F348334

General Info

Members Datasets Scaffolds Average Seq Length
235 166 470 149

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0435607|Ga0436360_0435607_2073_2600
Length 175
Sequence VPQQDKRVVQQDGVSPEALLQLTISRMEIAGSVGSVLAHKGSAVWSIAPNATVFDAIELMADKNVGALPVVDDGQLVGMISERDYTRKVSLKGKSSKHTPVREIMTQDVVTVNVADTIRECMGVMTDSRIRHLPVMEGEKMIGLVSLGDLVKWVILEQAATIEALQKYITGDYPA

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.7
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0435607 3300039438 Bacteria 3498
2 Ga0065704_10219847 3300005289 Bacteria 1078
3 Ga0065707_10248267 3300005295 Bacteria 1133
4 Ga0065707_10349503 3300005295 Unclassified 920
5 Ga0065707_10415509 3300005295 Unclassified 836
6 Ga0070676_10420623 3300005328 Unclassified 934
7 Ga0070690_100384670 3300005330 Bacteria 1027
8 Ga0070677_10172752 3300005333 Bacteria 1023
9 Ga0070677_10242259 3300005333 Bacteria 891
10 Ga0070666_10302024 3300005335 Bacteria 1140
11 Ga0070689_100072491 3300005340 Unclassified 2692
12 Ga0070668_100116971 3300005347 Bacteria 2127
13 Ga0070668_101100382 3300005347 Unclassified 717
14 Ga0070675_100686641 3300005354 Bacteria 932
15 Ga0070674_100002286 3300005356 Bacteria 10579
16 Ga0070674_100361987 3300005356 Bacteria 1175
17 Ga0070659_100716203 3300005366 Bacteria 866
18 Ga0070709_10197740 3300005434 Bacteria 1422
19 Ga0070713_100004684 3300005436 Bacteria 9236
20 Ga0070713_100241039 3300005436 Unclassified 1646
21 Ga0070713_101626631 3300005436 Unclassified 627
22 Ga0070710_10300057 3300005437 Unclassified 1048
23 Ga0070710_10846917 3300005437 Unclassified 656
24 Ga0070710_10865512 3300005437 Bacteria 650
25 Ga0070710_11248209 3300005437 Bacteria 551
26 Ga0070701_10138749 3300005438 Bacteria 1388
27 Ga0070700_100159169 3300005441 Bacteria 1553
28 Ga0070708_100843367 3300005445 Unclassified 861
29 Ga0070708_101873450 3300005445 Unclassified 556
30 Ga0070678_100589735 3300005456 Bacteria 991
31 Ga0070678_101083216 3300005456 Bacteria 739
32 Ga0068867_100134413 3300005459 Bacteria 1926
33 Ga0070685_10130149 3300005466 Bacteria 1573
34 Ga0070706_100226938 3300005467 Bacteria 1743
35 Ga0070698_100013579 3300005471 Bacteria 8624
36 Ga0070698_101506572 3300005471 Unclassified 624
37 Ga0070699_100370269 3300005518 Bacteria 1292
38 Ga0070699_100454436 3300005518 Unclassified 1162
39 Ga0070697_100012337 3300005536 Bacteria 6695
40 Ga0070697_100482349 3300005536 Bacteria 1083
41 Ga0070697_101244178 3300005536 Bacteria 664
42 Ga0070672_100243377 3300005543 Bacteria 1513
43 Ga0070695_100346273 3300005545 Bacteria 1112
44 Ga0070695_101172021 3300005545 Bacteria 631
45 Ga0070696_100347478 3300005546 Bacteria 1148
46 Ga0070696_100514094 3300005546 Bacteria 955
47 Ga0070704_100144584 3300005549 Bacteria 1862
48 Ga0068866_10183682 3300005718 Bacteria 1237
49 Ga0068861_100143762 3300005719 Bacteria 1950
50 Ga0068858_100006101 3300005842 Bacteria 11757
51 Ga0068858_100233339 3300005842 Bacteria 1744
52 Ga0068862_100033122 3300005844 Bacteria 4365
53 Ga0068862_101346419 3300005844 Bacteria 716
54 Ga0068862_101947908 3300005844 Bacteria 598
