300028653 Bacteria 3096
119 Ga0307515_10000257 3300028794 Bacteria 131732
120 Ga0307515_10076511 3300028794 Bacteria 4438
121 Ga0307511_10000545 3300030521 Bacteria 40394
122 Ga0265327_10004733 3300031251 Bacteria 11879
123 Ga0265327_10085686 3300031251 Bacteria 1547
124 Ga0265316_10233910 3300031344 Bacteria 1352
125 Ga0265316_10297660 3300031344 Bacteria 1176
126 Ga0265316_10383769 3300031344 Bacteria 1013
127 Ga0307509_10000009 3300031507 Bacteria 350890
128 Ga0307408_100000029 3300031548 Bacteria 227806
129 Ga0307408_100000531 3300031548 Bacteria 32967
130 Ga0307408_100004170 3300031548 Bacteria 9847
131 Ga0307408_100005814 3300031548 Bacteria 8206
132 Ga0307408_100188878 3300031548 Bacteria 1658
133 Ga0316576_10040851 3300031727 Bacteria 3335
134 Ga0316576_10043502 3300031727 Bacteria 3240
135 Ga0307406_10016876 3300031901 Bacteria 4248
136 Ga0307412_10131448 3300031911 Bacteria 1819
137 Ga0307415_100091947 3300032126 Bacteria 2199
138 Ga0316580_10001573 3300032139 Bacteria 6023
139 Ga0307507_10019570 3300033179 Bacteria 7620
140 Ga0316592_1005089 3300033524 Bacteria 2479
141 Ga0316588_1003562 3300033528 Bacteria 2859
142 Ga0316574_0003610 3300035398 Bacteria 8011
143 Ga0316582_0092282 3300036647 Bacteria 1995
144 Ga0316584_0080253 3300036712 Bacteria 2444
145 Ga0436361_0169339 3300039447 Bacteria 26126
146 Ga0436361_0491913 3300039447 Bacteria 14451
147 Ga0451793_0783927 3300041452 Bacteria 2409
148 Ga0453684_0257873 3300044712 Bacteria 1999
149 Ga0451576_0048065 3300045051 Bacteria 4484
150 Ga0451576_0096010 3300045051 Bacteria 3083
151 Ga0451576_0166129 3300045051 Bacteria 2303
152 Ga0451576_0639036 3300045051 Bacteria 1118
153 Ga0495617_000245 3300046452 Bacteria 32248
154 Ga0495590_0000020 3300046457 Bacteria 212352
155 Ga0495638_0000235 3300046460 Bacteria 75760
156 Ga0495653_0000067 3300046463 Bacteria 90116
157 Ga0495653_0173699 3300046463 Bacteria 1485
158 Ga0495650_0000251 3300046471 Bacteria 105577
159 Ga0495650_0000485 3300046471 Bacteria 60761
160 Ga0495650_0039011 3300046471 Bacteria 2052
161 Ga0495605_0000061 3300046474 Bacteria 145286
162 Ga0495639_0018559 3300046475 Bacteria 3030
163 Ga0495585_0002222 3300046492 Bacteria 14064
164 Ga0495583_0002937 3300046506 Bacteria 13735
165 Ga0495606_0000262 3300046507 Bacteria 92896
166 Ga0495606_0010828 3300046507 Bacteria 7515
167 Ga0495610_0000017 3300046512 Bacteria 365675
168 Ga0495637_0000179 3300046520 Bacteria 49260
169 Ga0495648_0000350 3300046524 Bacteria 50788
170 Ga0495648_0029750 3300046524 Bacteria 3620
171 Ga0495642_0001394 3300046528 Bacteria 10821
172 Ga0495654_0000060 3300046530 Bacteria 134307
173 Ga0495654_0001046 3300046530 Bacteria 20265
174 Ga0495654_0096322 3300046530 Bacteria 1367
175 Ga0495597_0002718 3300046542 Bacteria 10912
176 Ga0495622_0001922 3300046557 Bacteria 10209
177 Ga0495633_0001353 3300046558 Bacteria 19214
178 Ga0495633_0003452 3300046558 Bacteria 10508
179 Ga0495633_0004606 3300046558 Bacteria 8688
180 Ga0495633_0048680 3300046558 Bacteria 2001
181 Ga0495668_0002105 3300046616 Bacteria 17216
