F348367

General Info

Members Datasets Scaffolds Average Seq Length
235 164 470 139

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0013517|Ga0451577_0013517_850_1302
Length 150
Sequence MATSLQFHKRFAGILPALALFGASQVHAANADDAKGLWITAQKDAVIEFKICPDRPGALCGQIVWDKDAGTPADTCGVRIAQLDKYNQDKEAWRDGWIYDPRDKKTYKGVIRVKDKTLNMRAYIGVEVLGETEELFHVDAMPATPVCKAR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
79 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
80 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
81 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
88 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
89 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
90 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
96 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
97 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
98 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
99 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
100 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
118 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
119 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
120 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
121 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
122 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
123 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
124 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
125 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
126 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
127 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
143 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
144 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
151 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
154 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
155 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
156 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
157 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
158 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
159 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
160 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
161 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
162 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
163 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
164 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 0
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.49
Nodule 0
Rhizoplane 3.83
Rhizosphere 39.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0013517 3300042876 Bacteria 7636
2 JGI24740J21852_10000726 3300001979 Bacteria 14365
3 JGI25150J39212_1000148 3300002774 Bacteria 39765
4 JGI25151J46595_10000484 3300003187 Bacteria 37639
5 JGI25153J46596_10002611 3300003215 Bacteria 10306
6 JGI25153J46596_10007686 3300003215 Bacteria 5254
7 rootH1_10001291 3300003316 Bacteria 29451
8 rootH1_10135831 3300003316 Bacteria 1888
9 rootL2_10000467 3300003322 Bacteria 50803
10 rootL2_10210459 3300003322 Bacteria 4272
11 rootH1_10301204 3300003323 Bacteria 1087
12 Ga0055524_1000671 3300003775 Bacteria 23984
