F348179

General Info

Members Datasets Scaffolds Average Seq Length
235 193 196 324

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10056452|Ga0213876_100564522
Length 357
Sequence MTPFQYRRAADAGDAVRLASGLQGAQFIAGGTSQVDLMKEGVQRPSALVEILRIGLDEITETAAGGLSIGANVRNSTASDDCVVRERYTAIAEALHAGASQQIRNMATMAGNLLQRTRCPYLRDPVQPCNKRDPGSGCAAVRGFNRLHAIFGQTDEGPDSPHTCIAVHPSDMAVAMAAFEAVIVVRGRDGERRIAFEELHRLPGEDPSRDTNLQPDDLIVAMELPHFRGASHYLKVRDRASYAYALVSCATTLEMDGGRIAKARIALGSVAHKPWRLLRAEAMLEGERPSEELFRRAAAVGLEGVRTYSMNAYKPVLARALVARGLAETTGLSPRQGPAGTAFAASVGGIAGVRAGA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
3 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
4 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
7 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
8 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
9 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
10 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
11 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
12 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
13 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
16 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
17 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
18 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
19 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
20 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
21 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
25 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
26 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
27 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
28 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
29 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
30 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
31 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
32 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
33 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
190 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
191 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
192 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
193 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.4
Metatranscriptomes 0
Isolates 16.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 4.68
Rhizoplane 4.68
Rhizosphere 61.7
Stem 0
Stem Tuber 0
Unclassified 17.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000759 3300002075 Bacteria 9234
2 Ga0055540_1001949 3300003792 Bacteria 11539
3 Ga0055540_1002666 3300003792 Bacteria 9221
4 Ga0055540_1015818 3300003792 Bacteria 2176
5 Ga0065165_1000035 3300005262 Bacteria 214086
6 Ga0065712_10075433 3300005290 Bacteria 3864
7 Ga0070683_100001640 3300005329 Bacteria 17318
8 Ga0070670_100000354 3300005331 Bacteria 38502
9 Ga0070677_10006284 3300005333 Bacteria 3940
10 Ga0070661_100009561 3300005344 Bacteria 6716
11 Ga0070675_100003514 3300005354 Bacteria 11882
12 Ga0070671_100001638 3300005355 Bacteria 16912
13 Ga0070673_100006007 3300005364 Bacteria 7858
14 Ga0070667_100000059 3300005367 Bacteria 147078
15 Ga0070713_100000271 3300005436 Bacteria 34038
16 Ga0070711_100219289 3300005439 Bacteria 1478
17 Ga0070678_100000010 3300005456 Bacteria 58577
18 Ga0070662_100073643 3300005457 Bacteria 2524
19 Ga0068867_100023090 3300005459 Bacteria 4452
20 Ga0070684_100013765 3300005535 Bacteria 6529
21 Ga0070672_100000815 3300005543 Bacteria 18627
