F348233

General Info

Members Datasets Scaffolds Average Seq Length
235 142 471 371

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10235153|Ga0207702_102351531
Length 420
Sequence LVSFINARGDARWYVTVFGARFTMGNALCEAGDCHLNIHNDYYFSTMITALHNLRLITDGSIRPGKVILITDXXIIAISEESSIPENVTKIDLKGAYVAPGLLDLQIYGSGGKLFAGTPVVEALERMENDLLAQGTTGFFATIGTNTPAIFEQGIAAAKAYRKYAKGNFLGMHFEGPYLNPAKRGAHPANLIKKGTLDEVKRWVDSAEGEIKMMTIAPELQDQEVIAYLHANGVILSSGHSNASYDEGKAFLNKPIPAVTHLFNAMPQMHHREPGYIPAIFEERPYTSVVADGIHVDFAMIRLAKRELGDKLFLITDAVTAVTEGTYQHQFTGDRYVMPDGTLSGSCLSMLKAAQNCVEKVGIDLAEAINMASLYPAQLAKMPHKGRVAVGCDADLIVFNDAFEVLGTVFKGEQNMNFTN

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
135 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
136 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
137 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
138 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
139 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
140 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
141 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
142 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0.85
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 0.43
Rhizosphere 86.38
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10235153 3300026078 Bacteria 1714
2 JGI24736J21556_1004104 3300001904 Bacteria 2502
3 JGI24739J22299_10039162 3300001989 Bacteria 1589
4 JGI24739J22299_10051735 3300001989 Bacteria 1324
5 JGI24735J21928_10000003 3300002067 Bacteria 385983
6 JGI25162J39368_1000301 3300002737 Bacteria 45433
7 JGI25162J39368_1002474 3300002737 Bacteria 7135
8 JGI25165J46597_1000456 3300003214 Bacteria 41124
9 rootH1_10021888 3300003316 Bacteria 3968
10 rootH1_10036994 3300003316 Bacteria 7881
11 rootH2_10002709 3300003320 Bacteria 20537
12 rootH2_10089059 3300003320 Bacteria 6955
13 rootL2_10054152 3300003322 Bacteria 3544
14 rootH1_10000975 3300003316 Bacteria 12698
15 rootH1_10000975 3300003323 Bacteria 22074
16 rootH1_10123672 3300003323 Bacteria 1465
17 Ga0058863_10081386 3300004799 Bacteria 5279
18 Ga0058862_12459938 3300004803 Bacteria 1831
19 Ga0065714_10070953 3300005288 Bacteria 3712
20 Ga0065714_10082520 3300005288 Bacteria 2288
21 Ga0070658_10000008 3300005327 Bacteria 319912
22 Ga0070666_10000128 3300005335 Bacteria 53252
23 Ga0068868_100082508 3300005338 Unclassified 2578
24 Ga0068868_100314124 3300005338 Bacteria 1334
25 Ga0070671_100040160 3300005355 Bacteria 3886
26 Ga0070671_100220374 3300005355 Bacteria 1609
27 Ga0070673_100120328 3300005364 Bacteria 2189
28 Ga0070659_100016670 3300005366 Bacteria 5518
29 Ga0070667_100018783 3300005367 Bacteria 5733
30 Ga0070663_100012729 3300005455 Bacteria 5333
31 Ga0070662_100001291 3300005457 Bacteria 15376
32 Ga0070681_10034790 3300005458 Bacteria 5059
33 Ga0068867_100000904 3300005459 Bacteria 20133
34 Ga0070679_100010335 3300005530 Bacteria 8849
35 Ga0070679_100036706 3300005530 Bacteria 4864
36 Ga0070679_100292819 3300005530 Bacteria 1579
37 Ga0070684_100092576 3300005535 Bacteria 2690
38 Ga0068855_100000177 3300005563 Bacteria 82003
39 Ga0068855_100009928 3300005563 Bacteria 11481
40 Ga0068855_100014897 3300005563 Bacteria 9366
41 Ga0068855_100271428 3300005563 Bacteria 1886
42 Ga0068856_100003383 3300005614 Bacteria 16151