13 Ga0055530_10007766 3300003791 Bacteria 4444
14 Ga0058692_1000020 3300003856 Bacteria 250589
15 Ga0065165_1005360 3300005262 Bacteria 7267
16 Ga0070666_10942732 3300005335 Bacteria 639
17 Ga0070687_100453977 3300005343 Bacteria 853
18 Ga0070671_100469233 3300005355 Bacteria 1081
19 Ga0070667_100331158 3300005367 Bacteria 1376
20 Ga0068867_100000552 3300005459 Bacteria 24723
21 Ga0070706_100314856 3300005467 Bacteria 1460
22 Ga0068854_101405698 3300005578 Bacteria 631
23 Ga0068852_100047705 3300005616 Bacteria 3656
24 Ga0068859_101896453 3300005617 Bacteria 658
25 Ga0068861_100603197 3300005719 Bacteria 1008
26 Ga0075365_10324551 3300006038 Bacteria 1084
27 Ga0075368_10056057 3300006042 Bacteria 1572
28 Ga0075363_100019445 3300006048 Bacteria 3397
29 Ga0075363_100079490 3300006048 Bacteria 1792
30 Ga0075364_11054972 3300006051 Bacteria 552
31 Ga0075432_10474952 3300006058 Bacteria 553
32 Ga0075362_10007150 3300006177 Bacteria 4209
33 Ga0075362_10413315 3300006177 Bacteria 682
34 Ga0075367_10054805 3300006178 Bacteria 2365
35 Ga0075367_10139848 3300006178 Bacteria 1500
36 Ga0075367_10689179 3300006178 Bacteria 650
37 Ga0075366_10014269 3300006195 Bacteria 4537
38 Ga0075366_10026653 3300006195 Bacteria 3386
39 Ga0075366_10173751 3300006195 Bacteria 1308
40 Ga0097621_100521839 3300006237 Bacteria 1078
41 Ga0075370_10006467 3300006353 Bacteria 5897
42 Ga0097620_101895585 3300006931 Bacteria 658
43 Ga0114129_12320663 3300009147 Bacteria 644
44 Ga0105243_10000697 3300009148 Bacteria 32602
45 Ga0105243_10017417 3300009148 Bacteria 5431
46 Ga0105237_10095895 3300009545 Bacteria 2956
47 Ga0157378_10142088 3300013297 Bacteria 2230
48 Ga0163163_10813685 3300014325 Bacteria 998
49 Ga0157379_10309009 3300014968 Bacteria 1442
50 Ga0182005_1015688 3300015265 Bacteria 2111
51 Ga0207425_1000241 3300025245 Bacteria 42565
52 Ga0209129_1000320 3300025258 Bacteria 42469
53 Ga0209129_1000651 3300025258 Bacteria 23242
54 Ga0209129_1018364 3300025258 Bacteria 1345
55 Ga0209673_1010119 3300025273 Bacteria 4005
56 Ga0209025_1000207 3300025294 Bacteria 140774
57 Ga0209758_1000078 3300025297 Bacteria 266153
58 Ga0209758_1000848 3300025297 Bacteria 42565
59 Ga0209050_1002477 3300025298 Bacteria 15691
60 Ga0209256_1001155 3300025299 Bacteria 29900
61 Ga0209257_1076190 3300025304 Bacteria 872
62 Ga0207684_10311806 3300025910 Bacteria 1356
63 Ga0207671_10093825 3300025914 Bacteria 2264
64 Ga0207671_10406187 3300025914 Bacteria 1083
65 Ga0207662_10370011 3300025918 Bacteria 966
66 Ga0207644_10509084 3300025931 Bacteria 994
67 Ga0207709_10005144 3300025935 Bacteria 7462
68 Ga0207709_10012997 3300025935 Bacteria 4590
69 Ga0207689_10021594 3300025942 Bacteria 5412
70 Ga0207658_10350453 3300025986 Bacteria 1285
71 Ga0207674_10595131 3300026116 Bacteria 1068
72 Ga0207698_10300942 3300026142 Bacteria 1493
73 Ga0209371_1000011 3300027312 Bacteria 848456
74 Ga0209974_10019385 3300027876 Bacteria 2255
75 Ga0207428_11300768 3300027907 Bacteria 504
76 Ga0307517_10001740 3300028786 Bacteria 35898
77 Ga0307517_10026585 3300028786 Bacteria 7003
78 Ga0307517_10329641 3300028786 Bacteria 839
79 Ga0307515_10000282 3300028794 Bacteria 125216