55 Ga0070717_10097646 3300006028 Bacteria 2489
56 Ga0070717_10212411 3300006028 Bacteria 1698
57 Ga0070715_10105680 3300006163 Bacteria 1320
58 Ga0070715_10809678 3300006163 Unclassified 569
59 Ga0075428_100247972 3300006844 Bacteria 1920
60 Ga0075433_10819537 3300006852 Unclassified 813
61 Ga0075434_100318124 3300006871 Bacteria 1577
62 Ga0075434_102110335 3300006871 Bacteria 568
63 Ga0075435_100511250 3300007076 Unclassified 1039
64 Ga0105247_10141587 3300009101 Bacteria 1576
65 Ga0114129_10034563 3300009147 Bacteria 7141
66 Ga0114129_10050700 3300009147 Bacteria 5829
67 Ga0114129_10297070 3300009147 Bacteria 2154
68 Ga0105243_10055234 3300009148 Bacteria 3155
69 Ga0105242_10530561 3300009176 Bacteria 1125
70 Ga0105242_11596455 3300009176 Bacteria 686
71 Ga0105248_10012641 3300009177 Bacteria 9315
72 Ga0105249_10050369 3300009553 Bacteria 3797
73 Ga0157378_10182131 3300013297 Bacteria 1977
74 Ga0157378_11588317 3300013297 Bacteria 700
75 Ga0157378_13319460 3300013297 Bacteria 500
76 Ga0163162_10199388 3300013306 Bacteria 2130
77 Ga0157375_10197727 3300013308 Bacteria 2166
78 Ga0157375_10374983 3300013308 Bacteria 1589
79 Ga0157380_10086566 3300014326 Bacteria 2575
80 Ga0157379_10321508 3300014968 Bacteria 1413
81 Ga0213873_10007201 3300021358 Bacteria 2219
82 Ga0213873_10008690 3300021358 Bacteria 2084
83 Ga0213873_10136830 3300021358 Bacteria 729
84 Ga0213872_10016090 3300021361 Bacteria 3473
85 Ga0213872_10025692 3300021361 Bacteria 2706
86 Ga0213872_10048825 3300021361 Bacteria 1923
87 Ga0213872_10057856 3300021361 Bacteria 1755
88 Ga0213872_10244420 3300021361 Unclassified 758
89 Ga0213875_10081008 3300021388 Unclassified 1515
90 Ga0213871_10003675 3300021441 Bacteria 2989
91 Ga0213871_10013882 3300021441 Bacteria 1901
92 Ga0213871_10224357 3300021441 Bacteria 591
93 Ga0207710_10187419 3300025900 Bacteria 1017
94 Ga0207680_10182509 3300025903 Bacteria 1420
95 Ga0207685_10631342 3300025905 Bacteria 577
96 Ga0207699_10043019 3300025906 Unclassified 2622
97 Ga0207645_10407152 3300025907 Bacteria 915
98 Ga0207684_10411628 3300025910 Bacteria 1162
99 Ga0207693_10151737 3300025915 Bacteria 1822
100 Ga0207646_11270447 3300025922 Unclassified 644
101 Ga0207646_11394089 3300025922 Bacteria 610
102 Ga0207681_10236789 3300025923 Bacteria 1419
103 Ga0207650_10072459 3300025925 Unclassified 2593
104 Ga0207700_10445298 3300025928 Bacteria 1141
105 Ga0207664_10240382 3300025929 Bacteria 1577
106 Ga0207664_10265998 3300025929 Bacteria 1501
107 Ga0207686_10553790 3300025934 Bacteria 899
108 Ga0207670_10066894 3300025936 Bacteria 2470
109 Ga0207669_10104637 3300025937 Bacteria 1881
110 Ga0207665_10882071 3300025939 Unclassified 709
111 Ga0207691_10256613 3300025940 Bacteria 1508
112 Ga0207712_10482804 3300025961 Bacteria 1057
113 Ga0207640_10625670 3300025981 Bacteria 914
114 Ga0207658_10365636 3300025986 Bacteria 1260
115 Ga0207678_10769070 3300026067 Unclassified 850
116 Ga0207708_10296925 3300026075 Bacteria 1313
117 Ga0207641_10930553 3300026088 Unclassified 864