43 Ga0068856_100009146 3300005614 Bacteria 9630
44 Ga0068856_100084195 3300005614 Bacteria 3159
45 Ga0068856_100208732 3300005614 Bacteria 1968
46 Ga0068859_100000018 3300005617 Bacteria 248813
47 Ga0068851_10078701 3300005834 Unclassified 1718
48 Ga0068863_100079483 3300005841 Bacteria 3106
49 Ga0068858_100091320 3300005842 Bacteria 2834
50 Ga0068858_100186858 3300005842 Bacteria 1957
51 Ga0068860_100003505 3300005843 Bacteria 16152
52 Ga0068860_100012749 3300005843 Bacteria 8264
53 Ga0075366_10000660 3300006195 Bacteria 16235
54 Ga0075366_10010515 3300006195 Bacteria 5196
55 Ga0097621_100000174 3300006237 Bacteria 40714
56 Ga0097621_100103601 3300006237 Bacteria 2397
57 Ga0068871_100000060 3300006358 Bacteria 59245
58 Ga0097620_100000018 3300006931 Bacteria 248813
59 Ga0105240_10002497 3300009093 Bacteria 29564
60 Ga0105240_10116264 3300009093 Bacteria 3227
61 Ga0105240_10119427 3300009093 Bacteria 3175
62 Ga0105240_10262791 3300009093 Bacteria 1990
63 Ga0105247_10024254 3300009101 Bacteria 3654
64 Ga0105243_10111282 3300009148 Bacteria 2292
65 Ga0105241_10000510 3300009174 Bacteria 29254
66 Ga0105241_10005050 3300009174 Bacteria 9738
67 Ga0105241_10007345 3300009174 Bacteria 8104
68 Ga0105241_10028919 3300009174 Bacteria 4130
69 Ga0105242_10115429 3300009176 Bacteria 2295
70 Ga0105237_10001030 3300009545 Bacteria 37560
71 Ga0105237_10006927 3300009545 Bacteria 12496
72 Ga0105237_10008634 3300009545 Bacteria 11015
73 Ga0105237_10293962 3300009545 Bacteria 1627
74 Ga0105237_10347209 3300009545 Bacteria 1488
75 Ga0105238_10041236 3300009551 Bacteria 4676
76 Ga0105238_10076789 3300009551 Bacteria 3332
77 Ga0105249_10005809 3300009553 Bacteria 10672
78 Ga0105239_10000865 3300010375 Bacteria 43041
79 Ga0105239_10002625 3300010375 Bacteria 22737
80 Ga0105239_10004217 3300010375 Bacteria 17268
81 Ga0105239_10015371 3300010375 Bacteria 8479
82 Ga0105239_10019481 3300010375 Bacteria 7490
83 Ga0105239_10020300 3300010375 Bacteria 7329
84 Ga0105239_10116120 3300010375 Bacteria 2970
85 Ga0105246_10014766 3300011119 Bacteria 4918
86 Ga0157373_10000034 3300013100 Bacteria 124053
87 Ga0157373_10014428 3300013100 Bacteria 5791
88 Ga0157371_10000107 3300013102 Bacteria 126477
89 Ga0157371_10038757 3300013102 Bacteria 3409
90 Ga0157371_10082843 3300013102 Bacteria 2271
91 Ga0157370_10023850 3300013104 Bacteria 6068
92 Ga0157369_10001235 3300013105 Bacteria 31847
93 Ga0157369_10141939 3300013105 Bacteria 2541
94 Ga0157369_10508876 3300013105 Bacteria 1246
95 Ga0157369_10508877 3300013105 Bacteria 1246
96 Ga0157374_10000948 3300013296 Bacteria 25182
97 Ga0157374_10009410 3300013296 Bacteria 8386
98 Ga0157378_10151015 3300013297 Bacteria 2164
99 Ga0157378_10499940 3300013297 Unclassified 1214
100 Ga0163162_10000599 3300013306 Bacteria 33336
101 Ga0163162_10028147 3300013306 Bacteria 5559
102 Ga0163162_10063712 3300013306 Bacteria 3730
103 Ga0157372_10000041 3300013307 Bacteria 158494
104 Ga0157372_10012894 3300013307 Bacteria 8911
105 Ga0157372_10047377 3300013307 Bacteria 4776
106 Ga0157372_10065631 3300013307 Bacteria 4076
107 Ga0157372_10112528 3300013307 Bacteria 3119
108 Ga0157372_10225648 3300013307 Bacteria 2172
109 Ga0157372_10482760 3300013307 Bacteria 1445