80 Ga0307515_10000837 3300028794 Bacteria 70694
81 Ga0307515_10001476 3300028794 Bacteria 52884
82 Ga0307515_10017078 3300028794 Bacteria 13249
83 Ga0307515_10031199 3300028794 Bacteria 8897
84 Ga0268256_1000011 3300030500 Bacteria 848625
85 Ga0307512_10042540 3300030522 Bacteria 3759
86 Ga0307512_10235226 3300030522 Bacteria 935
87 Ga0307513_10018739 3300031456 Bacteria 8264
88 Ga0307513_10231924 3300031456 Bacteria 1658
89 Ga0307513_10243930 3300031456 Bacteria 1599
90 Ga0307509_10001779 3300031507 Bacteria 35792
91 Ga0307509_10003682 3300031507 Bacteria 22922
92 Ga0307509_10121958 3300031507 Bacteria 2582
93 Ga0307509_10163330 3300031507 Bacteria 2120
94 Ga0307509_10167889 3300031507 Bacteria 2079
95 Ga0307509_10170692 3300031507 Bacteria 2055
96 Ga0307408_100000219 3300031548 Bacteria 61012
97 Ga0307408_100105765 3300031548 Bacteria 2152
98 Ga0307408_100906230 3300031548 Bacteria 807
99 Ga0307508_10000016 3300031616 Bacteria 206976
100 Ga0307508_10001829 3300031616 Bacteria 23544
101 Ga0307514_10001033 3300031649 Bacteria 40119
102 Ga0307514_10001530 3300031649 Bacteria 27605
103 Ga0307514_10009526 3300031649 Bacteria 8160
104 Ga0307514_10117268 3300031649 Bacteria 1868
105 Ga0307514_10194077 3300031649 Bacteria 1288
106 Ga0307516_10005067 3300031730 Bacteria 15943
107 Ga0307516_10337764 3300031730 Bacteria 1174
108 Ga0307406_10000604 3300031901 Bacteria 20514
109 Ga0307416_100002714 3300032002 Bacteria 10258
110 Ga0307416_100005847 3300032002 Bacteria 7627
111 Ga0307507_10051062 3300033179 Bacteria 3984
112 Ga0307507_10131164 3300033179 Bacteria 1960
113 Ga0307507_10279734 3300033179 Bacteria 1045
114 Ga0307510_10029801 3300033180 Bacteria 6202
115 Ga0395905_0358669 3300037471 Bacteria 1350
116 Ga0395905_1316084 3300037471 Bacteria 626
117 Ga0400484_03537 3300038725 Bacteria 7914
118 Ga0400484_13038 3300038725 Bacteria 2909
119 Ga0400490_14606 3300038726 Bacteria 18655
120 Ga0400491_19342 3300038727 Bacteria 17826
121 Ga0400483_022054 3300039062 Bacteria 3173
122 Ga0400483_096403 3300039062 Bacteria 4904
123 Ga0400483_184392 3300039062 Bacteria 1418
124 Ga0400483_193175 3300039062 Bacteria 9297
125 Ga0400483_215542 3300039062 Bacteria 14582
126 Ga0451787_575181 3300041441 Bacteria 872
127 Ga0451789_0413142 3300041443 Bacteria 954
128 Ga0451791_0801499 3300041451 Bacteria 2127
129 Ga0451797_0123089 3300041453 Bacteria 1388
130 Ga0451798_0471284 3300041458 Bacteria 861
131 Ga0451802_0463378 3300041460 Bacteria 1541
132 Ga0451802_1725171 3300041460 Bacteria 1374
133 Ga0451807_1377498 3300041486 Bacteria 609
134 Ga0451835_0779320 3300041492 Bacteria 1076
135 Ga0451839_0801522 3300041496 Bacteria 797
136 Ga0451841_0373014 3300041498 Bacteria 1504
137 Ga0451845_0583438 3300041501 Bacteria 694
138 Ga0451843_0795912 3300041509 Bacteria 507
139 Ga0451853_0881195 3300041512 Bacteria 636
140 Ga0439437_015430 3300042000 Bacteria 898
141 Ga0439450_025647 3300042008 Bacteria 1294
142 Ga0450919_000592 3300042121 Bacteria 4581
143 Ga0450891_004370 3300042129 Bacteria 1326
144 Ga0450892_000843 3300042130 Bacteria 3369
145 Ga0450903_031456 3300042138 Bacteria 800