22 Ga0070665_100473545 3300005548 Bacteria 1263
23 Ga0070664_100000179 3300005564 Bacteria 44681
24 Ga0068854_100001230 3300005578 Bacteria 15351
25 Ga0068856_100009761 3300005614 Bacteria 9327
26 Ga0070702_100016130 3300005615 Bacteria 3827
27 Ga0068852_100000347 3300005616 Bacteria 31132
28 Ga0068859_100023913 3300005617 Bacteria 6131
29 Ga0068864_100021000 3300005618 Bacteria 5468
30 Ga0068864_100362928 3300005618 Bacteria 1369
31 Ga0068851_10014158 3300005834 Bacteria 3784
32 Ga0068870_10043367 3300005840 Bacteria 2346
33 Ga0068858_100081982 3300005842 Bacteria 2998
34 Ga0068860_100000048 3300005843 Bacteria 209375
35 Ga0081455_10000278 3300005937 Bacteria 67808
36 Ga0081539_10000493 3300005985 Bacteria 83122
37 Ga0075365_10022615 3300006038 Bacteria 3943
38 Ga0075363_100018801 3300006048 Bacteria 3446
39 Ga0075363_100033069 3300006048 Bacteria 2691
40 Ga0075364_10008320 3300006051 Bacteria 6193
41 Ga0075364_10015670 3300006051 Bacteria 4705
42 Ga0075369_10002450 3300006186 Bacteria 6621
43 Ga0075369_10064631 3300006186 Bacteria 1602
44 Ga0097621_100000056 3300006237 Bacteria 59138
45 Ga0075370_10014331 3300006353 Bacteria 4227
46 Ga0075370_10127393 3300006353 Bacteria 1484
47 Ga0068871_100000488 3300006358 Bacteria 27109
48 Ga0075430_100144667 3300006846 Bacteria 1980
49 Ga0068865_100059209 3300006881 Bacteria 2678
50 Ga0097620_100023913 3300006931 Bacteria 6131
51 Ga0079104_1003059 3300006946 Bacteria 8178
52 Ga0105244_10002242 3300009036 Bacteria 14721
53 Ga0105243_10000203 3300009148 Bacteria 69484
54 Ga0105242_10420599 3300009176 Bacteria 1252
55 Ga0105248_10000098 3300009177 Bacteria 96532
56 Ga0105248_10227681 3300009177 Bacteria 2099
57 Ga0105237_10245677 3300009545 Bacteria 1791
58 Ga0105246_10000088 3300011119 Bacteria 39136
59 Ga0157374_10000816 3300013296 Bacteria 27323
60 Ga0157375_10000608 3300013308 Bacteria 31811
61 Ga0182008_10005495 3300014497 Bacteria 7213
62 Ga0157376_10027868 3300014969 Bacteria 4483
63 Ga0182006_1000512 3300015261 Bacteria 29558
64 Ga0182005_1001455 3300015265 Bacteria 9536
65 Ga0214542_1018842 3300021321 Bacteria 5674
66 Ga0213872_10000217 3300021361 Bacteria 50746
67 Ga0213872_10022850 3300021361 Bacteria 2877
68 Ga0213876_10056452 3300021384 Bacteria 2073
69 Ga0213876_10089872 3300021384 Bacteria 1626
70 Ga0213875_10009560 3300021388 Bacteria 4906
71 Ga0228711_1024785 3300022739 Bacteria 4169
72 Ga0209674_100357 3300025226 Bacteria 25905
73 Ga0209565_1001827 3300025263 Bacteria 8550
74 Ga0209051_1000485 3300025303 Bacteria 51308
75 Ga0209051_1000595 3300025303 Bacteria 42760
76 Ga0209051_1007095 3300025303 Bacteria 6192
77 Ga0207655_1002275 3300025728 Bacteria 15824
78 Ga0207680_10037451 3300025903 Bacteria 2800
79 Ga0207649_10008716 3300025920 Bacteria 5538
80 Ga0207650_10018458 3300025925 Bacteria 4895
81 Ga0207659_10001573 3300025926 Bacteria 13545
82 Ga0207664_10293465 3300025929 Bacteria 1429
83 Ga0207644_10001572 3300025931 Bacteria 14755
84 Ga0207709_10000011 3300025935 Bacteria 552881
85 Ga0207711_10002636 3300025941 Bacteria 15877
86 Ga0207661_10004827 3300025944 Bacteria 9444
87 Ga0207679_10004741 3300025945 Bacteria 8466
88 Ga0207651_10000114 3300025960 Bacteria 34868
89 Ga0207640_10001484 3300025981 Bacteria 12651
90 Ga0207658_10000228 3300025986 Bacteria 58995
91 Ga0207648_10020036 3300026089 Bacteria 6034
92 Ga0207676_10009544 3300026095 Bacteria 6908