118 Ga0207648_10049801 3300026089 Bacteria 3664
119 Ga0207648_10089797 3300026089 Bacteria 2685
120 Ga0207676_11597821 3300026095 Bacteria 650
121 Ga0207675_100082020 3300026118 Bacteria 3024
122 Ga0207675_101968284 3300026118 Bacteria 602
123 Ga0268265_11250097 3300028380 Bacteria 741
124 Ga0268264_10748106 3300028381 Bacteria 974
125 Ga0316182_1345904 3300030745 Bacteria 1755
126 Ga0265330_10003169 3300031235 Bacteria 8696
127 Ga0265327_10006483 3300031251 Bacteria 9343
128 Ga0265316_10035005 3300031344 Unclassified 4075
129 Ga0316579_10176082 3300031691 Bacteria 1034
130 Ga0265342_10081495 3300031712 Unclassified 1868
131 Ga0316576_10016571 3300031727 Bacteria 4983
132 Ga0316583_10021544 3300032133 Bacteria 2310
133 Ga0316593_10034913 3300032168 Bacteria 1652
134 Ga0373934_0220178 3300035086 Bacteria 783
135 Ga0373923_0064594 3300035111 Unclassified 1561
136 Ga0373953_0014109 3300035117 Bacteria 2867
137 Ga0373954_0007787 3300035118 Bacteria 4690
138 Ga0373956_0002608 3300035119 Bacteria 7310
139 Ga0373943_0812494 3300035170 Bacteria 557
140 Ga0373955_0087002 3300035172 Bacteria 1775
141 Ga0316574_0057866 3300035398 Bacteria 2428
142 Ga0373933_0075449 3300035724 Unclassified 2058
143 Ga0316582_0024092 3300036647 Bacteria 3638
144 Ga0316582_0054014 3300036647 Bacteria 2556
145 Ga0373925_0150939 3300037068 Bacteria 1825
146 Ga0436364_0220468 3300037853 Bacteria 1133
147 Ga0436364_0735347 3300037853 Unclassified 1038
148 Ga0436364_1544936 3300037853 Bacteria 2175
149 Ga0436365_0121356 3300039437 Bacteria 1577
150 Ga0436365_1046022 3300039437 Bacteria 4676
151 Ga0436360_1001631 3300039438 Bacteria 2687
152 Ga0436360_1145256 3300039438 Bacteria 1785
153 Ga0436360_1283839 3300039438 Bacteria 3030
154 Ga0436360_1344517 3300039438 Bacteria 1775
155 Ga0436361_0084085 3300039447 Bacteria 2779
156 Ga0436361_0111052 3300039447 Bacteria 2810
157 Ga0436361_0360478 3300039447 Bacteria 2580
158 Ga0436361_0832009 3300039447 Bacteria 2046
159 Ga0436361_0917364 3300039447 Unclassified 3539
160 Ga0436363_0246847 3300039450 Bacteria 4435
161 Ga0436363_1346061 3300039450 Unclassified 1648
162 Ga0436362_0134258 3300039453 Bacteria 3565
163 Ga0436362_0499418 3300039453 Bacteria 2689
164 Ga0436362_0530764 3300039453 Bacteria 747
165 Ga0436362_0869820 3300039453 Bacteria 1405
166 Ga0436362_1296339 3300039453 Bacteria 1290
167 Ga0439465_0028158 3300041413 Bacteria 1781
168 Ga0451837_0826166 3300041494 Bacteria 3111
169 Ga0466969_0023892 3300044656 Bacteria 3146
170 Ga0466972_0027019 3300044658 Bacteria 2841
171 Ga0466982_0000007 3300044672 Bacteria 250854
172 Ga0466966_0006305 3300044684 Bacteria 7846
173 Ga0466964_0004034 3300044706 Bacteria 5397
174 Ga0453684_0608580 3300044712 Unclassified 1197
175 Ga0466968_0000902 3300044735 Bacteria 10457
176 Ga0466970_0035220 3300044765 Bacteria 2652
177 Ga0466960_0021962 3300044901 Bacteria 2847
178 Ga0451576_0227836 3300045051 Bacteria 1946
179 Ga0466958_0161424 3300045836 Bacteria 1416
180 Ga0495628_1115443 3300046516 Bacteria 538
181 Ga0495643_0000359 3300046522 Bacteria 62167