110 Ga0157375_10037010 3300013308 Bacteria 4672
111 Ga0163163_10193118 3300014325 Bacteria 2084
112 Ga0157379_10082932 3300014968 Bacteria 2873
113 Ga0157379_10106889 3300014968 Unclassified 2512
114 Ga0209563_104608 3300025230 Bacteria 2611
115 Ga0207427_100083 3300025231 Bacteria 142745
116 Ga0209437_100021 3300025233 Bacteria 646400
117 Ga0209437_100030 3300025233 Bacteria 532466
118 Ga0209233_1000035 3300025261 Bacteria 568478
119 Ga0209233_1001001 3300025261 Bacteria 12075
120 Ga0209233_1022411 3300025261 Bacteria 1617
121 Ga0207656_10041284 3300025321 Unclassified 1960
122 Ga0207680_10000212 3300025903 Bacteria 27928
123 Ga0207647_10000231 3300025904 Bacteria 46261
124 Ga0207647_10000529 3300025904 Bacteria 30445
125 Ga0207645_10000347 3300025907 Bacteria 38694
126 Ga0207705_10000026 3300025909 Bacteria 256051
127 Ga0207654_10003074 3300025911 Bacteria 8455
128 Ga0207654_10012878 3300025911 Bacteria 4291
129 Ga0207654_10013537 3300025911 Bacteria 4197
130 Ga0207654_10015040 3300025911 Bacteria 4008
131 Ga0207695_10000179 3300025913 Bacteria 185564
132 Ga0207695_10012733 3300025913 Bacteria 10071
133 Ga0207695_10042583 3300025913 Bacteria 4848
134 Ga0207671_10000769 3300025914 Bacteria 40631
135 Ga0207671_10000815 3300025914 Bacteria 39441
136 Ga0207671_10001806 3300025914 Bacteria 23915
137 Ga0207671_10009106 3300025914 Bacteria 8341
138 Ga0207671_10184345 3300025914 Bacteria 1625
139 Ga0207657_10015841 3300025919 Bacteria 7284
140 Ga0207652_10019343 3300025921 Bacteria 5600
141 Ga0207694_10018515 3300025924 Bacteria 5262
142 Ga0207694_10042194 3300025924 Bacteria 3518
143 Ga0207687_10166223 3300025927 Bacteria 1697
144 Ga0207644_10083634 3300025931 Bacteria 2364
145 Ga0207644_10184985 3300025931 Bacteria 1635
146 Ga0207690_10031179 3300025932 Bacteria 3409
147 Ga0207706_10000406 3300025933 Bacteria 46320
148 Ga0207686_10017163 3300025934 Bacteria 4075
149 Ga0207704_10000307 3300025938 Bacteria 22913
150 Ga0207691_10036786 3300025940 Bacteria 4535
151 Ga0207689_10000602 3300025942 Bacteria 34433
152 Ga0207661_10163604 3300025944 Bacteria 1932
153 Ga0207667_10000070 3300025949 Bacteria 180479
154 Ga0207667_10002580 3300025949 Bacteria 22502
155 Ga0207667_10168447 3300025949 Bacteria 2252
156 Ga0207667_10245267 3300025949 Bacteria 1833
157 Ga0207712_10035720 3300025961 Bacteria 3379
158 Ga0207658_10036238 3300025986 Unclassified 3536
159 Ga0207658_10041991 3300025986 Bacteria 3315
160 Ga0207677_10006592 3300026023 Bacteria 6370
161 Ga0207703_10032250 3300026035 Bacteria 4145
162 Ga0207678_10017163 3300026067 Bacteria 6354
163 Ga0207702_10000194 3300026078 Bacteria 71816
164 Ga0207702_10011155 3300026078 Bacteria 7497
165 Ga0207702_10023393 3300026078 Bacteria 5124
166 Ga0207641_10000015 3300026088 Bacteria 321332
167 Ga0207648_10000647 3300026089 Bacteria 39104
168 Ga0207676_10072340 3300026095 Bacteria 2771
169 Ga0207683_10002531 3300026121 Bacteria 15963
170 Ga0207698_10017428 3300026142 Bacteria 4872
171 Ga0268264_10000844 3300028381 Bacteria 32786
172 Ga0268264_10002184 3300028381 Bacteria 17393
173 Ga0307517_10001797 3300028786 Bacteria 35313
174 Ga0307515_10120832 3300028794 Bacteria 2968
175 Ga0307515_10124073 3300028794 Bacteria 2900
176 Ga0265327_10085951 3300031251 Bacteria 1544
