F348256

General Info

Members Datasets Scaffolds Average Seq Length
235 114 234 364

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10012918|Ga0265338_100129186
Length 381
Sequence VGSSPTFAPPLPQSLALATDILYVVPELQHNTLVEAAYRRRGFSRLEAAAGARFCAEAARHGIRTHNAIKALHLDHLFGSGAGGCQPKARIEKIKTRFRGAQVWNANRKLGQATGYAAIETAMKLADRYGIGMVSVDNAFHYLWGGGYVMEAARRGYIAYTNCTAALAEVVPFGGRFPTLGTNPHSWGFPTTAALGYPIVIDWATSVVAMGRVQQLAREGKPLPPNAAVDEQGAPTTDPARAKYLLPFGAHKGYGLSLINELVAAFIGGSLPTLRSRWDREPQEKHSCCFFFQVWHPDAISAGAFAGGRTQADNVKAVIADILGHGNEGCLLPGQIEAEAAARSAKHGGLLFSEAEIAAFSEIAAGCRQPKWNLADFPVAP

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
112 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 0
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10009782 3300003320 Bacteria 15407
2 rootH2_10129369 3300003320 Bacteria 2353
3 rootH1_10042213 3300003323 Bacteria 2020
4 Ga0070683_100018696 3300005329 Bacteria 6141
5 Ga0070683_100023865 3300005329 Bacteria 5475
6 Ga0070670_100347897 3300005331 Bacteria 1302
7 Ga0070675_100026242 3300005354 Bacteria 4675
8 Ga0070667_100090728 3300005367 Bacteria 2627
9 Ga0070713_100033655 3300005436 Bacteria 4108
10 Ga0070713_100455504 3300005436 Bacteria 1202
11 Ga0070705_100132906 3300005440 Bacteria 1626
12 Ga0070706_100071970 3300005467 Bacteria 3199
13 Ga0070698_100018303 3300005471 Bacteria 7376
14 Ga0070679_100017986 3300005530 Bacteria 6850
15 Ga0070672_100106504 3300005543 Bacteria 2281
16 Ga0070664_100138481 3300005564 Bacteria 2141
17 Ga0068857_100127544 3300005577 Bacteria 2293
18 Ga0068856_100000216 3300005614 Bacteria 62260
19 Ga0068852_100184839 3300005616 Bacteria 1962
20 Ga0068863_100133253 3300005841 Bacteria 2373
21 Ga0068863_100193233 3300005841 Bacteria 1956
22 Ga0068860_100233859 3300005843 Bacteria 1786
23 Ga0070717_10000110 3300006028 Bacteria 64702
24 Ga0075364_10153231 3300006051 Bacteria 1554
25 Ga0105240_10016531 3300009093 Bacteria 9987
26 Ga0105240_10233425 3300009093 Bacteria 2136
27 Ga0111539_10206875 3300009094 Bacteria 2287
28 Ga0105245_10063404 3300009098 Bacteria 3337
29 Ga0114129_10419959 3300009147 Bacteria 1759
30 Ga0114129_10631421 3300009147 Bacteria 1384
31 Ga0157370_10010950 3300013104 Bacteria 9518
32 Ga0157370_10147978 3300013104 Bacteria 2186
33 Ga0157369_10319718 3300013105 Unclassified 1613
34 Ga0163162_10077033 3300013306 Bacteria 3398
35 Ga0157372_10163515 3300013307 Unclassified 2573
36 Ga0163163_10341261 3300014325 Bacteria 1553
37 Ga0207695_10000211 3300025913 Bacteria 156467
38 Ga0207652_10043593 3300025921 Bacteria 3820
39 Ga0207646_10240405 3300025922 Bacteria 1636
40 Ga0207650_10055051 3300025925 Bacteria 2952
41 Ga0207650_10180352 3300025925 Bacteria 1683
42 Ga0207659_10060594 3300025926 Bacteria 2724
43 Ga0207659_10137195 3300025926 Bacteria 1895
44 Ga0207700_10028232 3300025928 Bacteria 3942
45 Ga0207669_10003757 3300025937 Bacteria 6592
46 Ga0207691_10037795 3300025940 Bacteria 4469
47 Ga0207661_10016296 3300025944 Bacteria 5483
48 Ga0207679_10096211 3300025945 Bacteria 2303
49 Ga0207658_10018891 3300025986 Bacteria 4767
50 Ga0207702_10000313 3300026078 Bacteria 55459
51 Ga0207641_10108874 3300026088 Bacteria 2453
52 Ga0207641_10182335 3300026088 Bacteria 1924
53 Ga0265337_1001202 3300028556 Bacteria 13174
54 Ga0265337_1004468 3300028556 Bacteria 5798
55 Ga0265326_10033292 3300028558 Bacteria 1467
56 Ga0265319_1000043 3300028563 Bacteria 109696
57 Ga0265319_1002070 3300028563 Bacteria 11268
58 Ga0265319_1002247 3300028563 Bacteria 10724
59 Ga0265319_1002458 3300028563 Bacteria 10111