182 Ga0495643_0004670 3300046522 Bacteria 9512
183 Ga0495642_0001995 3300046528 Bacteria 8543
184 Ga0495640_0297121 3300046533 Bacteria 1004
185 Ga0495597_0009756 3300046542 Bacteria 4728
186 Ga0495645_0190571 3300046543 Bacteria 1398
187 Ga0495668_0046843 3300046616 Bacteria 2402
188 Ga0495634_0029406 3300046642 Bacteria 3804
189 Ga0495661_0005406 3300046665 Bacteria 9083
190 Ga0495599_0199401 3300046678 Bacteria 1230
191 Ga0495647_0023649 3300046681 Bacteria 2230
192 Ga0495658_0159836 3300046683 Bacteria 1389
193 Ga0495658_0369322 3300046683 Unclassified 913
194 Ga0495581_0789610 3300047315 Bacteria 545
195 Ga0495604_0274591 3300047317 Bacteria 1141
196 Ga0495676_0260385 3300047321 Bacteria 1180
197 Ga0495687_008722 3300047443 Bacteria 5758
198 Ga0495686_0132032 3300047472 Bacteria 1480
199 Ga0496102_0117248 3300048905 Bacteria 2485
200 Ga0496107_0963051 3300048910 Bacteria 620
201 Ga0496112_1100029 3300048915 Unclassified 713
202 Ga0496115_0604348 3300048918 Bacteria 872
203 Ga0496117_0002696 3300048920 Bacteria 21946
204 Ga0496118_0002064 3300048921 Bacteria 28295
205 Ga0496126_0000164 3300048929 Bacteria 152791
206 Ga0501034_0429036 3300049571 Unclassified 1242
207 Ga0501036_0105300 3300049572 Bacteria 2386
208 Ga0501038_0248793 3300049574 Bacteria 1409
209 Ga0501039_0680803 3300049575 Bacteria 805
210 Ga0501041_0065689 3300049577 Bacteria 2223
211 Ga0501041_0084789 3300049577 Bacteria 1953
212 Ga0501042_0741701 3300049578 Bacteria 714
213 Ga0501042_0873469 3300049578 Bacteria 655
214 Ga0501046_0701204 3300049580 Bacteria 713
215 Ga0501048_0403174 3300049582 Bacteria 978
216 Ga0501071_0507093 3300049587 Bacteria 926
217 Ga0501075_0009480 3300049591 Bacteria 6814
218 Ga0501076_0046055 3300049592 Bacteria 3445
219 Ga0501076_0430673 3300049592 Bacteria 1086
220 Ga0501079_0046343 3300049741 Bacteria 3355
221 Ga0501079_0083266 3300049741 Unclassified 2475
222 Ga0501081_0062584 3300049743 Bacteria 2581
223 Ga0501081_0211237 3300049743 Bacteria 1409
224 Ga0501045_0481541 3300049824 Bacteria 922
225 nmdc:mga05p37_176698_c1 3300050507 Bacteria 2601
226 nmdc:mga05p37_27944_c2 3300050507 Bacteria 5840
227 nmdc:mga05p37_81886_c1 3300050507 Bacteria 3976
228 nmdc:mga0n895_623470_c1 3300050512 Bacteria 1079
229 nmdc:mga0a205_904050_c1 3300050515 Unclassified 730
230 Ga0495601_0076379 3300053077 Bacteria 2145
231 Ga0495619_0178316 3300053085 Bacteria 1470
232 Ga0495619_0441742 3300053085 Bacteria 897
233 Ga0500645_007544 3300053730 Bacteria 3778
234 Ga0466962_0002611 3300061719 Bacteria 8565
235 Ga0530510_0683203 3300061734 Bacteria 782
236 Ga0436360_0435607
237 Ga0065704_10219847
238 Ga0065707_10248267
239 Ga0065707_10349503
240 Ga0065707_10415509
241 Ga0070676_10420623
242 Ga0070690_100384670
243 Ga0070677_10172752
244 Ga0070677_10242259
245 Ga0070666_10302024
246 Ga0070689_100072491
247 Ga0070668_100116971
248 Ga0070668_101100382
249 Ga0070675_100686641
250 Ga0070674_100002286
251 Ga0070674_100361987
252 Ga0070659_100716203
253 Ga0070709_10197740
254 Ga0070713_100004684
255 Ga0070713_100241039
256 Ga0070713_101626631