93 Ga0207676_10273681 3300026095 Bacteria 1530
94 Ga0207683_10000810 3300026121 Bacteria 28613
95 Ga0207698_10005070 3300026142 Bacteria 8084
96 Ga0209281_1000188 3300027111 Bacteria 141823
97 Ga0268266_10171816 3300028379 Bacteria 1968
98 Ga0268264_10000005 3300028381 Bacteria 934972
99 Ga0265337_1009759 3300028556 Bacteria 3407
100 Ga0265338_10007869 3300028800 Bacteria 13090
101 Ga0307513_10040791 3300031456 Bacteria 5130
102 Ga0307513_10046758 3300031456 Bacteria 4714
103 Ga0307405_10060714 3300031731 Bacteria 2387
104 Ga0307405_10080166 3300031731 Bacteria 2131
105 Ga0307405_10262212 3300031731 Bacteria 1291
106 Ga0307413_10050866 3300031824 Bacteria 2493
107 Ga0307413_10054693 3300031824 Bacteria 2424
108 Ga0307412_10001482 3300031911 Bacteria 13051
109 Ga0307412_10052457 3300031911 Bacteria 2701
110 Ga0307416_100187634 3300032002 Bacteria 1946
111 Ga0373923_0018021 3300035111 Bacteria 2710
112 Ga0373946_0024702 3300035171 Bacteria 2358
113 Ga0373937_0038158 3300036401 Bacteria 4378
114 Ga0395900_0067949 3300037418 Bacteria 3662
115 Ga0395898_0116248 3300037466 Bacteria 2563
116 Ga0395905_0000594 3300037471 Bacteria 48383
117 Ga0395905_0001008 3300037471 Bacteria 35984
118 Ga0395905_0017458 3300037471 Bacteria 6813
119 Ga0395905_0224367 3300037471 Bacteria 1758
120 Ga0436364_0020672 3300037853 Bacteria 1291
121 Ga0436364_0618299 3300037853 Bacteria 1596
122 Ga0436364_0662482 3300037853 Bacteria 3927
123 Ga0436364_0868957 3300037853 Bacteria 10426
124 Ga0436364_1328598 3300037853 Bacteria 2599
125 Ga0436364_1526685 3300037853 Bacteria 1739
126 Ga0436365_0101992 3300039437 Bacteria 8961
127 Ga0436365_1678077 3300039437 Bacteria 2082
128 Ga0436360_0883853 3300039438 Bacteria 16325
129 Ga0436361_0238361 3300039447 Bacteria 15794
130 Ga0436361_0616410 3300039447 Bacteria 7091
131 Ga0436361_0931365 3300039447 Bacteria 36892
132 Ga0439436_0000046 3300041404 Bacteria 36987
133 Ga0439461_0003029 3300041410 Bacteria 2738
134 Ga0439466_0000135 3300041411 Bacteria 29163
135 Ga0439466_0000541 3300041411 Bacteria 14286
136 Ga0439465_0000157 3300041413 Bacteria 16967
137 Ga0439465_0002418 3300041413 Bacteria 6115
138 Ga0439465_0004589 3300041413 Bacteria 4460
139 Ga0439431_0009152 3300041997 Bacteria 2233
140 Ga0439445_0003991 3300042004 Bacteria 3330
141 Ga0450908_000067 3300042184 Bacteria 20606
142 Ga0466969_0052451 3300044656 Bacteria 2004
143 Ga0466982_0000088 3300044672 Bacteria 23126
144 Ga0466965_0004778 3300044683 Bacteria 6040
145 Ga0466965_0070376 3300044683 Bacteria 1758
146 Ga0466965_0094676 3300044683 Bacteria 1522
147 Ga0466966_0043065 3300044684 Bacteria 2895
148 Ga0466961_0022941 3300044693 Bacteria 4015
149 Ga0466961_0059914 3300044693 Bacteria 2421
150 Ga0453684_0240703 3300044712 Bacteria 2083
151 Ga0466970_0006952 3300044765 Bacteria 5666
152 Ga0466970_0274220 3300044765 Bacteria 948
153 Ga0466960_0001619 3300044901 Bacteria 8233
154 Ga0466959_0050436 3300045049 Bacteria 3055
155 Ga0466967_0553067 3300045976 Bacteria 1133
156 Ga0495590_0004386 3300046457 Bacteria 5701
157 Ga0495606_0000104 3300046507 Bacteria 143973
158 Ga0495588_0010647 3300046674 Bacteria 4286
159 Ga0495670_0000998 3300046691 Bacteria 13756
160 Ga0495649_0008472 3300046694 Bacteria 6187
161 Ga0496100_0097293 3300048903 Bacteria 2021
162 Ga0496102_0000167 3300048905 Bacteria 88562
163 Ga0496103_0000756 3300048906 Bacteria 23844