182 Ga0495668_0004696 3300046616 Bacteria 9580
183 Ga0495625_0001192 3300046660 Bacteria 33259
184 Ga0495625_0007112 3300046660 Bacteria 9829
185 Ga0495661_0033783 3300046665 Bacteria 3224
186 Ga0495670_0083614 3300046691 Bacteria 1628
187 Ga0495671_0000037 3300046692 Bacteria 177605
188 Ga0495660_0001903 3300046810 Bacteria 13643
189 Ga0495672_0063954 3300047320 Bacteria 2109
190 Ga0495683_0057983 3300047323 Bacteria 1924
191 Ga0495679_017378 3300047446 Bacteria 2575
192 Ga0495673_0000179 3300047469 Bacteria 102128
193 Ga0495686_0000988 3300047472 Bacteria 34672
194 Ga0495686_0001635 3300047472 Bacteria 23409
195 Ga0496116_0038150 3300048919 Bacteria 3340
196 Ga0496120_0115497 3300048923 Bacteria 1395
197 Ga0496123_0008730 3300048926 Bacteria 9252
198 Ga0496123_0033567 3300048926 Bacteria 3691
199 Ga0496125_0001189 3300048928 Bacteria 39370
200 Ga0496126_0001477 3300048929 Bacteria 36534
201 Ga0496126_0012895 3300048929 Bacteria 8536
202 Ga0495678_006030 3300049459 Bacteria 6529
203 Ga0495678_075666 3300049459 Bacteria 1222
204 Ga0501031_0002015 3300049568 Bacteria 12792
205 Ga0501043_0033189 3300049579 Bacteria 4060
206 Ga0501035_0016625 3300049822 Bacteria 6783
207 Ga0501035_0051512 3300049822 Bacteria 3686
208 Ga0501044_0000045 3300049823 Bacteria 148353
209 nmdc:mga00v17_38820_c1 3300050491 Bacteria 2849
210 nmdc:mga0k408_72762_c1 3300050493 Bacteria 2007
211 nmdc:mga07m45_54819_c1 3300050496 Bacteria 2253
212 Ga0500644_0159572 3300053088 Bacteria 910
213 Ga0500646_0003914 3300053090 Bacteria 3788
214 Ga0500562_026696 3300053108 Bacteria 1514
215 Ga0500569_029503 3300053109 Bacteria 1529
216 Ga0500618_000139 3300053125 Bacteria 60811
217 Ga0500655_001368 3300053133 Bacteria 4614
218 Ga0500586_017316 3300053145 Bacteria 2202
219 Ga0500604_0005678 3300053151 Bacteria 3293
220 Ga0500616_0139081 3300053153 Bacteria 1137
221 Ga0500637_0142898 3300053178 Bacteria 1385
222 2643792030 2643221554 Bacteria 6603920
223 2643936584 2643221585 Bacteria 5812563
224 2644216488 2643221638 Bacteria 6579467
225 2644317940 2643221656 Bacteria 5809961
226 2738826834 2738541297 Bacteria 6549566
227 2739150631 2738541357 Bacteria 6549408
228 2739192550 2738543003 Bacteria 6549560
229 2739319027 2738543026 Bacteria 6549408
230 2739337268 2738543029 Bacteria 6549249
231 2821135832 2821131069 Bacteria 6108407
232 2857568044 2857564685 Bacteria 6290584
233 2919477009 2919476304 Bacteria 5888696
234 2932426387 2932422444 Bacteria 4678430
235 8055228943 8055225921 Bacteria 3341787
236 Ga0075364_10007990
237 JGI25154J39366_1001995
238 JGI25152J39213_1000224
239 JGI25150J39212_1003199
240 JGI25150J39212_1011201
241 JGI25159J45721_1011592
242 JGI25159J45721_1021715
243 JGI25153J46596_10004513
244 rootH1_10021305
245 JGI25160J50197_1001176
246 JGI25161J50226_1003233
247 Ga0055529_1000473
248 Ga0055526_1004613
249 Ga0055526_1007594
250 Ga0055537_1000038
251 Ga0055537_1005266
252 Ga0055537_1008757
253 Ga0055524_1001031
254 Ga0055524_1001453
255 Ga0055524_1001929
256 Ga0055534_1000074
257 Ga0055534_1018573
258 Ga0055528_1000231
259 Ga0055528_1004830
