F348262

General Info

Members Datasets Scaffolds Average Seq Length
235 199 470 264

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10080681|Ga0265330_100806812
Length 266
Sequence MRQYLDFLDLLLREGRRKQDRTGTGTLSLFGHQMRFDLAQGFPLLTTKKLHRKSIIHELLWFLKGDTNVAYLRENGVTIWDEWADASGELGPVYGRQWRSWACPDGRVIDQIAGVVEDIKRDPFSRRLIVSAWNPADLDKMALAPCHCLFQFYIDETDGQKRLSCQLYQRSADVFLGVPFNIASYALLTHLIARETGCVAGDFVQTFGDAHLYLNHVDQAREQLKREPRSLPQLKLASGALFETRYDDIDIEGYDPWPAIAAPIAV

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
81 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
82 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
156 2509276019 Ensifer aridi TW10 Isolate Nodule
157 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
158 2534681786 Brucella suis 92/29 Isolate Unclassified
159 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
160 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
161 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
162 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
163 2643221582 Rhizobium sp. Root651 Isolate Unclassified
164 2643221693 Rhizobium sp. Root491 Isolate Unclassified
165 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
166 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
167 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
168 2751185800 Brucella pituitosa AA2 Isolate Unclassified
169 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
170 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
171 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
172 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
173 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
174 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
175 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
176 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
177 2854911287 Brucella lupini LUP21 Isolate Unclassified
178 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
179 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
180 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
181 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
182 2919404418 Luteibacter sp. 3190 Isolate Unclassified
183 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
184 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
185 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
186 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
187 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
188 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
189 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
190 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
191 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
192 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
193 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
194 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
195 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
196 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
197 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
198 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
199 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.57
Metatranscriptomes 1.28
Isolates 19.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.6
Nodule 5.11
Rhizoplane 2.55
Rhizosphere 54.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10080681 3300031235 Bacteria 1402
2 JGI24751J29686_10033308 3300002459 Bacteria 1068