177 Ga0307507_10000143 3300033179 Bacteria 124248
178 Ga0307510_10132732 3300033180 Bacteria 2157
179 Ga0395899_0000024 3300037312 Bacteria 357402
180 Ga0395899_0000027 3300037312 Bacteria 337387
181 Ga0395900_0000140 3300037418 Bacteria 121917
182 Ga0395900_0000251 3300037418 Bacteria 83846
183 Ga0395900_0120455 3300037418 Bacteria 2692
184 Ga0395905_0000248 3300037471 Bacteria 81042
185 Ga0395905_0001526 3300037471 Bacteria 27691
186 Ga0395901_0000145 3300038443 Bacteria 91739
187 Ga0466959_0219795 3300045049 Bacteria 1318
188 Ga0466958_0029865 3300045836 Bacteria 3235
189 Ga0495650_0000023 3300046471 Bacteria 527763
190 Ga0495585_0000250 3300046492 Bacteria 55780
191 Ga0495585_0002074 3300046492 Bacteria 14718
192 Ga0495596_0080760 3300046500 Bacteria 1262
193 Ga0495583_0015143 3300046506 Bacteria 4209
194 Ga0495606_0001103 3300046507 Bacteria 38654
195 Ga0495606_0034761 3300046507 Bacteria 3456
196 Ga0495616_0000353 3300046513 Bacteria 35893
197 Ga0495616_0010044 3300046513 Bacteria 5495
198 Ga0495631_0071351 3300046518 Bacteria 1501
199 Ga0495637_0046785 3300046520 Bacteria 1829
200 Ga0495644_0065008 3300046523 Unclassified 1371
201 Ga0495648_0009001 3300046524 Bacteria 7795
202 Ga0495654_0045609 3300046530 Bacteria 2162
203 Ga0495609_0031421 3300046538 Bacteria 2414
204 Ga0495633_0000083 3300046558 Bacteria 125035
205 Ga0495668_0000055 3300046616 Bacteria 199412
206 Ga0495668_0059509 3300046616 Bacteria 2108
207 Ga0495625_0000018 3300046660 Bacteria 299567
208 Ga0495625_0001180 3300046660 Bacteria 33548
209 Ga0495661_0001577 3300046665 Bacteria 18785
210 Ga0495661_0004587 3300046665 Bacteria 9943
211 Ga0495661_0069519 3300046665 Bacteria 2063
212 Ga0495671_0045107 3300046692 Bacteria 2208
213 Ga0495649_0000015 3300046694 Bacteria 246431
214 Ga0495660_0042854 3300046810 Bacteria 2499
215 Ga0495683_0006585 3300047323 Bacteria 6338
216 Ga0495687_000888 3300047443 Bacteria 31504
217 Ga0495686_0000917 3300047472 Bacteria 36995
218 Ga0495686_0000931 3300047472 Bacteria 36438
219 Ga0495686_0042956 3300047472 Bacteria 2870
220 Ga0495686_0067013 3300047472 Bacteria 2217
221 Ga0495686_0094177 3300047472 Bacteria 1815
222 Ga0495614_0000945 3300048089 Bacteria 12334
223 Ga0495678_003723 3300049459 Bacteria 9221
224 Ga0495682_0021652 3300049460 Bacteria 2407
225 nmdc:mga0k408_710_c1 3300050493 Bacteria 18223
226 Ga0500608_001030 3300053122 Bacteria 9990
227 Ga0500618_000006 3300053125 Bacteria 239188
228 Ga0500624_000631 3300053157 Bacteria 9385
229 2599479466 2599185184 Bacteria 6430550
230 2852625659 2852623160 Bacteria 4376875
231 2884934658 2884933994 Bacteria 4535041
232 2919439903 2919437846 Bacteria 6199444
233 2928082228 2928078545 Bacteria 6534839
234 2928149196 2928147474 Bacteria 6512076
235 2932084944 2932082852 Bacteria 6563563
236 2977234545 2977232053 Bacteria 5485925
237 Ga0207702_10235153
238 JGI24736J21556_1004104
239 JGI24739J22299_10039162
240 JGI24739J22299_10051735
241 JGI24735J21928_10000003
242 JGI25162J39368_1000301
243 JGI25162J39368_1002474
244 JGI25165J46597_1000456
245 rootH1_10021888
246 rootH1_10036994
247 rootH2_10002709
248 rootH2_10089059
249 rootL2_10054152
250 rootH1_10000975
251 rootH1_10123672
252 Ga0058863_10081386
253 Ga0058862_12459938