164 Ga0496104_0294387 3300048907 Bacteria 1536
165 Ga0496108_0002535 3300048911 Bacteria 14619
166 Ga0496109_0002343 3300048912 Bacteria 15800
167 Ga0496110_0000037 3300048913 Bacteria 64495
168 Ga0496111_0190833 3300048914 Bacteria 1523
169 Ga0496112_0520531 3300048915 Bacteria 1124
170 Ga0496113_0127776 3300048916 Bacteria 1992
171 Ga0496114_0203535 3300048917 Bacteria 1734
172 Ga0496116_0013479 3300048919 Bacteria 6587
173 Ga0496117_0000447 3300048920 Bacteria 68541
174 Ga0496118_0000286 3300048921 Bacteria 88166
175 Ga0496119_0012559 3300048922 Bacteria 6863
176 Ga0496119_0017635 3300048922 Bacteria 5362
177 Ga0496121_0024636 3300048924 Bacteria 5746
178 Ga0496124_0003542 3300048927 Bacteria 18989
179 Ga0496124_0004325 3300048927 Bacteria 16651
180 Ga0496125_0001004 3300048928 Bacteria 43910
181 Ga0496126_0001691 3300048929 Bacteria 32861
182 Ga0501047_0510504 3300049581 Bacteria 1028
183 Ga0501070_0008085 3300049586 Bacteria 8904
184 Ga0501073_0134368 3300049589 Bacteria 1714
185 Ga0501080_0062908 3300049742 Bacteria 3454
186 Ga0501279_000339 3300049775 Bacteria 6238
187 nmdc:mga03n38_2778_c1 3300050490 Bacteria 5497
188 nmdc:mga00v17_133336_c1 3300050491 Bacteria 1589
189 nmdc:mga00v17_71077_c1 3300050491 Bacteria 2157
190 nmdc:mga06z11_136342_c1 3300050494 Bacteria 1383
191 nmdc:mga07m45_16321_c1 3300050496 Bacteria 3975
192 nmdc:mga07m45_9051_c2 3300050496 Bacteria 4220
193 nmdc:mga0sz30_31233_c1 3300050516 Bacteria 2203
194 nmdc:mga0sz30_478_c1 3300050516 Bacteria 15095
195 Ga0495601_0143010 3300053077 Bacteria 1561
196 Ga0500616_0008421 3300053153 Bacteria 6406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0274220 Ga0466970_0274220_13_888 280
2 3300048928 Ga0496125_0001004 Ga0496125_0001004_11692_12681 281
3 3300046691 Ga0495670_0000998 Ga0495670_0000998_12882_13730 282
4 3300028800 Ga0265338_10007869 Ga0265338_100078697 287
5 3300044712 Ga0453684_0240703 Ga0453684_0240703_935_1882 289
6 3300032002 Ga0307416_100187634 Ga0307416_1001876342 298
7 3300053077 Ga0495601_0143010 Ga0495601_0143010_248_1180 299
8 3300037853 Ga0436364_0618299 Ga0436364_0618299_245_1183 300
9 3300048907 Ga0496104_0294387 Ga0496104_0294387_184_1170 301
10 3300006946 Ga0079104_1003059 Ga0079104_10030594 304
11 3300027111 Ga0209281_1000188 Ga0209281_100018878 304
12 3300037418 Ga0395900_0067949 Ga0395900_0067949_2139_3089 304
13 3300037466 Ga0395898_0116248 Ga0395898_0116248_246_1196 304
14 3300037853 Ga0436364_0662482 Ga0436364_0662482_224_1192 304
15 3300039437 Ga0436365_0101992 Ga0436365_0101992_574_1542 304
16 iso_pu_bacteria 2643221715 2644636124 304
17 3300039438 Ga0436360_0883853 Ga0436360_0883853_15151_16134 308
18 3300039447 Ga0436361_0616410 Ga0436361_0616410_2106_3089 308
19 3300037471 Ga0395905_0001008 Ga0395905_0001008_15794_16777 309
20 iso_pu_bacteria 2902810491 2902817099 309
21 3300028556 Ga0265337_1009759 Ga0265337_10097594 310
22 3300031731 Ga0307405_10262212 Ga0307405_102622122 310
23 3300041413 Ga0439465_0002418 Ga0439465_0002418_3553_4539 310
24 iso_pu_bacteria 2913912277 2913916577 310
25 3300037471 Ga0395905_0017458 Ga0395905_0017458_1899_2849 311
26 3300037471 Ga0395905_0224367 Ga0395905_0224367_258_1208 311
27 iso_pu_bacteria 2617270889 2617918584 311
28 iso_pu_bacteria 2886627955 2886629162 311
29 iso_pu_bacteria 2913844669 2913852199 311
30 iso_pu_bacteria 2913939268 2913946918 311
31 iso_pu_bacteria 642555144 642601396 311