3 JGI25156J39149_1005186 3300002705 Bacteria 3820
4 JGI25162J39368_1000128 3300002737 Bacteria 83781
5 JGI25157J39369_1000211 3300002741 Bacteria 48410
6 JGI25163J39215_1000749 3300002771 Bacteria 8171
7 JGI25164J39214_1000067 3300002772 Bacteria 103259
8 JGI25165J46597_1000167 3300003214 Bacteria 103259
9 Ga0006554J51385_1031742 3300003567 Bacteria 1087
10 Ga0006562J51391_1003487 3300003578 Bacteria 6510
11 Ga0006562J51391_1056881 3300003578 Bacteria 1460
12 Ga0055535_1000074 3300003761 Bacteria 111974
13 Ga0055535_1000256 3300003761 Bacteria 55821
14 Ga0055542_1000110 3300003762 Bacteria 110960
15 Ga0055542_1000206 3300003762 Bacteria 72609
16 Ga0055529_1000024 3300003763 Bacteria 305218
17 Ga0055529_1000121 3300003763 Bacteria 114639
18 Ga0065165_1001503 3300005262 Bacteria 24665
19 Ga0070670_100161106 3300005331 Bacteria 1944
20 Ga0070714_100012754 3300005435 Bacteria 6714
21 Ga0070707_100718755 3300005468 Bacteria 962
22 Ga0068853_100000079 3300005539 Bacteria 66544
23 Ga0070665_100010357 3300005548 Bacteria 9434
24 Ga0070664_100184131 3300005564 Bacteria 1858
25 Ga0068859_100012814 3300005617 Bacteria 8420
26 Ga0075368_10000115 3300006042 Bacteria 20911
27 Ga0075362_10053098 3300006177 Bacteria 1818
28 Ga0075369_10003237 3300006186 Bacteria 5913
29 Ga0075366_10035289 3300006195 Bacteria 2948
30 Ga0075431_100075455 3300006847 Bacteria 3479
31 Ga0075429_100073246 3300006880 Bacteria 2983
32 Ga0097620_100012814 3300006931 Bacteria 8420
33 Ga0105240_10153148 3300009093 Bacteria 2744
34 Ga0111539_10478246 3300009094 Bacteria 1451
35 Ga0114129_10891201 3300009147 Bacteria 1128
36 Ga0105243_10016974 3300009148 Bacteria 5506
37 Ga0105241_10103350 3300009174 Bacteria 2268
38 Ga0157373_10373246 3300013100 Bacteria 1020
39 Ga0157371_10063996 3300013102 Bacteria 2607
40 Ga0157370_10000351 3300013104 Bacteria 58496
41 Ga0171463_1003 3300013249 Bacteria 695693
42 Ga0163162_10003053 3300013306 Bacteria 15999
43 Ga0157372_10114956 3300013307 Bacteria 3085
44 Ga0163163_10004255 3300014325 Bacteria 12199
45 Ga0182008_10017288 3300014497 Bacteria 3743
46 Ga0182006_1061559 3300015261 Bacteria 1415
47 Ga0183363_1093 3300015690 Bacteria 25804
48 Ga0163161_10112030 3300017792 Bacteria 2041
49 Ga0214543_1000038 3300021327 Bacteria 182106
50 Ga0213872_10006331 3300021361 Bacteria 5957
51 Ga0209435_101940 3300025206 Bacteria 2491
52 Ga0209760_100644 3300025207 Bacteria 5773
53 Ga0209784_100011 3300025224 Bacteria 546770
54 Ga0209672_100972 3300025228 Bacteria 12689
55 Ga0209672_102843 3300025228 Bacteria 3926
56 Ga0207427_100026 3300025231 Bacteria 412764
57 Ga0209437_100217 3300025233 Bacteria 105424
58 Ga0209258_100027 3300025242 Bacteria 518449
59 Ga0209258_100165 3300025242 Bacteria 148376
60 Ga0209646_1000397 3300025246 Bacteria 26143
61 Ga0209026_1000018 3300025250 Bacteria 381351
62 Ga0209148_1000001 3300025254 Bacteria 2545271
63 Ga0209148_1000092 3300025254 Bacteria 249076
64 Ga0209759_1000066 3300025256 Bacteria 184163
65 Ga0209233_1000002 3300025261 Bacteria 2501366
66 Ga0209455_1000019 3300025272 Bacteria 705658
67 Ga0209050_1000538 3300025298 Bacteria 62826
68 Ga0207654_10010505 3300025911 Bacteria 4714
69 Ga0207650_10002806 3300025925 Bacteria 12027
70 Ga0207709_10227675 3300025935 Bacteria 1349
71 Ga0207670_10381624 3300025936 Bacteria 1123
72 Ga0207679_10155439 3300025945 Bacteria 1867
73 Ga0207639_10000046 3300026041 Bacteria 134165
74 Ga0207676_10261519 3300026095 Bacteria 1563
75 Ga0209983_1032140 3300027665 Bacteria 1121