60 Ga0265319_1007847 3300028563 Bacteria 4745
61 Ga0265319_1014456 3300028563 Unclassified 3096
62 Ga0265319_1024210 3300028563 Bacteria 2188
63 Ga0265334_10003275 3300028573 Bacteria 7391
64 Ga0265318_10000002 3300028577 Bacteria 428208
65 Ga0265318_10000006 3300028577 Bacteria 285591
66 Ga0265318_10000690 3300028577 Bacteria 22719
67 Ga0265318_10001576 3300028577 Bacteria 13202
68 Ga0265318_10003279 3300028577 Bacteria 8226
69 Ga0265318_10009779 3300028577 Bacteria 4203
70 Ga0265318_10074569 3300028577 Bacteria 1256
71 Ga0265336_10000790 3300028666 Bacteria 16725
72 Ga0265336_10010711 3300028666 Bacteria 3135
73 Ga0265338_10002288 3300028800 Bacteria 29166
74 Ga0265338_10002495 3300028800 Bacteria 27417
75 Ga0265338_10008644 3300028800 Bacteria 12318
76 Ga0265338_10012918 3300028800 Bacteria 9485
77 Ga0265324_10001657 3300029957 Bacteria 12322
78 Ga0265324_10002815 3300029957 Bacteria 8579
79 Ga0265332_10021889 3300031238 Bacteria 2823
80 Ga0265328_10023787 3300031239 Bacteria 2321
81 Ga0265320_10000015 3300031240 Bacteria 198537
82 Ga0265320_10000356 3300031240 Bacteria 37270
83 Ga0265320_10000369 3300031240 Bacteria 36482
84 Ga0265320_10000614 3300031240 Bacteria 27360
85 Ga0265320_10002028 3300031240 Bacteria 14282
86 Ga0265320_10002522 3300031240 Bacteria 12729
87 Ga0265320_10005853 3300031240 Bacteria 7830
88 Ga0265320_10005925 3300031240 Bacteria 7771
89 Ga0265320_10006828 3300031240 Bacteria 7151
90 Ga0265320_10007265 3300031240 Bacteria 6895
91 Ga0265320_10075426 3300031240 Bacteria 1582
92 Ga0265320_10082923 3300031240 Bacteria 1494
93 Ga0265325_10079366 3300031241 Bacteria 1633
94 Ga0265340_10060734 3300031247 Bacteria 1810
95 Ga0265339_10073146 3300031249 Bacteria 1823
96 Ga0265339_10091210 3300031249 Bacteria 1597
97 Ga0265331_10013658 3300031250 Bacteria 4357
98 Ga0265331_10014308 3300031250 Bacteria 4230
99 Ga0265331_10038748 3300031250 Bacteria 2327
100 Ga0265327_10009297 3300031251 Bacteria 7117
101 Ga0265316_10038909 3300031344 Bacteria 3825
102 Ga0265316_10070919 3300031344 Unclassified 2687
103 Ga0265316_10115062 3300031344 Bacteria 2034
104 Ga0265316_10207349 3300031344 Bacteria 1451
105 Ga0307408_100000017 3300031548 Bacteria 355890
106 Ga0265313_10000163 3300031595 Bacteria 69742
107 Ga0265313_10000831 3300031595 Bacteria 31241
108 Ga0265313_10002731 3300031595 Bacteria 14914
109 Ga0265313_10007476 3300031595 Bacteria 7454
110 Ga0265313_10007781 3300031595 Bacteria 7244
111 Ga0265313_10012248 3300031595 Bacteria 5250
112 Ga0265313_10028892 3300031595 Bacteria 2875
113 Ga0265313_10037907 3300031595 Bacteria 2405
114 Ga0265313_10051474 3300031595 Bacteria 1970
115 Ga0265313_10052481 3300031595 Bacteria 1946
116 Ga0307508_10000266 3300031616 Bacteria 63937
117 Ga0265314_10000728 3300031711 Bacteria 39616
118 Ga0265314_10002115 3300031711 Bacteria 20851
119 Ga0265314_10003419 3300031711 Bacteria 15356
120 Ga0265314_10006113 3300031711 Bacteria 10700
121 Ga0265314_10006477 3300031711 Bacteria 10356
122 Ga0265314_10009233 3300031711 Bacteria 8354
123 Ga0265314_10067608 3300031711 Bacteria 2405
124 Ga0265314_10123507 3300031711 Bacteria 1626
125 Ga0265342_10001929 3300031712 Bacteria 18604
126 Ga0265342_10022008 3300031712 Bacteria 4061
127 Ga0307412_10112509 3300031911 Bacteria 1946
128 Ga0307409_100000178 3300031995 Bacteria 24822
129 Ga0307416_100000034 3300032002 Bacteria 155632
130 Ga0307416_100127873 3300032002 Bacteria 2280
131 Ga0307416_100157810 3300032002 Bacteria 2091
132 Ga0307415_100170028 3300032126 Bacteria 1699