257 Ga0070710_10300057
258 Ga0070710_10846917
259 Ga0070710_10865512
260 Ga0070710_11248209
261 Ga0070701_10138749
262 Ga0070700_100159169
263 Ga0070708_100843367
264 Ga0070708_101873450
265 Ga0070678_100589735
266 Ga0070678_101083216
267 Ga0068867_100134413
268 Ga0070685_10130149
269 Ga0070706_100226938
270 Ga0070698_100013579
271 Ga0070698_101506572
272 Ga0070699_100370269
273 Ga0070699_100454436
274 Ga0070697_100012337
275 Ga0070697_100482349
276 Ga0070697_101244178
277 Ga0070672_100243377
278 Ga0070695_100346273
279 Ga0070695_101172021
280 Ga0070696_100347478
281 Ga0070696_100514094
282 Ga0070704_100144584
283 Ga0068866_10183682
284 Ga0068861_100143762
285 Ga0068858_100006101
286 Ga0068858_100233339
287 Ga0068862_100033122
288 Ga0068862_101346419
289 Ga0068862_101947908
290 Ga0070717_10097646
291 Ga0070717_10212411
292 Ga0070715_10105680
293 Ga0070715_10809678
294 Ga0075428_100247972
295 Ga0075433_10819537
296 Ga0075434_100318124
297 Ga0075434_102110335
298 Ga0075435_100511250
299 Ga0105247_10141587
300 Ga0114129_10034563
301 Ga0114129_10050700
302 Ga0114129_10297070
303 Ga0105243_10055234
304 Ga0105242_10530561
305 Ga0105242_11596455
306 Ga0105248_10012641
307 Ga0105249_10050369
308 Ga0157378_10182131
309 Ga0157378_11588317
310 Ga0157378_13319460
311 Ga0163162_10199388
312 Ga0157375_10197727
313 Ga0157375_10374983
314 Ga0157380_10086566
315 Ga0157379_10321508
316 Ga0213873_10007201
317 Ga0213873_10008690
318 Ga0213873_10136830
319 Ga0213872_10016090
320 Ga0213872_10025692
321 Ga0213872_10048825
322 Ga0213872_10057856
323 Ga0213872_10244420
324 Ga0213875_10081008
325 Ga0213871_10003675
326 Ga0213871_10013882
327 Ga0213871_10224357
328 Ga0207710_10187419
329 Ga0207680_10182509
330 Ga0207685_10631342
331 Ga0207699_10043019
332 Ga0207645_10407152
333 Ga0207684_10411628
334 Ga0207693_10151737
335 Ga0207646_11270447
336 Ga0207646_11394089
337 Ga0207681_10236789
338 Ga0207650_10072459
339 Ga0207700_10445298
340 Ga0207664_10240382
341 Ga0207664_10265998
342 Ga0207686_10553790
343 Ga0207670_10066894
344 Ga0207669_10104637
345 Ga0207665_10882071
346 Ga0207691_10256613
347 Ga0207712_10482804
348 Ga0207640_10625670
349 Ga0207658_10365636
350 Ga0207678_10769070
351 Ga0207708_10296925
352 Ga0207641_10930553
353 Ga0207648_10049801
354 Ga0207648_10089797
355 Ga0207676_11597821
356 Ga0207675_100082020
357 Ga0207675_101968284
358 Ga0268265_11250097
359 Ga0268264_10748106
360 Ga0316182_1345904
361 Ga0265330_10003169
362 Ga0265327_10006483
363 Ga0265316_10035005
364 Ga0316579_10176082
365 Ga0265342_10081495
366 Ga0316576_10016571
367 Ga0316583_10021544
368 Ga0316593_10034913
369 Ga0373934_0220178
370 Ga0373923_0064594
371 Ga0373953_0014109
372 Ga0373954_0007787
373 Ga0373956_0002608
374 Ga0373943_0812494
375 Ga0373955_0087002
376 Ga0316574_0057866
377 Ga0373933_0075449
378 Ga0316582_0024092
379 Ga0316582_0054014
380 Ga0373925_0150939
381 Ga0436364_0220468
382 Ga0436364_0735347
383 Ga0436364_1544936
384 Ga0436365_0121356
385 Ga0436365_1046022
386 Ga0436360_1001631
387 Ga0436360_1145256
388 Ga0436360_1283839