76 Ga0268266_10017271 3300028379 Bacteria 6160
77 Ga0265328_10000041 3300031239 Bacteria 89398
78 Ga0265328_10000375 3300031239 Bacteria 20819
79 Ga0265328_10036327 3300031239 Bacteria 1820
80 Ga0265329_10044546 3300031242 Bacteria 1418
81 Ga0265331_10001219 3300031250 Bacteria 19343
82 Ga0265331_10008538 3300031250 Bacteria 5820
83 Ga0265327_10007761 3300031251 Bacteria 8191
84 Ga0265316_10012475 3300031344 Bacteria 7618
85 Ga0307416_100159545 3300032002 Bacteria 2082
86 Ga0307415_100330816 3300032126 Bacteria 1275
87 Ga0373937_0026443 3300036401 Bacteria 5245
88 Ga0395899_0023210 3300037312 Bacteria 4702
89 Ga0395898_0000922 3300037466 Bacteria 47049
90 Ga0400491_10962 3300038727 Bacteria 1596
91 Ga0400488_04209 3300038741 Bacteria 6451
92 Ga0400487_02813 3300039110 Bacteria 3506
93 Ga0400487_51829 3300039110 Bacteria 8967
94 Ga0436361_0069717 3300039447 Bacteria 2732
95 Ga0439465_0088928 3300041413 Bacteria 1055
96 Ga0451793_0020339 3300041452 Bacteria 2597
97 Ga0439449_0002827 3300042007 Bacteria 6751
98 Ga0439459_0000117 3300042438 Bacteria 7594
99 Ga0451577_0003143 3300042876 Bacteria 18605
100 Ga0466961_0000645 3300044693 Bacteria 21905
101 Ga0495629_0002267 3300046459 Bacteria 14831
102 Ga0495629_0075936 3300046459 Bacteria 2346
103 Ga0495638_0000497 3300046460 Bacteria 46775
104 Ga0495651_0076887 3300046462 Bacteria 2528
105 Ga0495605_0018133 3300046474 Bacteria 3779
106 Ga0495662_0057370 3300046476 Bacteria 1880
107 Ga0495664_0138139 3300046477 Bacteria 1477
108 Ga0495584_0004915 3300046491 Bacteria 7132
109 Ga0495631_0050519 3300046518 Bacteria 1818
110 Ga0495637_0043319 3300046520 Bacteria 1922
111 Ga0495637_0052240 3300046520 Bacteria 1707
112 Ga0495644_0012345 3300046523 Bacteria 3284
113 Ga0495609_0084030 3300046538 Bacteria 1389
114 Ga0495633_0048274 3300046558 Bacteria 2010
115 Ga0495611_0107660 3300046648 Bacteria 1296
116 Ga0495625_0008650 3300046660 Bacteria 8655
117 Ga0495625_0013357 3300046660 Bacteria 6601
118 Ga0495588_0001754 3300046674 Bacteria 9235
119 Ga0495657_0023715 3300046675 Bacteria 4382
120 Ga0495670_0026280 3300046691 Bacteria 2881
121 Ga0495589_0211645 3300046794 Bacteria 912
122 Ga0495600_0006237 3300046809 Bacteria 7237
123 Ga0495660_0034741 3300046810 Bacteria 2819
124 Ga0495681_0015618 3300047470 Bacteria 4289
125 Ga0495626_0002661 3300048091 Bacteria 12112
126 Ga0495626_0008168 3300048091 Bacteria 5766
127 Ga0496110_0012211 3300048913 Bacteria 7057
128 Ga0496111_0012000 3300048914 Bacteria 5857
129 Ga0496111_0365525 3300048914 Bacteria 1068
130 Ga0496113_0038664 3300048916 Bacteria 3509
131 Ga0496116_0107101 3300048919 Bacteria 1653
132 Ga0496117_0000002 3300048920 Bacteria 2483758
133 Ga0496117_0005653 3300048920 Bacteria 13045
134 Ga0496118_0000087 3300048921 Bacteria 176693
135 Ga0496118_0101864 3300048921 Bacteria 1937
136 Ga0496119_0015291 3300048922 Bacteria 5926
137 Ga0496119_0090748 3300048922 Bacteria 1736
138 Ga0496119_0097266 3300048922 Bacteria 1659
139 Ga0496120_0000180 3300048923 Bacteria 107518
140 Ga0496120_0012345 3300048923 Bacteria 5821
141 Ga0496121_0020069 3300048924 Bacteria 6639
142 Ga0496122_0000004 3300048925 Bacteria 645283
143 Ga0496122_0008984 3300048925 Bacteria 10625
144 Ga0496122_0029402 3300048925 Bacteria 4636
145 Ga0496123_0000007 3300048926 Bacteria 645283
146 Ga0496124_0224383 3300048927 Bacteria 1410
147 Ga0496125_0000412 3300048928 Bacteria 79970
148 Ga0496125_0201207 3300048928 Bacteria 1303