133 Ga0373933_0116373 3300035724 Bacteria 1671
134 Ga0395905_0449796 3300037471 Bacteria 1186
135 Ga0439446_0052729 3300042156 Bacteria 1218
136 Ga0451577_0002863 3300042876 Bacteria 19842
137 Ga0451577_0004884 3300042876 Bacteria 13971
138 Ga0451577_0008988 3300042876 Bacteria 9656
139 Ga0451577_0046405 3300042876 Bacteria 3887
140 Ga0451577_0284476 3300042876 Bacteria 1498
141 Ga0453683_0008464 3300044673 Bacteria 6901
142 Ga0453684_0025923 3300044712 Bacteria 8490
143 Ga0453684_0038334 3300044712 Bacteria 6555
144 Ga0451576_0000163 3300045051 Bacteria 170072
145 Ga0451576_0012524 3300045051 Bacteria 9521
146 Ga0451576_0052736 3300045051 Bacteria 4262
147 Ga0466967_0040420 3300045976 Bacteria 4015
148 Ga0495592_0115701 3300046454 Bacteria 1893
149 Ga0495618_0025374 3300046514 Bacteria 3678
150 Ga0495630_0062227 3300046517 Bacteria 2803
151 Ga0495630_0133457 3300046517 Bacteria 1886
152 Ga0495640_0045095 3300046533 Bacteria 3061
153 Ga0495667_0062080 3300046559 Bacteria 2449
154 Ga0495667_0122044 3300046559 Bacteria 1682
155 Ga0495634_0095123 3300046642 Bacteria 1930
156 Ga0495635_0183586 3300046663 Bacteria 1421
157 Ga0495658_0038761 3300046683 Bacteria 2640
158 Ga0495613_0024763 3300046689 Bacteria 4472
159 Ga0495613_0050307 3300046689 Bacteria 3073
160 Ga0495676_0171468 3300047321 Bacteria 1527
161 Ga0495684_0007593 3300047471 Bacteria 8390
162 Ga0495684_0024530 3300047471 Bacteria 4643
163 Ga0495684_0099668 3300047471 Unclassified 2197
164 Ga0496121_0082227 3300048924 Bacteria 2547
165 Ga0501032_0000096 3300049569 Bacteria 74368
166 Ga0501032_0001790 3300049569 Bacteria 16957
167 Ga0501032_0082736 3300049569 Bacteria 2135
168 Ga0501033_0001188 3300049570 Bacteria 23515
169 Ga0501033_0023952 3300049570 Bacteria 4605
170 Ga0501034_0000217 3300049571 Bacteria 109765
171 Ga0501034_0002865 3300049571 Bacteria 20073
172 Ga0501034_0009552 3300049571 Bacteria 10154
173 Ga0501034_0010912 3300049571 Bacteria 9439
174 Ga0501034_0011905 3300049571 Bacteria 8998
175 Ga0501036_0000301 3300049572 Bacteria 34161
176 Ga0501036_0044635 3300049572 Bacteria 3755
177 Ga0501036_0292646 3300049572 Bacteria 1362
178 Ga0501037_0001137 3300049573 Bacteria 19718
179 Ga0501037_0010603 3300049573 Bacteria 6770
180 Ga0501038_0000355 3300049574 Bacteria 39320
181 Ga0501038_0001505 3300049574 Bacteria 21439
182 Ga0501039_0014687 3300049575 Bacteria 5990
183 Ga0501042_0001165 3300049578 Bacteria 15217
184 Ga0501043_0034038 3300049579 Bacteria 4008
185 Ga0501043_0034356 3300049579 Unclassified 3988
186 Ga0501046_0000007 3300049580 Bacteria 356002
187 Ga0501046_0000550 3300049580 Bacteria 37312
188 Ga0501046_0005162 3300049580 Bacteria 11703
189 Ga0501046_0012986 3300049580 Bacteria 7070
190 Ga0501046_0025531 3300049580 Bacteria 4834
191 Ga0501046_0138724 3300049580 Bacteria 1841
192 Ga0501047_0001124 3300049581 Bacteria 26582
193 Ga0501047_0001480 3300049581 Bacteria 22905
194 Ga0501047_0008660 3300049581 Bacteria 9609
195 Ga0501047_0014733 3300049581 Bacteria 7440
196 Ga0501047_0087912 3300049581 Bacteria 2985
197 Ga0501047_0225047 3300049581 Bacteria 1731
198 Ga0501048_0002373 3300049582 Bacteria 14383
199 Ga0501048_0064768 3300049582 Bacteria 2584
200 Ga0501068_0040252 3300049584 Bacteria 2805
201 Ga0501070_0104446 3300049586 Bacteria 2342
202 Ga0501073_0016624 3300049589 Bacteria 5330
203 Ga0501073_0084618 3300049589 Bacteria 2207
204 Ga0501080_0004857 3300049742 Bacteria 11982
205 Ga0501080_0059198 3300049742 Bacteria 3565
206 Ga0501080_0116150 3300049742 Bacteria 2481