32 3300005439 Ga0070711_100219289 Ga0070711_1002192891 312
33 3300025929 Ga0207664_10293465 Ga0207664_102934652 312
34 3300044656 Ga0466969_0052451 Ga0466969_0052451_82_1053 312
35 iso_pu_bacteria 2585427530 2585555274 312
36 iso_pu_bacteria 2786546132 2786675454 312
37 iso_pu_bacteria 2867346516 2867352473 312
38 iso_pu_bacteria 2929212328 2929215768 312
39 iso_pu_bacteria 2954711539 2954711603 312
40 iso_pu_bacteria 2954740390 2954740430 312
41 iso_pu_bacteria 2954749733 2954759130 312
42 iso_pu_bacteria 2954759201 2954759456 312
43 3300037471 Ga0395905_0000594 Ga0395905_0000594_18316_19281 313
44 3300044901 Ga0466960_0001619 Ga0466960_0001619_3063_4058 313
45 iso_pu_bacteria 2939582691 2939585569 313
46 3300005262 Ga0065165_1000035 Ga0065165_100003548 314
47 3300041411 Ga0439466_0000135 Ga0439466_0000135_11365_12354 314
48 iso_pu_bacteria 2508501122 2509110078 314
49 iso_pu_bacteria 2515154107 2515612568 314
50 iso_pu_bacteria 2537561592 2537899325 314
51 iso_pu_bacteria 2551306166 2552113000 314
52 iso_pu_bacteria 2565956761 2566996423 314
53 iso_pu_bacteria 2791355094 2792640683 314
54 iso_pu_bacteria 2818991462 2819689814 314
55 iso_pu_bacteria 2818991469 2819726633 314
56 iso_pu_bacteria 2834641062 2834645277 314
57 iso_pu_bacteria 2857481737 2857485417 314
58 iso_pu_bacteria 2902810491 2902815639 314
59 iso_pu_bacteria 2922554459 2922557941 314
60 iso_pu_bacteria 2933016740 2933022491 314
61 iso_pu_bacteria 2936996657 2937001952 314
62 iso_pu_bacteria 2970047711 2970053214 314
63 iso_pu_bacteria 8003400568 8003403517 314
64 iso_pu_bacteria 8033684223 8033690670 314
65 iso_pu_bacteria 8054472261 8054474246 314
66 iso_pu_bacteria 8056447290 8056453868 314
67 3300005614 Ga0068856_100009761 Ga0068856_1000097618 315
68 3300031456 Ga0307513_10040791 Ga0307513_100407912 315
69 3300035111 Ga0373923_0018021 Ga0373923_0018021_452_1429 315
70 3300035171 Ga0373946_0024702 Ga0373946_0024702_861_1838 315
71 3300036401 Ga0373937_0038158 Ga0373937_0038158_2615_3592 315
72 iso_pu_bacteria 2842918807 2842921114 315
73 iso_pu_bacteria 2937822353 2937828012 315
74 iso_pu_bacteria 2953994433 2953996390 315
75 3300005436 Ga0070713_100000271 Ga0070713_10000027131 316
76 3300005937 Ga0081455_10000278 Ga0081455_1000027864 316
77 3300006186 Ga0075369_10064631 Ga0075369_100646312 316
78 3300021384 Ga0213876_10056452 Ga0213876_100564522 316
79 3300021384 Ga0213876_10089872 Ga0213876_100898722 316
80 3300025263 Ga0209565_1001827 Ga0209565_10018276 316
81 3300031824 Ga0307413_10050866 Ga0307413_100508662 316
82 3300037853 Ga0436364_0020672 Ga0436364_0020672_28_978 316
83 3300037853 Ga0436364_1328598 Ga0436364_1328598_606_1679 316
84 3300037853 Ga0436364_1526685 Ga0436364_1526685_464_1537 316
85 3300039437 Ga0436365_1678077 Ga0436365_1678077_675_1748 316
86 3300049775 Ga0501279_000339 Ga0501279_000339_765_1751 316
87 3300005548 Ga0070665_100473545 Ga0070665_1004735452 317
88 3300005985 Ga0081539_10000493 Ga0081539_1000049322 317
89 3300006186 Ga0075369_10002450 Ga0075369_100024504 317
90 3300009176 Ga0105242_10420599 Ga0105242_104205992 317
91 3300021361 Ga0213872_10000217 Ga0213872_1000021712 317
92 3300021361 Ga0213872_10022850 Ga0213872_100228503 317
93 3300021388 Ga0213875_10009560 Ga0213875_100095604 317
94 3300028379 Ga0268266_10171816 Ga0268266_101718162 317
95 3300031456 Ga0307513_10046758 Ga0307513_100467585 317