149 Ga0496125_0314070 3300048928 Bacteria 953
150 Ga0496126_0011232 3300048929 Bacteria 9291
151 Ga0496126_0267507 3300048929 Bacteria 1419
152 Ga0501031_0008597 3300049568 Bacteria 6645
153 Ga0501031_0146336 3300049568 Bacteria 1544
154 Ga0501032_0053699 3300049569 Bacteria 2713
155 Ga0501032_0082177 3300049569 Bacteria 2143
156 Ga0501033_0090261 3300049570 Bacteria 2241
157 Ga0501034_0018054 3300049571 Bacteria 7239
158 Ga0501038_0008714 3300049574 Bacteria 9310
159 Ga0501038_0199043 3300049574 Bacteria 1608
160 Ga0501039_0238933 3300049575 Bacteria 1428
161 Ga0501043_0106562 3300049579 Bacteria 2202
162 Ga0501043_0183870 3300049579 Bacteria 1628
163 Ga0501046_0005153 3300049580 Bacteria 11714
164 Ga0501047_0503707 3300049581 Bacteria 1037
165 Ga0501070_0015026 3300049586 Bacteria 6514
166 Ga0501070_0019669 3300049586 Bacteria 5662
167 Ga0501070_0036125 3300049586 Bacteria 4126
168 Ga0501074_0017584 3300049590 Bacteria 5192
169 Ga0501074_0043816 3300049590 Bacteria 3239
170 Ga0501235_004215 3300049669 Bacteria 3116
171 Ga0501079_0160831 3300049741 Bacteria 1751
172 Ga0501080_0000611 3300049742 Bacteria 28272
173 Ga0501035_0098191 3300049822 Bacteria 2571
174 Ga0501035_0223351 3300049822 Bacteria 1607
175 Ga0501044_0131586 3300049823 Bacteria 2495
176 Ga0501044_0206611 3300049823 Bacteria 1920
177 Ga0501044_0362680 3300049823 Bacteria 1367
178 nmdc:mga03683_103743_c1 3300050489 Bacteria 1252
179 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
180 nmdc:mga0yw44_2944_c1 3300050492 Bacteria 7416
181 nmdc:mga0k408_41193_c1 3300050493 Bacteria 2659
182 nmdc:mga06z11_31333_c1 3300050494 Bacteria 2583
183 nmdc:mga07m45_171076_c1 3300050496 Bacteria 1263
184 nmdc:mga06r32_46368_c1 3300050510 Bacteria 4147
185 nmdc:mga0sz30_234_c1 3300050516 Bacteria 21206
186 Ga0495619_0025327 3300053085 Bacteria 3809
187 Ga0500561_0000158 3300053137 Bacteria 12739
188 Ga0500568_0140107 3300053139 Bacteria 897
189 Ga0500634_0010642 3300053161 Bacteria 4708
190 Ga0500645_030759 3300053730 Bacteria 1615
191 2509111305 2508501122 Bacteria 6292184
192 2509376415 2509276019 Bacteria 6802256
193 2524448611 2524023207 Bacteria 6813453
194 2535485101 2534681786 Bacteria 3308809
195 2554248176 2554235003 Bacteria 5877155
196 2558868422 2558860100 Bacteria 8458965
197 2559295292 2558860242 Bacteria 5568029
198 2599331707 2599185156 Bacteria 5403036
199 2643920398 2643221582 Bacteria 5804683
200 2644522014 2643221693 Bacteria 5513853
201 2657681509 2657244999 Bacteria 5946535
202 2723604332 2721755693 Bacteria 6126117
203 2730135022 2728369359 Bacteria 5621728
204 2753359727 2751185800 Bacteria 5467370
205 2753810126 2751185905 Bacteria 6142767
206 2758641986 2758568016 Bacteria 5645291
207 2792639127 2791355094 Bacteria 7011481
208 2802436689 2802428803 Bacteria 5806948
209 2804752701 2802429268 Bacteria 6094027
210 2838076918 2838074704 Bacteria 6785777
211 2842924112 2842922631 Bacteria 5824079
212 2848994371 2848992105 Bacteria 6810864
213 2854912377 2854911287 Bacteria 5582813
214 2884341641 2884338543 Bacteria 4610696
215 2889280291 2889276214 Bacteria 5979355
216 2899850689 2899845264 Bacteria 5672268
217 2904595779 2904595352 Bacteria 6124848
218 2919406253 2919404418 Bacteria 4232372
219 2920761592 2920760137 Bacteria 7427611
220 2920825154 2920822456 Bacteria 6897201
221 2926762885 2926760298 Bacteria 5505990
222 2937117883 2937113482 Bacteria 6505872
223 2939705379 2939702853 Bacteria 5139229