207 Ga0501080_0211090 3300049742 Bacteria 1779
208 Ga0501080_0212387 3300049742 Bacteria 1773
209 Ga0501080_0230204 3300049742 Bacteria 1694
210 Ga0501083_0000046 3300049744 Bacteria 88934
211 Ga0501083_0003250 3300049744 Bacteria 11342
212 Ga0501083_0008420 3300049744 Bacteria 7290
213 Ga0501083_0052616 3300049744 Bacteria 2735
214 Ga0501083_0075693 3300049744 Bacteria 2235
215 Ga0501083_0101583 3300049744 Bacteria 1896
216 Ga0501035_0000783 3300049822 Bacteria 34036
217 Ga0501035_0002708 3300049822 Bacteria 17229
218 Ga0501035_0010010 3300049822 Bacteria 8797
219 Ga0501035_0106040 3300049822 Bacteria 2464
220 Ga0501044_0000834 3300049823 Bacteria 36994
221 Ga0501044_0005169 3300049823 Bacteria 14535
222 Ga0501044_0025152 3300049823 Bacteria 6312
223 Ga0501044_0032961 3300049823 Bacteria 5444
224 Ga0501044_0077964 3300049823 Bacteria 3359
225 Ga0501044_0144957 3300049823 Bacteria 2361
226 Ga0501045_0125874 3300049824 Bacteria 1904
227 nmdc:mga08y16_465633_c1 3300050511 Bacteria 1287
228 Ga0495612_0007121 3300053078 Bacteria 4578
229 Ga0500568_0014859 3300053139 Bacteria 3501
230 Ga0500616_0014304 3300053153 Bacteria 4564
231 Ga0501082_0000120 3300060353 Bacteria 62475
232 Ga0501082_0023065 3300060353 Bacteria 5366
233 Ga0501082_0025557 3300060353 Bacteria 5089
234 Ga0501082_0183386 3300060353 Bacteria 1821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_465633_c1 nmdc:mga08y16_465633_c1_10_987 324
2 3300049580 Ga0501046_0138724 Ga0501046_0138724_813_1799 328
3 3300049570 Ga0501033_0023952 Ga0501033_0023952_2268_3359 340
4 3300049571 Ga0501034_0002865 Ga0501034_0002865_9791_10882 340
5 3300049572 Ga0501036_0292646 Ga0501036_0292646_67_1158 340
6 3300049573 Ga0501037_0001137 Ga0501037_0001137_5113_6204 340
7 3300049574 Ga0501038_0001505 Ga0501038_0001505_6007_7098 340
8 3300049579 Ga0501043_0034038 Ga0501043_0034038_234_1325 340
9 3300049581 Ga0501047_0087912 Ga0501047_0087912_603_1694 340
10 3300049742 Ga0501080_0116150 Ga0501080_0116150_703_1794 340
11 3300005843 Ga0068860_100233859 Ga0068860_1002338592 356
12 3300037471 Ga0395905_0449796 Ga0395905_0449796_25_1098 356
13 3300049744 Ga0501083_0008420 Ga0501083_0008420_6175_7272 356
14 3300005543 Ga0070672_100106504 Ga0070672_1001065042 358
15 3300025926 Ga0207659_10137195 Ga0207659_101371952 358
16 3300025937 Ga0207669_10003757 Ga0207669_100037572 358
17 3300025940 Ga0207691_10037795 Ga0207691_100377953 358
18 3300005440 Ga0070705_100132906 Ga0070705_1001329062 360
19 3300005471 Ga0070698_100018303 Ga0070698_1000183031 360
20 3300025922 Ga0207646_10240405 Ga0207646_102404052 360
21 iso_pu_bacteria 2786546940 2788434549 360
22 3300009094 Ga0111539_10206875 Ga0111539_102068752 361
23 3300009147 Ga0114129_10419959 Ga0114129_104199592 361
24 3300031250 Ga0265331_10013658 Ga0265331_100136583 361
25 3300046454 Ga0495592_0115701 Ga0495592_0115701_62_1153 361
26 3300053078 Ga0495612_0007121 Ga0495612_0007121_1409_2500 361
27 3300060353 Ga0501082_0000120 Ga0501082_0000120_11528_12646 361
28 3300005367 Ga0070667_100090728 Ga0070667_1000907282 362
29 3300005436 Ga0070713_100455504 Ga0070713_1004555041 362
30 3300005616 Ga0068852_100184839 Ga0068852_1001848392 362
31 3300005841 Ga0068863_100133253 Ga0068863_1001332532 362
32 3300009093 Ga0105240_10016531 Ga0105240_100165316 362
33 3300009093 Ga0105240_10233425 Ga0105240_102334252 362
34 3300009098 Ga0105245_10063404 Ga0105245_100634044 362
35 3300013104 Ga0157370_10010950 Ga0157370_100109506 362
36 3300013104 Ga0157370_10147978 Ga0157370_101479782 362