260 Ga0055530_10001965
261 Ga0055543_1000924
262 Ga0065165_1002806
263 Ga0065704_10076112
264 Ga0070661_100289250
265 Ga0070671_100089649
266 Ga0070667_100137522
267 Ga0070667_100183998
268 Ga0070698_100436871
269 Ga0068853_100000225
270 Ga0068853_100169525
271 Ga0070665_100013080
272 Ga0068855_100002951
273 Ga0068864_100010250
274 Ga0068864_100061645
275 Ga0068863_100002342
276 Ga0068863_100024593
277 Ga0068858_100098982
278 Ga0068860_100010719
279 Ga0068860_100041214
280 Ga0068862_100011728
281 Ga0068862_100021433
282 Ga0075365_10159647
283 Ga0070712_100015351
284 Ga0075366_10021409
285 Ga0075366_10057150
286 Ga0097621_100184012
287 Ga0068871_100078059
288 Ga0079104_1002320
289 Ga0105242_10051306
290 Ga0105248_10741838
291 Ga0105237_10106640
292 Ga0105249_10915859
293 Ga0105239_10009508
294 Ga0105246_10091884
295 Ga0157370_10237015
296 Ga0157375_10306349
297 Ga0163163_10001631
298 Ga0157379_10001561
299 Ga0157379_10023043
300 Ga0157379_10041091
301 Ga0182006_1000141
302 Ga0182005_1000016
303 Ga0213872_10000006
304 Ga0213872_10000735
305 Ga0213872_10041803
306 Ga0209436_100797
307 Ga0209436_101578
308 Ga0209437_105469
309 Ga0207425_1000021
310 Ga0209646_1000068
311 Ga0209129_1000020
312 Ga0209565_1000123
313 Ga0209565_1003210
314 Ga0209565_1013045
315 Ga0209455_1000563
316 Ga0209673_1000040
317 Ga0209130_1001646
318 Ga0209130_1002777
319 Ga0209130_1011412
320 Ga0209675_1000117
321 Ga0209675_1001690
322 Ga0209675_1029580
323 Ga0209564_1000121
324 Ga0209564_1000780
325 Ga0209564_1001271
326 Ga0209564_1016913
327 Ga0209758_1000077
328 Ga0209050_1000050
329 Ga0209050_1000795
330 Ga0209256_1000288
331 Ga0209256_1000674
332 Ga0209256_1003939
333 Ga0209256_1009037
334 Ga0207426_1001270
335 Ga0209257_1000075
336 Ga0207645_10071023
337 Ga0207671_10081160
338 Ga0207686_10009825
339 Ga0207711_10139801
340 Ga0207667_10015938
341 Ga0207658_10082707
342 Ga0207703_10017115
343 Ga0207639_10000208
344 Ga0207639_10341167
345 Ga0207678_10251319
346 Ga0207641_10007225
347 Ga0207641_10068380
348 Ga0207676_10012702
349 Ga0209281_1005643
350 Ga0268265_10047955
351 Ga0268264_10003897
352 Ga0268264_10067240
353 Ga0265323_10014668
354 Ga0307515_10000257
355 Ga0307515_10076511
356 Ga0307511_10000545
357 Ga0265327_10004733
358 Ga0265327_10085686
359 Ga0265316_10233910
360 Ga0265316_10297660
361 Ga0265316_10383769
362 Ga0307509_10000009
363 Ga0307408_100000029
364 Ga0307408_100000531
365 Ga0307408_100004170
366 Ga0307408_100005814
367 Ga0307408_100188878
368 Ga0316576_10040851
369 Ga0316576_10043502
370 Ga0307406_10016876
371 Ga0307412_10131448
372 Ga0307415_100091947
373 Ga0316580_10001573
374 Ga0307507_10019570
375 Ga0316592_1005089
376 Ga0316588_1003562
377 Ga0316574_0003610
378 Ga0316582_0092282
379 Ga0316584_0080253
380 Ga0436361_0169339
381 Ga0436361_0491913
382 Ga0451793_0783927
383 Ga0453684_0257873
384 Ga0451576_0048065
385 Ga0451576_0096010
386 Ga0451576_0166129
387 Ga0451576_0639036
388 Ga0495617_000245
389 Ga0495590_0000020
390 Ga0495638_0000235
391 Ga0495653_0000067
392 Ga0495653_0173699
393 Ga0495650_0000251