224 2957417574 2957415311 Bacteria 6991633
225 2957446317 2957443900 Bacteria 6869977
226 2960621463 2960617483 Bacteria 6727748
227 2960661439 2960660292 Bacteria 7041660
228 2977526273 2977523885 Bacteria 6960446
229 2979094623 2979089926 Bacteria 5670289
230 2979100812 2979095461 Bacteria 5669583
231 2996711608 2996706504 Bacteria 5757485
232 648170454 648028048 Bacteria 5394884
233 650740501 650716007 Bacteria 5573770
234 8011351019 8011350971 Bacteria 6158957
235 8018153177 8018150411 Bacteria 5549903
236 Ga0265330_10080681
237 JGI24751J29686_10033308
238 JGI25156J39149_1005186
239 JGI25162J39368_1000128
240 JGI25157J39369_1000211
241 JGI25163J39215_1000749
242 JGI25164J39214_1000067
243 JGI25165J46597_1000167
244 Ga0006554J51385_1031742
245 Ga0006562J51391_1003487
246 Ga0006562J51391_1056881
247 Ga0055535_1000074
248 Ga0055535_1000256
249 Ga0055542_1000110
250 Ga0055542_1000206
251 Ga0055529_1000024
252 Ga0055529_1000121
253 Ga0065165_1001503
254 Ga0070670_100161106
255 Ga0070714_100012754
256 Ga0070707_100718755
257 Ga0068853_100000079
258 Ga0070665_100010357
259 Ga0070664_100184131
260 Ga0068859_100012814
261 Ga0075368_10000115
262 Ga0075362_10053098
263 Ga0075369_10003237
264 Ga0075366_10035289
265 Ga0075431_100075455
266 Ga0075429_100073246
267 Ga0097620_100012814
268 Ga0105240_10153148
269 Ga0111539_10478246
270 Ga0114129_10891201
271 Ga0105243_10016974
272 Ga0105241_10103350
273 Ga0157373_10373246
274 Ga0157371_10063996
275 Ga0157370_10000351
276 Ga0171463_1003
277 Ga0163162_10003053
278 Ga0157372_10114956
279 Ga0163163_10004255
280 Ga0182008_10017288
281 Ga0182006_1061559
282 Ga0183363_1093
283 Ga0163161_10112030
284 Ga0214543_1000038
285 Ga0213872_10006331
286 Ga0209435_101940
287 Ga0209760_100644
288 Ga0209784_100011
289 Ga0209672_100972
290 Ga0209672_102843
291 Ga0207427_100026
292 Ga0209437_100217
293 Ga0209258_100027
294 Ga0209258_100165
295 Ga0209646_1000397
296 Ga0209026_1000018
297 Ga0209148_1000001
298 Ga0209148_1000092
299 Ga0209759_1000066
300 Ga0209233_1000002
301 Ga0209455_1000019
302 Ga0209050_1000538
303 Ga0207654_10010505
304 Ga0207650_10002806
305 Ga0207709_10227675
306 Ga0207670_10381624
307 Ga0207679_10155439
308 Ga0207639_10000046
309 Ga0207676_10261519
310 Ga0209983_1032140
311 Ga0268266_10017271
312 Ga0265328_10000041
313 Ga0265328_10000375
314 Ga0265328_10036327
315 Ga0265329_10044546
316 Ga0265331_10001219
317 Ga0265331_10008538
318 Ga0265327_10007761
319 Ga0265316_10012475
320 Ga0307416_100159545
321 Ga0307415_100330816
322 Ga0373937_0026443
323 Ga0395899_0023210
324 Ga0395898_0000922
325 Ga0400491_10962
326 Ga0400488_04209
327 Ga0400487_02813
328 Ga0400487_51829
329 Ga0436361_0069717
330 Ga0439465_0088928
331 Ga0451793_0020339
332 Ga0439449_0002827
333 Ga0439459_0000117
334 Ga0451577_0003143
335 Ga0466961_0000645
336 Ga0495629_0002267
337 Ga0495629_0075936
338 Ga0495638_0000497
339 Ga0495651_0076887
340 Ga0495605_0018133
341 Ga0495662_0057370
342 Ga0495664_0138139
343 Ga0495584_0004915
344 Ga0495631_0050519
345 Ga0495637_0043319
346 Ga0495637_0052240
347 Ga0495644_0012345
348 Ga0495609_0084030
349 Ga0495633_0048274
350 Ga0495611_0107660
351 Ga0495625_0008650
352 Ga0495625_0013357
353 Ga0495588_0001754
354 Ga0495657_0023715
355 Ga0495670_0026280
356 Ga0495589_0211645
357 Ga0495600_0006237
358 Ga0495660_0034741
359 Ga0495681_0015618
360 Ga0495626_0002661
361 Ga0495626_0008168
362 Ga0496110_0012211
363 Ga0496111_0012000
364 Ga0496111_0365525
365 Ga0496113_0038664
366 Ga0496116_0107101