37 3300013105 Ga0157369_10319718 Ga0157369_103197182 362
38 3300013307 Ga0157372_10163515 Ga0157372_101635152 362
39 3300025913 Ga0207695_10000211 Ga0207695_10000211134 362
40 3300025986 Ga0207658_10018891 Ga0207658_100188913 362
41 3300026088 Ga0207641_10108874 Ga0207641_101088743 362
42 3300046517 Ga0495630_0062227 Ga0495630_0062227_307_1404 362
43 3300046533 Ga0495640_0045095 Ga0495640_0045095_1227_2324 362
44 3300046663 Ga0495635_0183586 Ga0495635_0183586_217_1314 362
45 3300048924 Ga0496121_0082227 Ga0496121_0082227_526_1614 362
46 3300049571 Ga0501034_0011905 Ga0501034_0011905_5686_6777 362
47 3300049580 Ga0501046_0000007 Ga0501046_0000007_125894_126985 362
48 3300049581 Ga0501047_0014733 Ga0501047_0014733_5736_6827 362
49 3300049581 Ga0501047_0225047 Ga0501047_0225047_273_1364 362
50 3300049582 Ga0501048_0002373 Ga0501048_0002373_7409_8500 362
51 3300049586 Ga0501070_0104446 Ga0501070_0104446_1206_2297 362
52 3300049589 Ga0501073_0016624 Ga0501073_0016624_379_1476 362
53 3300049742 Ga0501080_0004857 Ga0501080_0004857_4298_5389 362
54 3300049742 Ga0501080_0059198 Ga0501080_0059198_1208_2299 362
55 3300049742 Ga0501080_0211090 Ga0501080_0211090_557_1648 362
56 3300049744 Ga0501083_0000046 Ga0501083_0000046_81080_82171 362
57 3300049822 Ga0501035_0010010 Ga0501035_0010010_1999_3090 362
58 3300049823 Ga0501044_0005169 Ga0501044_0005169_9262_10353 362
59 3300049823 Ga0501044_0077964 Ga0501044_0077964_1035_2126 362
60 3300049823 Ga0501044_0144957 Ga0501044_0144957_1079_2170 362
61 3300060353 Ga0501082_0025557 Ga0501082_0025557_3894_4985 362
62 3300060353 Ga0501082_0183386 Ga0501082_0183386_122_1213 362
63 3300005331 Ga0070670_100347897 Ga0070670_1003478971 363
64 3300005436 Ga0070713_100033655 Ga0070713_1000336553 363
65 3300005530 Ga0070679_100017986 Ga0070679_1000179865 363
66 3300005564 Ga0070664_100138481 Ga0070664_1001384812 363
67 3300006051 Ga0075364_10153231 Ga0075364_101532312 363
68 3300013306 Ga0163162_10077033 Ga0163162_100770333 363
69 3300025921 Ga0207652_10043593 Ga0207652_100435932 363
70 3300025925 Ga0207650_10180352 Ga0207650_101803522 363
71 3300025928 Ga0207700_10028232 Ga0207700_100282323 363
72 3300025945 Ga0207679_10096211 Ga0207679_100962112 363
73 3300028556 Ga0265337_1001202 Ga0265337_10012023 363
74 3300028563 Ga0265319_1007847 Ga0265319_10078474 363
75 3300028563 Ga0265319_1014456 Ga0265319_10144563 363
76 3300028577 Ga0265318_10003279 Ga0265318_100032797 363
77 3300031240 Ga0265320_10000015 Ga0265320_1000001521 363
78 3300031240 Ga0265320_10000356 Ga0265320_1000035629 363
79 3300031240 Ga0265320_10000369 Ga0265320_1000036930 363
80 3300031240 Ga0265320_10000614 Ga0265320_100006145 363
81 3300031250 Ga0265331_10014308 Ga0265331_100143083 363
82 3300031344 Ga0265316_10070919 Ga0265316_100709192 363
83 3300031595 Ga0265313_10000163 Ga0265313_1000016319 363
84 3300031595 Ga0265313_10052481 Ga0265313_100524812 363
85 3300031711 Ga0265314_10006477 Ga0265314_100064774 363
86 3300032002 Ga0307416_100127873 Ga0307416_1001278732 363
87 3300032126 Ga0307415_100170028 Ga0307415_1001700282 363
88 3300042876 Ga0451577_0002863 Ga0451577_0002863_10292_11398 363
89 3300045051 Ga0451576_0052736 Ga0451576_0052736_639_1730 363
90 3300046514 Ga0495618_0025374 Ga0495618_0025374_2366_3460 363
91 3300046517 Ga0495630_0133457 Ga0495630_0133457_515_1609 363
92 3300046559 Ga0495667_0062080 Ga0495667_0062080_893_1987 363
93 3300046559 Ga0495667_0122044 Ga0495667_0122044_216_1310 363
94 3300046642 Ga0495634_0095123 Ga0495634_0095123_145_1239 363