96 3300037853 Ga0436364_0868957 Ga0436364_0868957_6554_7648 317
97 3300039447 Ga0436361_0238361 Ga0436361_0238361_1072_2064 317
98 3300039447 Ga0436361_0931365 Ga0436361_0931365_33280_34272 317
99 3300045976 Ga0466967_0553067 Ga0466967_0553067_61_1062 317
100 3300046507 Ga0495606_0000104 Ga0495606_0000104_25924_26964 317
101 3300048927 Ga0496124_0004325 Ga0496124_0004325_3938_4891 317
102 3300050516 nmdc:mga0sz30_478_c1 nmdc:mga0sz30_478_c1_4399_5382 317
103 3300003792 Ga0055540_1001949 Ga0055540_100194913 318
104 3300003792 Ga0055540_1002666 Ga0055540_10026662 318
105 3300003792 Ga0055540_1015818 Ga0055540_10158182 318
106 3300005290 Ga0065712_10075433 Ga0065712_100754334 318
107 3300005329 Ga0070683_100001640 Ga0070683_10000164012 318
108 3300005331 Ga0070670_100000354 Ga0070670_10000035416 318
109 3300005333 Ga0070677_10006284 Ga0070677_100062842 318
110 3300005344 Ga0070661_100009561 Ga0070661_1000095614 318
111 3300005354 Ga0070675_100003514 Ga0070675_1000035147 318
112 3300005355 Ga0070671_100001638 Ga0070671_10000163814 318
113 3300005364 Ga0070673_100006007 Ga0070673_1000060075 318
114 3300005367 Ga0070667_100000059 Ga0070667_1000000596 318
115 3300005456 Ga0070678_100000010 Ga0070678_1000000104 318
116 3300005457 Ga0070662_100073643 Ga0070662_1000736433 318
117 3300005459 Ga0068867_100023090 Ga0068867_1000230903 318
118 3300005535 Ga0070684_100013765 Ga0070684_1000137653 318
119 3300005543 Ga0070672_100000815 Ga0070672_10000081514 318
120 3300005564 Ga0070664_100000179 Ga0070664_10000017929 318
121 3300005578 Ga0068854_100001230 Ga0068854_10000123014 318
122 3300005615 Ga0070702_100016130 Ga0070702_1000161303 318
123 3300005616 Ga0068852_100000347 Ga0068852_10000034710 318
124 3300005617 Ga0068859_100023913 Ga0068859_1000239137 318
125 3300005618 Ga0068864_100021000 Ga0068864_1000210004 318
126 3300005618 Ga0068864_100362928 Ga0068864_1003629282 318
127 3300005834 Ga0068851_10014158 Ga0068851_100141582 318
128 3300005840 Ga0068870_10043367 Ga0068870_100433672 318
129 3300005842 Ga0068858_100081982 Ga0068858_1000819822 318
130 3300005843 Ga0068860_100000048 Ga0068860_1000000486 318
131 3300006038 Ga0075365_10022615 Ga0075365_100226155 318
132 3300006048 Ga0075363_100018801 Ga0075363_1000188012 318
133 3300006048 Ga0075363_100033069 Ga0075363_1000330692 318
134 3300006051 Ga0075364_10008320 Ga0075364_100083204 318
135 3300006051 Ga0075364_10015670 Ga0075364_100156702 318
136 3300006237 Ga0097621_100000056 Ga0097621_10000005612 318
137 3300006353 Ga0075370_10014331 Ga0075370_100143314 318
138 3300006353 Ga0075370_10127393 Ga0075370_101273932 318
139 3300006358 Ga0068871_100000488 Ga0068871_10000048819 318
140 3300006846 Ga0075430_100144667 Ga0075430_1001446672 318
141 3300006881 Ga0068865_100059209 Ga0068865_1000592093 318
142 3300006931 Ga0097620_100023913 Ga0097620_1000239137 318
143 3300009036 Ga0105244_10002242 Ga0105244_1000224211 318
144 3300009148 Ga0105243_10000203 Ga0105243_1000020312 318
145 3300009177 Ga0105248_10000098 Ga0105248_100000982 318
146 3300009177 Ga0105248_10227681 Ga0105248_102276812 318
147 3300011119 Ga0105246_10000088 Ga0105246_1000008811 318
148 3300013296 Ga0157374_10000816 Ga0157374_1000081620 318
149 3300013308 Ga0157375_10000608 Ga0157375_100006085 318
150 3300014969 Ga0157376_10027868 Ga0157376_100278685 318
151 3300021321 Ga0214542_1018842 Ga0214542_10188424 318
152 3300022739 Ga0228711_1024785 Ga0228711_10247852 318