367 Ga0496117_0000002
368 Ga0496117_0005653
369 Ga0496118_0000087
370 Ga0496118_0101864
371 Ga0496119_0015291
372 Ga0496119_0090748
373 Ga0496119_0097266
374 Ga0496120_0000180
375 Ga0496120_0012345
376 Ga0496121_0020069
377 Ga0496122_0000004
378 Ga0496122_0008984
379 Ga0496122_0029402
380 Ga0496123_0000007
381 Ga0496124_0224383
382 Ga0496125_0000412
383 Ga0496125_0201207
384 Ga0496125_0314070
385 Ga0496126_0011232
386 Ga0496126_0267507
387 Ga0501031_0008597
388 Ga0501031_0146336
389 Ga0501032_0053699
390 Ga0501032_0082177
391 Ga0501033_0090261
392 Ga0501034_0018054
393 Ga0501038_0008714
394 Ga0501038_0199043
395 Ga0501039_0238933
396 Ga0501043_0106562
397 Ga0501043_0183870
398 Ga0501046_0005153
399 Ga0501047_0503707
400 Ga0501070_0015026
401 Ga0501070_0019669
402 Ga0501070_0036125
403 Ga0501074_0017584
404 Ga0501074_0043816
405 Ga0501235_004215
406 Ga0501079_0160831
407 Ga0501080_0000611
408 Ga0501035_0098191
409 Ga0501035_0223351
410 Ga0501044_0131586
411 Ga0501044_0206611
412 Ga0501044_0362680
413 nmdc:mga03683_103743_c1
414 nmdc:mga00v17_12_c1
415 nmdc:mga0yw44_2944_c1
416 nmdc:mga0k408_41193_c1
417 nmdc:mga06z11_31333_c1
418 nmdc:mga07m45_171076_c1
419 nmdc:mga06r32_46368_c1
420 nmdc:mga0sz30_234_c1
421 Ga0495619_0025327
422 Ga0500561_0000158
423 Ga0500568_0140107
424 Ga0500634_0010642
425 Ga0500645_030759
426 2509111305
427 2509376415
428 2524448611
429 2535485101
430 2554248176
431 2558868422
432 2559295292
433 2599331707
434 2643920398
435 2644522014
436 2657681509
437 2723604332
438 2730135022
439 2753359727
440 2753810126
441 2758641986
442 2792639127
443 2802436689
444 2804752701
445 2838076918
446 2842924112
447 2848994371
448 2854912377
449 2884341641
450 2889280291
451 2899850689
452 2904595779
453 2919406253
454 2920761592
455 2920825154
456 2926762885
457 2937117883
458 2939705379
459 2957417574
460 2957446317
461 2960621463
462 2960661439
463 2977526273
464 2979094623
465 2979100812
466 2996711608
467 648170454
468 650740501
469 8011351019
470 8018153177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

266

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b5b-assembly1.cif.gz_B crystal structure of the thymidylate synthase k48q 0.9854 1 264
1fwm-assembly1.cif.gz_B crystal structure of the thymidylate synthase r166q mutant 0.9846 3 264
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9842 1 261
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9838 3 264
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.9836 3 262
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9743 2 250 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9701 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9629 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.96 2 262 3.30.572.10
af_P06785_1_304_3.30.572.10 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9528 3 264 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A2H6J9D6-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.994 141 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A352HMS8-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.993 151 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A2E8YSB0-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9918 145 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3B8HDY4-F1-model_v4 deleted 0.9915 119 249
AF-A0A355SVW1-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.991 163 264 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map