95 3300046683 Ga0495658_0038761 Ga0495658_0038761_1263_2357 363
96 3300046689 Ga0495613_0024763 Ga0495613_0024763_552_1646 363
97 3300046689 Ga0495613_0050307 Ga0495613_0050307_1445_2539 363
98 3300047321 Ga0495676_0171468 Ga0495676_0171468_343_1437 363
99 3300047471 Ga0495684_0007593 Ga0495684_0007593_2001_3095 363
100 3300047471 Ga0495684_0024530 Ga0495684_0024530_2726_3820 363
101 3300047471 Ga0495684_0099668 Ga0495684_0099668_207_1307 363
102 3300049571 Ga0501034_0000217 Ga0501034_0000217_104883_105986 363
103 3300005354 Ga0070675_100026242 Ga0070675_1000262421 364
104 3300005467 Ga0070706_100071970 Ga0070706_1000719702 364
105 3300005841 Ga0068863_100193233 Ga0068863_1001932332 364
106 3300006028 Ga0070717_10000110 Ga0070717_1000011019 364
107 3300009147 Ga0114129_10631421 Ga0114129_106314212 364
108 3300025925 Ga0207650_10055051 Ga0207650_100550512 364
109 3300025926 Ga0207659_10060594 Ga0207659_100605943 364
110 3300026088 Ga0207641_10182335 Ga0207641_101823351 364
111 3300028563 Ga0265319_1000043 Ga0265319_100004334 364
112 3300028563 Ga0265319_1002070 Ga0265319_10020707 364
113 3300028563 Ga0265319_1002458 Ga0265319_10024586 364
114 3300028573 Ga0265334_10003275 Ga0265334_100032752 364
115 3300028577 Ga0265318_10000002 Ga0265318_10000002367 364
116 3300028577 Ga0265318_10000690 Ga0265318_100006902 364
117 3300028577 Ga0265318_10074569 Ga0265318_100745691 364
118 3300028666 Ga0265336_10010711 Ga0265336_100107113 364
119 3300028800 Ga0265338_10012918 Ga0265338_100129186 364
120 3300031238 Ga0265332_10021889 Ga0265332_100218892 364
121 3300031240 Ga0265320_10005853 Ga0265320_100058533 364
122 3300031240 Ga0265320_10005925 Ga0265320_100059255 364
123 3300031240 Ga0265320_10006828 Ga0265320_100068284 364
124 3300031240 Ga0265320_10082923 Ga0265320_100829232 364
125 3300031241 Ga0265325_10079366 Ga0265325_100793662 364
126 3300031249 Ga0265339_10073146 Ga0265339_100731462 364
127 3300031249 Ga0265339_10091210 Ga0265339_100912101 364
128 3300031250 Ga0265331_10038748 Ga0265331_100387482 364
129 3300031344 Ga0265316_10115062 Ga0265316_101150621 364
130 3300031344 Ga0265316_10207349 Ga0265316_102073491 364
131 3300031548 Ga0307408_100000017 Ga0307408_10000001749 364
132 3300031595 Ga0265313_10000831 Ga0265313_100008319 364
133 3300031595 Ga0265313_10007476 Ga0265313_100074764 364
134 3300031595 Ga0265313_10007781 Ga0265313_100077814 364
135 3300031595 Ga0265313_10037907 Ga0265313_100379072 364
136 3300031595 Ga0265313_10051474 Ga0265313_100514742 364
137 3300031711 Ga0265314_10002115 Ga0265314_100021152 364
138 3300031711 Ga0265314_10006113 Ga0265314_100061136 364
139 3300031711 Ga0265314_10009233 Ga0265314_100092333 364
140 3300031711 Ga0265314_10067608 Ga0265314_100676082 364
141 3300031712 Ga0265342_10001929 Ga0265342_1000192917 364
142 3300031712 Ga0265342_10022008 Ga0265342_100220084 364
143 3300031911 Ga0307412_10112509 Ga0307412_101125092 364
144 3300032002 Ga0307416_100000034 Ga0307416_10000003438 364
145 3300035724 Ga0373933_0116373 Ga0373933_0116373_68_1165 364
146 3300044712 Ga0453684_0025923 Ga0453684_0025923_3326_4420 364
147 3300049569 Ga0501032_0082736 Ga0501032_0082736_145_1239 364
148 3300049570 Ga0501033_0001188 Ga0501033_0001188_7531_8625 364
149 3300049571 Ga0501034_0010912 Ga0501034_0010912_1091_2191 364
150 3300049573 Ga0501037_0010603 Ga0501037_0010603_1453_2547 364
151 3300049579 Ga0501043_0034356 Ga0501043_0034356_2834_3928 364
152 3300049580 Ga0501046_0000550 Ga0501046_0000550_16252_17346 364