254 Ga0065714_10070953
255 Ga0065714_10082520
256 Ga0070658_10000008
257 Ga0070666_10000128
258 Ga0068868_100082508
259 Ga0068868_100314124
260 Ga0070671_100040160
261 Ga0070671_100220374
262 Ga0070673_100120328
263 Ga0070659_100016670
264 Ga0070667_100018783
265 Ga0070663_100012729
266 Ga0070662_100001291
267 Ga0070681_10034790
268 Ga0068867_100000904
269 Ga0070679_100010335
270 Ga0070679_100036706
271 Ga0070679_100292819
272 Ga0070684_100092576
273 Ga0068855_100000177
274 Ga0068855_100009928
275 Ga0068855_100014897
276 Ga0068855_100271428
277 Ga0068856_100003383
278 Ga0068856_100009146
279 Ga0068856_100084195
280 Ga0068856_100208732
281 Ga0068859_100000018
282 Ga0068851_10078701
283 Ga0068863_100079483
284 Ga0068858_100091320
285 Ga0068858_100186858
286 Ga0068860_100003505
287 Ga0068860_100012749
288 Ga0075366_10000660
289 Ga0075366_10010515
290 Ga0097621_100000174
291 Ga0097621_100103601
292 Ga0068871_100000060
293 Ga0097620_100000018
294 Ga0105240_10002497
295 Ga0105240_10116264
296 Ga0105240_10119427
297 Ga0105240_10262791
298 Ga0105247_10024254
299 Ga0105243_10111282
300 Ga0105241_10000510
301 Ga0105241_10005050
302 Ga0105241_10007345
303 Ga0105241_10028919
304 Ga0105242_10115429
305 Ga0105237_10001030
306 Ga0105237_10006927
307 Ga0105237_10008634
308 Ga0105237_10293962
309 Ga0105237_10347209
310 Ga0105238_10041236
311 Ga0105238_10076789
312 Ga0105249_10005809
313 Ga0105239_10000865
314 Ga0105239_10002625
315 Ga0105239_10004217
316 Ga0105239_10015371
317 Ga0105239_10019481
318 Ga0105239_10020300
319 Ga0105239_10116120
320 Ga0105246_10014766
321 Ga0157373_10000034
322 Ga0157373_10014428
323 Ga0157371_10000107
324 Ga0157371_10038757
325 Ga0157371_10082843
326 Ga0157370_10023850
327 Ga0157369_10001235
328 Ga0157369_10141939
329 Ga0157369_10508876
330 Ga0157369_10508877
331 Ga0157374_10000948
332 Ga0157374_10009410
333 Ga0157378_10151015
334 Ga0157378_10499940
335 Ga0163162_10000599
336 Ga0163162_10028147
337 Ga0163162_10063712
338 Ga0157372_10000041
339 Ga0157372_10012894
340 Ga0157372_10047377
341 Ga0157372_10065631
342 Ga0157372_10112528
343 Ga0157372_10225648
344 Ga0157372_10482760
345 Ga0157375_10037010
346 Ga0163163_10193118
347 Ga0157379_10082932
348 Ga0157379_10106889
349 Ga0209563_104608
350 Ga0207427_100083
351 Ga0209437_100021
352 Ga0209437_100030
353 Ga0209233_1000035
354 Ga0209233_1001001
355 Ga0209233_1022411
356 Ga0207656_10041284
357 Ga0207680_10000212
358 Ga0207647_10000231
359 Ga0207647_10000529
360 Ga0207645_10000347
361 Ga0207705_10000026
362 Ga0207654_10003074
363 Ga0207654_10012878
364 Ga0207654_10013537
365 Ga0207654_10015040
366 Ga0207695_10000179
367 Ga0207695_10012733
368 Ga0207695_10042583
369 Ga0207671_10000769
370 Ga0207671_10000815
371 Ga0207671_10001806
372 Ga0207671_10009106
373 Ga0207671_10184345
374 Ga0207657_10015841
375 Ga0207652_10019343
376 Ga0207694_10018515
377 Ga0207694_10042194
378 Ga0207687_10166223
379 Ga0207644_10083634
380 Ga0207644_10184985
381 Ga0207690_10031179
382 Ga0207706_10000406
383 Ga0207686_10017163
384 Ga0207704_10000307
385 Ga0207691_10036786
386 Ga0207689_10000602
387 Ga0207661_10163604
388 Ga0207667_10000070
389 Ga0207667_10002580
390 Ga0207667_10168447
391 Ga0207667_10245267
392 Ga0207712_10035720
393 Ga0207658_10036238