146 Ga0450918_000056 3300042531 Bacteria 22747
147 Ga0450893_0000840 3300042532 Bacteria 4548
148 Ga0451577_0001066 3300042876 Bacteria 39535
149 Ga0453683_0050748 3300044673 Bacteria 2600
150 Ga0453684_0006104 3300044712 Bacteria 23233
151 Ga0453684_0149056 3300044712 Bacteria 2782
152 Ga0451576_0002708 3300045051 Bacteria 25749
153 Ga0495592_0000387 3300046454 Bacteria 34389
154 Ga0495638_0120021 3300046460 Bacteria 1555
155 Ga0495610_0047022 3300046512 Bacteria 2125
156 Ga0495610_0088029 3300046512 Bacteria 1412
157 Ga0495643_0063091 3300046522 Bacteria 1960
158 Ga0495625_0003792 3300046660 Bacteria 14645
159 Ga0495625_0716880 3300046660 Bacteria 589
160 Ga0495671_0441988 3300046692 Bacteria 622
161 Ga0495687_003133 3300047443 Bacteria 12338
162 Ga0495673_0042977 3300047469 Bacteria 2025
163 Ga0495626_0325165 3300048091 Bacteria 604
164 Ga0496102_0007764 3300048905 Bacteria 9170
165 Ga0496116_0087154 3300048919 Bacteria 1912
166 Ga0496124_0000705 3300048927 Bacteria 54667
167 Ga0501292_002616 3300049515 Bacteria 2337
168 Ga0501293_016337 3300049516 Bacteria 690
169 Ga0501294_012811 3300049517 Bacteria 845
170 Ga0501298_026403 3300049521 Bacteria 1117
171 Ga0501299_016228 3300049522 Bacteria 1317
172 Ga0501303_007699 3300049526 Bacteria 965
173 Ga0501206_006604 3300049653 Bacteria 1510
174 Ga0501206_029248 3300049653 Bacteria 814
175 Ga0501222_056063 3300049662 Bacteria 587
176 Ga0501243_117295 3300049675 Bacteria 549
177 Ga0501257_025975 3300049686 Bacteria 1396
178 Ga0501257_122507 3300049686 Bacteria 698
179 Ga0501262_004428 3300049759 Bacteria 1630
180 Ga0501262_011419 3300049759 Bacteria 1124
181 Ga0501281_04756 3300049777 Bacteria 951
182 nmdc:mga03683_44805_c1 3300050489 Bacteria 1829
183 nmdc:mga03n38_118080_c1 3300050490 Bacteria 1300
184 nmdc:mga00v17_1068395_c1 3300050491 Bacteria 506
185 nmdc:mga00v17_242561_c1 3300050491 Bacteria 1168
186 nmdc:mga0k408_11018_c1 3300050493 Bacteria 4909
187 nmdc:mga0k408_1853_c1 3300050493 Bacteria 11360
188 nmdc:mga0k408_204189_c1 3300050493 Bacteria 1180
189 nmdc:mga0k408_242661_c1 3300050493 Bacteria 1076
190 nmdc:mga0k408_261858_c1 3300050493 Bacteria 1033
191 nmdc:mga0k408_45239_c1 3300050493 Bacteria 2539
192 nmdc:mga0k408_92342_c1 3300050493 Bacteria 1779
193 nmdc:mga06z11_147447_c1 3300050494 Bacteria 1335
194 nmdc:mga06z11_576005_c1 3300050494 Bacteria 684
195 nmdc:mga06z11_98060_c1 3300050494 Bacteria 1603
196 nmdc:mga04h51_192632_c1 3300050495 Bacteria 798
197 nmdc:mga07m45_107544_c1 3300050496 Bacteria 1605
198 nmdc:mga07m45_1432_c1 3300050496 Bacteria 10939
199 nmdc:mga07m45_269812_c1 3300050496 Bacteria 990
200 nmdc:mga07m45_513_c1 3300050496 Bacteria 16432
201 nmdc:mga07m45_619320_c1 3300050496 Bacteria 625
202 nmdc:mga0sz30_569434_c1 3300050516 Bacteria 512
203 Ga0500610_0087824 3300053079 Bacteria 1617
204 Ga0500578_0000013 3300053086 Bacteria 185921
205 Ga0500578_0218970 3300053086 Bacteria 1158
206 Ga0500643_114977 3300053087 Bacteria 726
207 Ga0500644_0190531 3300053088 Bacteria 844
208 Ga0500583_0228180 3300053092 Bacteria 922
209 Ga0500651_0003007 3300053093 Bacteria 9096
210 Ga0500650_0369270 3300053098 Bacteria 625