153 3300049580 Ga0501046_0005162 Ga0501046_0005162_10228_11322 364
154 3300049581 Ga0501047_0001480 Ga0501047_0001480_10282_11376 364
155 3300049589 Ga0501073_0084618 Ga0501073_0084618_250_1368 364
156 3300049742 Ga0501080_0230204 Ga0501080_0230204_464_1561 364
157 3300049744 Ga0501083_0003250 Ga0501083_0003250_760_1857 364
158 3300049744 Ga0501083_0075693 Ga0501083_0075693_132_1229 364
159 3300049822 Ga0501035_0106040 Ga0501035_0106040_1200_2294 364
160 3300053139 Ga0500568_0014859 Ga0500568_0014859_208_1326 364
161 3300053153 Ga0500616_0014304 Ga0500616_0014304_2428_3546 364
162 3300003320 rootH2_10009782 rootH2_100097823 365
163 3300003320 rootH2_10129369 rootH2_101293692 365
164 3300003323 rootH1_10042213 rootH1_100422132 365
165 3300005329 Ga0070683_100018696 Ga0070683_1000186965 365
166 3300005329 Ga0070683_100023865 Ga0070683_1000238653 365
167 3300005577 Ga0068857_100127544 Ga0068857_1001275442 365
168 3300005614 Ga0068856_100000216 Ga0068856_10000021641 365
169 3300014325 Ga0163163_10341261 Ga0163163_103412611 365
170 3300025944 Ga0207661_10016296 Ga0207661_100162963 365
171 3300026078 Ga0207702_10000313 Ga0207702_1000031324 365
172 3300028556 Ga0265337_1004468 Ga0265337_10044682 365
173 3300028558 Ga0265326_10033292 Ga0265326_100332922 365
174 3300028563 Ga0265319_1002247 Ga0265319_10022476 365
175 3300028563 Ga0265319_1024210 Ga0265319_10242102 365
176 3300028577 Ga0265318_10000006 Ga0265318_1000000658 365
177 3300028577 Ga0265318_10001576 Ga0265318_100015767 365
178 3300028577 Ga0265318_10009779 Ga0265318_100097793 365
179 3300028666 Ga0265336_10000790 Ga0265336_100007903 365
180 3300028800 Ga0265338_10002288 Ga0265338_100022885 365
181 3300028800 Ga0265338_10002495 Ga0265338_1000249523 365
182 3300028800 Ga0265338_10008644 Ga0265338_100086447 365
183 3300029957 Ga0265324_10001657 Ga0265324_100016576 365
184 3300029957 Ga0265324_10002815 Ga0265324_100028156 365
185 3300031239 Ga0265328_10023787 Ga0265328_100237872 365
186 3300031240 Ga0265320_10002028 Ga0265320_100020285 365
187 3300031240 Ga0265320_10002522 Ga0265320_100025227 365
188 3300031240 Ga0265320_10007265 Ga0265320_100072654 365
189 3300031240 Ga0265320_10075426 Ga0265320_100754262 365
190 3300031247 Ga0265340_10060734 Ga0265340_100607342 365
191 3300031251 Ga0265327_10009297 Ga0265327_100092977 365
192 3300031344 Ga0265316_10038909 Ga0265316_100389093 365
193 3300031595 Ga0265313_10002731 Ga0265313_100027319 365
194 3300031595 Ga0265313_10012248 Ga0265313_100122485 365
195 3300031595 Ga0265313_10028892 Ga0265313_100288922 365
196 3300031616 Ga0307508_10000266 Ga0307508_100002662 365
197 3300031711 Ga0265314_10000728 Ga0265314_1000072829 365
198 3300031711 Ga0265314_10003419 Ga0265314_100034193 365
199 3300031711 Ga0265314_10123507 Ga0265314_101235072 365
200 3300031995 Ga0307409_100000178 Ga0307409_1000001782 365
201 3300032002 Ga0307416_100157810 Ga0307416_1001578102 365
202 3300042156 Ga0439446_0052729 Ga0439446_0052729_108_1205 365
203 3300042876 Ga0451577_0004884 Ga0451577_0004884_9354_10478 365
204 3300042876 Ga0451577_0008988 Ga0451577_0008988_8464_9561 365
205 3300042876 Ga0451577_0046405 Ga0451577_0046405_1366_2463 365
206 3300042876 Ga0451577_0284476 Ga0451577_0284476_50_1147 365
207 3300044673 Ga0453683_0008464 Ga0453683_0008464_102_1199 365
208 3300044712 Ga0453684_0038334 Ga0453684_0038334_5382_6479 365
209 3300045051 Ga0451576_0000163 Ga0451576_0000163_119423_120523 365
210 3300045051 Ga0451576_0012524 Ga0451576_0012524_1359_2456 365