394 Ga0207658_10041991
395 Ga0207677_10006592
396 Ga0207703_10032250
397 Ga0207678_10017163
398 Ga0207702_10000194
399 Ga0207702_10011155
400 Ga0207702_10023393
401 Ga0207641_10000015
402 Ga0207648_10000647
403 Ga0207676_10072340
404 Ga0207683_10002531
405 Ga0207698_10017428
406 Ga0268264_10000844
407 Ga0268264_10002184
408 Ga0307517_10001797
409 Ga0307515_10120832
410 Ga0307515_10124073
411 Ga0265327_10085951
412 Ga0307507_10000143
413 Ga0307510_10132732
414 Ga0395899_0000024
415 Ga0395899_0000027
416 Ga0395900_0000140
417 Ga0395900_0000251
418 Ga0395900_0120455
419 Ga0395905_0000248
420 Ga0395905_0001526
421 Ga0395901_0000145
422 Ga0466959_0219795
423 Ga0466958_0029865
424 Ga0495650_0000023
425 Ga0495585_0000250
426 Ga0495585_0002074
427 Ga0495596_0080760
428 Ga0495583_0015143
429 Ga0495606_0001103
430 Ga0495606_0034761
431 Ga0495616_0000353
432 Ga0495616_0010044
433 Ga0495631_0071351
434 Ga0495637_0046785
435 Ga0495644_0065008
436 Ga0495648_0009001
437 Ga0495654_0045609
438 Ga0495609_0031421
439 Ga0495633_0000083
440 Ga0495668_0000055
441 Ga0495668_0059509
442 Ga0495625_0000018
443 Ga0495625_0001180
444 Ga0495661_0001577
445 Ga0495661_0004587
446 Ga0495661_0069519
447 Ga0495671_0045107
448 Ga0495649_0000015
449 Ga0495660_0042854
450 Ga0495683_0006585
451 Ga0495687_000888
452 Ga0495686_0000917
453 Ga0495686_0000931
454 Ga0495686_0042956
455 Ga0495686_0067013
456 Ga0495686_0094177
457 Ga0495614_0000945
458 Ga0495678_003723
459 Ga0495682_0021652
460 nmdc:mga0k408_710_c1
461 Ga0500608_001030
462 Ga0500618_000006
463 Ga0500624_000631
464 2599479466
465 2852625659
466 2884934658
467 2919439903
468 2928082228
469 2928149196
470 2932084944
471 2977234545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

97

414

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3egj-assembly1.cif.gz_A n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae. 0.9374 8 379
2p53-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate 0.9348 10 380
2p50-assembly1.cif.gz_A crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9343 10 380
2p50-assembly2.cif.gz_C crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9325 10 380
2p50-assembly2.cif.gz_D crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9313 10 380
ID Description Score Start End Superfamily
3iv8D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9305 9 62 2.30.40.10
af_P0AF18_1_54_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9254 10 62 2.30.40.10
1yrrB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9206 11 62 2.30.40.10
af_Q2G2U0_63_361_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9156 62 347 3.20.20.140
af_O53382_52_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9087 62 344 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A258WRN5-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9813 8 378 GO:0006046
GO:0008448
GO:0046872
AF-A0A482SHG6-F1-model_v4 deleted 0.9811 151 380
AF-A0A258WRN5-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9786 8 378 GO:0006046
GO:0008448
GO:0046872
AF-A0A358XRQ4-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9735 174 364 GO:0006046
GO:0008448
AF-A0A2S1LN73-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9728 8 377 GO:0006046
GO:0008448
GO:0046872

Map