211 Ga0500562_015044 3300053108 Bacteria 1984
212 Ga0500628_109862 3300053129 Bacteria 738
213 Ga0500652_000278 3300053131 Bacteria 19044
214 Ga0500658_0224213 3300053134 Bacteria 862
215 Ga0500568_0022164 3300053139 Bacteria 2723
216 Ga0500604_0003090 3300053151 Bacteria 4470
217 Ga0500604_0034787 3300053151 Bacteria 1496
218 Ga0500604_0035292 3300053151 Bacteria 1487
219 Ga0500622_0001029 3300053156 Bacteria 23369
220 Ga0500627_0175789 3300053158 Bacteria 964
221 Ga0500584_127232 3300053726 Bacteria 998
222 Ga0500645_215772 3300053730 Bacteria 515
223 Ga0500587_000096 3300053739 Bacteria 7634
224 2587730910 2585428057 Bacteria 6737412
225 2587735758 2585428058 Bacteria 6853932
226 2587754947 2585428062 Bacteria 6842168
227 2587759269 2585428062 Bacteria 6842168
228 2643970167 2643221592 Bacteria 6608788
229 2644141166 2643221625 Bacteria 6512927
230 2644248534 2643221644 Bacteria 6865017
231 2644274221 2643221648 Bacteria 6521465
232 2919707859 2919704043 Bacteria 5560311
233 8021624717 8021622325 Bacteria 4844743
234 8021630391 8021626552 Bacteria 4665214
235 8021648596 8021648035 Bacteria 4772378
236 Ga0451577_0013517
237 JGI24740J21852_10000726
238 JGI25150J39212_1000148
239 JGI25151J46595_10000484
240 JGI25153J46596_10002611
241 JGI25153J46596_10007686
242 rootH1_10001291
243 rootH1_10135831
244 rootL2_10000467
245 rootL2_10210459
246 rootH1_10301204
247 Ga0055524_1000671
248 Ga0055530_10007766
249 Ga0058692_1000020
250 Ga0065165_1005360
251 Ga0070666_10942732
252 Ga0070687_100453977
253 Ga0070671_100469233
254 Ga0070667_100331158
255 Ga0068867_100000552
256 Ga0070706_100314856
257 Ga0068854_101405698
258 Ga0068852_100047705
259 Ga0068859_101896453
260 Ga0068861_100603197
261 Ga0075365_10324551
262 Ga0075368_10056057
263 Ga0075363_100019445
264 Ga0075363_100079490
265 Ga0075364_11054972
266 Ga0075432_10474952
267 Ga0075362_10007150
268 Ga0075362_10413315
269 Ga0075367_10054805
270 Ga0075367_10139848
271 Ga0075367_10689179
272 Ga0075366_10014269
273 Ga0075366_10026653
274 Ga0075366_10173751
275 Ga0097621_100521839
276 Ga0075370_10006467
277 Ga0097620_101895585
278 Ga0114129_12320663
279 Ga0105243_10000697
280 Ga0105243_10017417
281 Ga0105237_10095895
282 Ga0157378_10142088
283 Ga0163163_10813685
284 Ga0157379_10309009
285 Ga0182005_1015688
286 Ga0207425_1000241
287 Ga0209129_1000320
288 Ga0209129_1000651
289 Ga0209129_1018364
290 Ga0209673_1010119
291 Ga0209025_1000207
292 Ga0209758_1000078
293 Ga0209758_1000848
294 Ga0209050_1002477
295 Ga0209256_1001155
296 Ga0209257_1076190
297 Ga0207684_10311806
298 Ga0207671_10093825
299 Ga0207671_10406187
300 Ga0207662_10370011
301 Ga0207644_10509084
302 Ga0207709_10005144
303 Ga0207709_10012997
304 Ga0207689_10021594
305 Ga0207658_10350453
306 Ga0207674_10595131
307 Ga0207698_10300942
308 Ga0209371_1000011
309 Ga0209974_10019385
310 Ga0207428_11300768
311 Ga0307517_10001740
312 Ga0307517_10026585
313 Ga0307517_10329641
314 Ga0307515_10000282
315 Ga0307515_10000837
316 Ga0307515_10001476
317 Ga0307515_10017078
318 Ga0307515_10031199
319 Ga0268256_1000011
320 Ga0307512_10042540
321 Ga0307512_10235226
322 Ga0307513_10018739
323 Ga0307513_10231924