211 3300045976 Ga0466967_0040420 Ga0466967_0040420_2700_3797 365
212 3300049569 Ga0501032_0000096 Ga0501032_0000096_61848_62945 365
213 3300049569 Ga0501032_0001790 Ga0501032_0001790_3134_4231 365
214 3300049571 Ga0501034_0009552 Ga0501034_0009552_2971_4068 365
215 3300049572 Ga0501036_0000301 Ga0501036_0000301_7568_8665 365
216 3300049572 Ga0501036_0044635 Ga0501036_0044635_980_2077 365
217 3300049574 Ga0501038_0000355 Ga0501038_0000355_15532_16629 365
218 3300049575 Ga0501039_0014687 Ga0501039_0014687_1438_2535 365
219 3300049578 Ga0501042_0001165 Ga0501042_0001165_13362_14459 365
220 3300049580 Ga0501046_0012986 Ga0501046_0012986_3823_4920 365
221 3300049580 Ga0501046_0025531 Ga0501046_0025531_2873_3970 365
222 3300049581 Ga0501047_0001124 Ga0501047_0001124_6990_8087 365
223 3300049581 Ga0501047_0008660 Ga0501047_0008660_7846_8943 365
224 3300049582 Ga0501048_0064768 Ga0501048_0064768_809_1906 365
225 3300049584 Ga0501068_0040252 Ga0501068_0040252_1025_2122 365
226 3300049742 Ga0501080_0212387 Ga0501080_0212387_659_1756 365
227 3300049744 Ga0501083_0052616 Ga0501083_0052616_767_1864 365
228 3300049744 Ga0501083_0101583 Ga0501083_0101583_62_1159 365
229 3300049822 Ga0501035_0000783 Ga0501035_0000783_7563_8660 365
230 3300049822 Ga0501035_0002708 Ga0501035_0002708_15491_16588 365
231 3300049823 Ga0501044_0000834 Ga0501044_0000834_13141_14238 365
232 3300049823 Ga0501044_0025152 Ga0501044_0025152_4180_5277 365
233 3300049823 Ga0501044_0032961 Ga0501044_0032961_3457_4554 365
234 3300049824 Ga0501045_0125874 Ga0501045_0125874_791_1888 365
235 3300060353 Ga0501082_0023065 Ga0501082_0023065_4122_5219 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02615

Ldh_2

Malate/L-lactate dehydrogenase

25

360

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h8a-assembly1.cif.gz_A crystal structure of ureidoglycolate dehydrogenase in binary complex with nadh 0.8773 7 351
1wtj-assembly1.cif.gz_A crystal structure of delta1-piperideine-2-carboxylate reductase from pseudomonas syringae pvar.tomato 0.8766 7 347
4fju-assembly1.cif.gz_B crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate 0.8764 10 326
1x0a-assembly1.cif.gz_A crystal structure of type ii malate/lactate dehydrogenase from thermus thermophilus hb8 0.8754 7 356
1s20-assembly3.cif.gz_E a novel nad binding protein revealed by the crystal structure of e. coli 2,3-diketogulonate reductase (yiak) northeast structural genomics consortium target er82 0.8731 7 346
ID Description Score Start End Superfamily
1wtjA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Hypothetical oxidoreductase yiak; domain 3 0.9641 188 232 3.30.60.50
1z2iA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Hypothetical oxidoreductase yiak; domain 3 0.9635 195 230 3.30.60.50
4h8aB01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.9259 8 56 1.10.1530.10
1z2iA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1;Hypothetical oxidoreductase yiak; domain 3 0.9162 195 230 3.30.60.50
af_Q9VP68_93_150_1.10.1530.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.915 7 57 1.10.1530.10
ID Description Score Start End GO Terms
AF-A0A290QA86-F1-model_v4 Lactate dehydrogenase 0.9801 1 365 GO:0016491
AF-A0A290QA86-F1-model_v4 Lactate dehydrogenase 0.9774 1 365 GO:0016491
AF-A0A354FR14-F1-model_v4 Lactate dehydrogenase 0.9697 1 210 GO:0016491
AF-A0A354FR14-F1-model_v4 Lactate dehydrogenase 0.9652 1 210 GO:0016491
AF-A0A351HCQ3-F1-model_v4 Lactate dehydrogenase 0.9558 1 186 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map