153 3300025303 Ga0209051_1000485 Ga0209051_10004858 318
154 3300025303 Ga0209051_1000595 Ga0209051_100059527 318
155 3300025303 Ga0209051_1007095 Ga0209051_10070952 318
156 3300025728 Ga0207655_1002275 Ga0207655_100227511 318
157 3300025903 Ga0207680_10037451 Ga0207680_100374512 318
158 3300025920 Ga0207649_10008716 Ga0207649_100087164 318
159 3300025925 Ga0207650_10018458 Ga0207650_100184583 318
160 3300025926 Ga0207659_10001573 Ga0207659_100015739 318
161 3300025931 Ga0207644_10001572 Ga0207644_100015724 318
162 3300025935 Ga0207709_10000011 Ga0207709_10000011178 318
163 3300025941 Ga0207711_10002636 Ga0207711_1000263614 318
164 3300025944 Ga0207661_10004827 Ga0207661_100048273 318
165 3300025945 Ga0207679_10004741 Ga0207679_100047412 318
166 3300025960 Ga0207651_10000114 Ga0207651_1000011424 318
167 3300025981 Ga0207640_10001484 Ga0207640_1000148411 318
168 3300025986 Ga0207658_10000228 Ga0207658_100002286 318
169 3300026089 Ga0207648_10020036 Ga0207648_100200364 318
170 3300026095 Ga0207676_10009544 Ga0207676_100095445 318
171 3300026095 Ga0207676_10273681 Ga0207676_102736812 318
172 3300026121 Ga0207683_10000810 Ga0207683_1000081011 318
173 3300026142 Ga0207698_10005070 Ga0207698_100050702 318
174 3300028381 Ga0268264_10000005 Ga0268264_100000056 318
175 3300031731 Ga0307405_10060714 Ga0307405_100607142 318
176 3300031731 Ga0307405_10080166 Ga0307405_100801663 318
177 3300031824 Ga0307413_10054693 Ga0307413_100546933 318
178 3300031911 Ga0307412_10052457 Ga0307412_100524572 318
179 3300041410 Ga0439461_0003029 Ga0439461_0003029_1239_2231 318
180 3300041411 Ga0439466_0000541 Ga0439466_0000541_11405_12397 318
181 3300041413 Ga0439465_0004589 Ga0439465_0004589_1221_2213 318
182 3300041997 Ga0439431_0009152 Ga0439431_0009152_1000_1992 318
183 3300042004 Ga0439445_0003991 Ga0439445_0003991_226_1218 318
184 3300044683 Ga0466965_0004778 Ga0466965_0004778_903_1898 318
185 3300044683 Ga0466965_0070376 Ga0466965_0070376_391_1389 318
186 3300044683 Ga0466965_0094676 Ga0466965_0094676_148_1158 318
187 3300044684 Ga0466966_0043065 Ga0466966_0043065_1367_2359 318
188 3300044693 Ga0466961_0022941 Ga0466961_0022941_1179_2189 318
189 3300044693 Ga0466961_0059914 Ga0466961_0059914_26_1018 318
190 3300044765 Ga0466970_0006952 Ga0466970_0006952_2434_3444 318
191 3300045049 Ga0466959_0050436 Ga0466959_0050436_2024_3016 318
192 3300046674 Ga0495588_0010647 Ga0495588_0010647_1303_2295 318
193 3300048903 Ga0496100_0097293 Ga0496100_0097293_1014_1970 318
194 3300048905 Ga0496102_0000167 Ga0496102_0000167_81169_82158 318
195 3300048906 Ga0496103_0000756 Ga0496103_0000756_20256_21245 318
196 3300048911 Ga0496108_0002535 Ga0496108_0002535_4852_5808 318
197 3300048912 Ga0496109_0002343 Ga0496109_0002343_12768_13724 318
198 3300048913 Ga0496110_0000037 Ga0496110_0000037_3583_4539 318
199 3300048914 Ga0496111_0190833 Ga0496111_0190833_187_1143 318
200 3300048915 Ga0496112_0520531 Ga0496112_0520531_49_1038 318
201 3300048916 Ga0496113_0127776 Ga0496113_0127776_420_1376 318
202 3300048917 Ga0496114_0203535 Ga0496114_0203535_495_1451 318
203 3300048919 Ga0496116_0013479 Ga0496116_0013479_5185_6174 318
204 3300048920 Ga0496117_0000447 Ga0496117_0000447_6405_7394 318
205 3300048921 Ga0496118_0000286 Ga0496118_0000286_6379_7368 318
206 3300048922 Ga0496119_0017635 Ga0496119_0017635_4108_5097 318
207 3300048924 Ga0496121_0024636 Ga0496121_0024636_2084_3073 318