394 Ga0495650_0000485
395 Ga0495650_0039011
396 Ga0495605_0000061
397 Ga0495639_0018559
398 Ga0495585_0002222
399 Ga0495583_0002937
400 Ga0495606_0000262
401 Ga0495606_0010828
402 Ga0495610_0000017
403 Ga0495637_0000179
404 Ga0495648_0000350
405 Ga0495648_0029750
406 Ga0495642_0001394
407 Ga0495654_0000060
408 Ga0495654_0001046
409 Ga0495654_0096322
410 Ga0495597_0002718
411 Ga0495622_0001922
412 Ga0495633_0001353
413 Ga0495633_0003452
414 Ga0495633_0004606
415 Ga0495633_0048680
416 Ga0495668_0002105
417 Ga0495668_0004696
418 Ga0495625_0001192
419 Ga0495625_0007112
420 Ga0495661_0033783
421 Ga0495670_0083614
422 Ga0495671_0000037
423 Ga0495660_0001903
424 Ga0495672_0063954
425 Ga0495683_0057983
426 Ga0495679_017378
427 Ga0495673_0000179
428 Ga0495686_0000988
429 Ga0495686_0001635
430 Ga0496116_0038150
431 Ga0496120_0115497
432 Ga0496123_0008730
433 Ga0496123_0033567
434 Ga0496125_0001189
435 Ga0496126_0001477
436 Ga0496126_0012895
437 Ga0495678_006030
438 Ga0495678_075666
439 Ga0501031_0002015
440 Ga0501043_0033189
441 Ga0501035_0016625
442 Ga0501035_0051512
443 Ga0501044_0000045
444 nmdc:mga00v17_38820_c1
445 nmdc:mga0k408_72762_c1
446 nmdc:mga07m45_54819_c1
447 Ga0500644_0159572
448 Ga0500646_0003914
449 Ga0500562_026696
450 Ga0500569_029503
451 Ga0500618_000139
452 Ga0500655_001368
453 Ga0500586_017316
454 Ga0500604_0005678
455 Ga0500616_0139081
456 Ga0500637_0142898
457 2643792030
458 2643936584
459 2644216488
460 2644317940
461 2738826834
462 2739150631
463 2739192550
464 2739319027
465 2739337268
466 2821135832
467 2857568044
468 2919477009
469 2932426387
470 8055228943

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

88

165

0.94

PF08544

GHMP_kinases_C

GHMP kinases C terminal

243

317

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.9223 3 284
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.916 3 284
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8541 8 274
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8334 8 274
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.7994 3 275
ID Description Score Start End Superfamily
2ww4A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9229 158 284 3.30.70.890
1oj4B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9218 4 157 3.30.230.10
2ww4A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9155 158 284 3.30.70.890
1oj4B01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8884 4 157 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8442 1 156 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7V8CUH5-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9847 1 284 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A7V8CUH5-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9813 1 284 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A4Q3MJ56-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) 0.9784 112 282 GO:0050515
AF-A0A7C0VUX1-F1-model_v4 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) 0.9704 105 283 GO:0005524
GO:0016114
GO:0050515
AF-A7C1K6-F1-model_v4 deleted 0.9684 119 283

Map