389 Ga0436360_1344517
390 Ga0436361_0084085
391 Ga0436361_0111052
392 Ga0436361_0360478
393 Ga0436361_0832009
394 Ga0436361_0917364
395 Ga0436363_0246847
396 Ga0436363_1346061
397 Ga0436362_0134258
398 Ga0436362_0499418
399 Ga0436362_0530764
400 Ga0436362_0869820
401 Ga0436362_1296339
402 Ga0439465_0028158
403 Ga0451837_0826166
404 Ga0466969_0023892
405 Ga0466972_0027019
406 Ga0466982_0000007
407 Ga0466966_0006305
408 Ga0466964_0004034
409 Ga0453684_0608580
410 Ga0466968_0000902
411 Ga0466970_0035220
412 Ga0466960_0021962
413 Ga0451576_0227836
414 Ga0466958_0161424
415 Ga0495628_1115443
416 Ga0495643_0000359
417 Ga0495643_0004670
418 Ga0495642_0001995
419 Ga0495640_0297121
420 Ga0495597_0009756
421 Ga0495645_0190571
422 Ga0495668_0046843
423 Ga0495634_0029406
424 Ga0495661_0005406
425 Ga0495599_0199401
426 Ga0495647_0023649
427 Ga0495658_0159836
428 Ga0495658_0369322
429 Ga0495581_0789610
430 Ga0495604_0274591
431 Ga0495676_0260385
432 Ga0495687_008722
433 Ga0495686_0132032
434 Ga0496102_0117248
435 Ga0496107_0963051
436 Ga0496112_1100029
437 Ga0496115_0604348
438 Ga0496117_0002696
439 Ga0496118_0002064
440 Ga0496126_0000164
441 Ga0501034_0429036
442 Ga0501036_0105300
443 Ga0501038_0248793
444 Ga0501039_0680803
445 Ga0501041_0065689
446 Ga0501041_0084789
447 Ga0501042_0741701
448 Ga0501042_0873469
449 Ga0501046_0701204
450 Ga0501048_0403174
451 Ga0501071_0507093
452 Ga0501075_0009480
453 Ga0501076_0046055
454 Ga0501076_0430673
455 Ga0501079_0046343
456 Ga0501079_0083266
457 Ga0501081_0062584
458 Ga0501081_0211237
459 Ga0501045_0481541
460 nmdc:mga05p37_176698_c1
461 nmdc:mga05p37_27944_c2
462 nmdc:mga05p37_81886_c1
463 nmdc:mga0n895_623470_c1
464 nmdc:mga0a205_904050_c1
465 Ga0495601_0076379
466 Ga0495619_0178316
467 Ga0495619_0441742
468 Ga0500645_007544
469 Ga0466962_0002611
470 Ga0530510_0683203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

101

156

0.94

PF00571

CBS

CBS domain

38

91

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9624 1 127
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9584 4 130
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9567 3 127
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9477 1 127
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9448 4 125
ID Description Score Start End Superfamily
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9712 4 142 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9617 2 129 3.10.580.10
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9617 3 144 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9584 4 130 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9567 3 127 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A127FDE4-F1-model_v4 Histidine kinase 0.992 3 143 GO:0016301
AF-A0A7Y2K6A9-F1-model_v4 CBS domain-containing protein 0.9893 4 125
AF-A0A7C4BV57-F1-model_v4 CBS domain-containing protein 0.9886 2 132
AF-A0A7W7YAX3-F1-model_v4 CBS domain-containing protein 0.9878 1 123
AF-T1B6V4-F1-model_v4 Signal-transduction protein with CBS domain protein 0.9869 1 119

Map