208 3300048927 Ga0496124_0003542 Ga0496124_0003542_3296_4285 318
209 3300048929 Ga0496126_0001691 Ga0496126_0001691_25629_26618 318
210 3300049581 Ga0501047_0510504 Ga0501047_0510504_26_1015 318
211 3300049586 Ga0501070_0008085 Ga0501070_0008085_1095_2087 318
212 3300049589 Ga0501073_0134368 Ga0501073_0134368_143_1135 318
213 3300049742 Ga0501080_0062908 Ga0501080_0062908_602_1594 318
214 3300050490 nmdc:mga03n38_2778_c1 nmdc:mga03n38_2778_c1_3377_4369 318
215 3300050491 nmdc:mga00v17_133336_c1 nmdc:mga00v17_133336_c1_386_1378 318
216 3300050491 nmdc:mga00v17_71077_c1 nmdc:mga00v17_71077_c1_289_1278 318
217 3300050494 nmdc:mga06z11_136342_c1 nmdc:mga06z11_136342_c1_131_1120 318
218 3300050496 nmdc:mga07m45_16321_c1 nmdc:mga07m45_16321_c1_1335_2324 318
219 3300050496 nmdc:mga07m45_9051_c2 nmdc:mga07m45_9051_c2_1898_2890 318
220 3300050516 nmdc:mga0sz30_31233_c1 nmdc:mga0sz30_31233_c1_1082_2074 318
221 3300053153 Ga0500616_0008421 Ga0500616_0008421_3831_4823 318
222 3300002075 JGI24738J21930_10000759 JGI24738J21930_100007599 319
223 3300009545 Ga0105237_10245677 Ga0105237_102456772 319
224 3300014497 Ga0182008_10005495 Ga0182008_100054956 319
225 3300015261 Ga0182006_1000512 Ga0182006_100051218 319
226 3300015265 Ga0182005_1001455 Ga0182005_10014552 319
227 3300025226 Ga0209674_100357 Ga0209674_1003577 319
228 3300031911 Ga0307412_10001482 Ga0307412_100014827 319
229 3300041404 Ga0439436_0000046 Ga0439436_0000046_26393_27352 319
230 3300041413 Ga0439465_0000157 Ga0439465_0000157_7399_8358 319
231 3300042184 Ga0450908_000067 Ga0450908_000067_696_1655 319
232 3300044672 Ga0466982_0000088 Ga0466982_0000088_20002_20961 319
233 3300046457 Ga0495590_0004386 Ga0495590_0004386_1687_2661 319
234 3300046694 Ga0495649_0008472 Ga0495649_0008472_1831_2790 319
235 3300048922 Ga0496119_0012559 Ga0496119_0012559_5663_6622 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

227

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

232

329

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9892 1 315
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.983 1 315
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9337 1 316
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9224 1 316
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.845 4 317
ID Description Score Start End Superfamily
5g5hB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9766 223 315 3.30.390.50
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9642 1 53 3.30.43.10
5g5hB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9564 223 315 3.30.390.50
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9467 1 53 3.30.43.10
4zohB01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.917 4 51 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A3A5JKA5-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9995 76 205 GO:0016491
GO:0050660
AF-F3FVU5-F1-model_v4 Molybdopterin dehydrogenase, FAD-binding:CO dehydrogenase 0.9987 70 172 GO:0016491
GO:0050660
AF-A0A531K3U3-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9985 89 216 GO:0016491
GO:0050660
AF-A0A526YID4-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9983 36 186 GO:0016491
GO:0071949
AF-A0A2A2M394-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9982 38 210 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
95.02 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map