324 Ga0307513_10243930
325 Ga0307509_10001779
326 Ga0307509_10003682
327 Ga0307509_10121958
328 Ga0307509_10163330
329 Ga0307509_10167889
330 Ga0307509_10170692
331 Ga0307408_100000219
332 Ga0307408_100105765
333 Ga0307408_100906230
334 Ga0307508_10000016
335 Ga0307508_10001829
336 Ga0307514_10001033
337 Ga0307514_10001530
338 Ga0307514_10009526
339 Ga0307514_10117268
340 Ga0307514_10194077
341 Ga0307516_10005067
342 Ga0307516_10337764
343 Ga0307406_10000604
344 Ga0307416_100002714
345 Ga0307416_100005847
346 Ga0307507_10051062
347 Ga0307507_10131164
348 Ga0307507_10279734
349 Ga0307510_10029801
350 Ga0395905_0358669
351 Ga0395905_1316084
352 Ga0400484_03537
353 Ga0400484_13038
354 Ga0400490_14606
355 Ga0400491_19342
356 Ga0400483_022054
357 Ga0400483_096403
358 Ga0400483_184392
359 Ga0400483_193175
360 Ga0400483_215542
361 Ga0451787_575181
362 Ga0451789_0413142
363 Ga0451791_0801499
364 Ga0451797_0123089
365 Ga0451798_0471284
366 Ga0451802_0463378
367 Ga0451802_1725171
368 Ga0451807_1377498
369 Ga0451835_0779320
370 Ga0451839_0801522
371 Ga0451841_0373014
372 Ga0451845_0583438
373 Ga0451843_0795912
374 Ga0451853_0881195
375 Ga0439437_015430
376 Ga0439450_025647
377 Ga0450919_000592
378 Ga0450891_004370
379 Ga0450892_000843
380 Ga0450903_031456
381 Ga0450918_000056
382 Ga0450893_0000840
383 Ga0451577_0001066
384 Ga0453683_0050748
385 Ga0453684_0006104
386 Ga0453684_0149056
387 Ga0451576_0002708
388 Ga0495592_0000387
389 Ga0495638_0120021
390 Ga0495610_0047022
391 Ga0495610_0088029
392 Ga0495643_0063091
393 Ga0495625_0003792
394 Ga0495625_0716880
395 Ga0495671_0441988
396 Ga0495687_003133
397 Ga0495673_0042977
398 Ga0495626_0325165
399 Ga0496102_0007764
400 Ga0496116_0087154
401 Ga0496124_0000705
402 Ga0501292_002616
403 Ga0501293_016337
404 Ga0501294_012811
405 Ga0501298_026403
406 Ga0501299_016228
407 Ga0501303_007699
408 Ga0501206_006604
409 Ga0501206_029248
410 Ga0501222_056063
411 Ga0501243_117295
412 Ga0501257_025975
413 Ga0501257_122507
414 Ga0501262_004428
415 Ga0501262_011419
416 Ga0501281_04756
417 nmdc:mga03683_44805_c1
418 nmdc:mga03n38_118080_c1
419 nmdc:mga00v17_1068395_c1
420 nmdc:mga00v17_242561_c1
421 nmdc:mga0k408_11018_c1
422 nmdc:mga0k408_1853_c1
423 nmdc:mga0k408_204189_c1
424 nmdc:mga0k408_242661_c1
425 nmdc:mga0k408_261858_c1
426 nmdc:mga0k408_45239_c1
427 nmdc:mga0k408_92342_c1
428 nmdc:mga06z11_147447_c1
429 nmdc:mga06z11_576005_c1
430 nmdc:mga06z11_98060_c1
431 nmdc:mga04h51_192632_c1
432 nmdc:mga07m45_107544_c1
433 nmdc:mga07m45_1432_c1
434 nmdc:mga07m45_269812_c1
435 nmdc:mga07m45_513_c1
436 nmdc:mga07m45_619320_c1
437 nmdc:mga0sz30_569434_c1
438 Ga0500610_0087824
439 Ga0500578_0000013
440 Ga0500578_0218970
441 Ga0500643_114977
442 Ga0500644_0190531
443 Ga0500583_0228180
444 Ga0500651_0003007
445 Ga0500650_0369270
446 Ga0500562_015044
447 Ga0500628_109862
448 Ga0500652_000278
449 Ga0500658_0224213
450 Ga0500568_0022164
451 Ga0500604_0003090
452 Ga0500604_0034787
453 Ga0500604_0035292
454 Ga0500622_0001029
455 Ga0500627_0175789
456 Ga0500584_127232
457 Ga0500645_215772
458 Ga0500587_000096
459 2587730910
460 2587735758
461 2587754947
462 2587759269
463 2643970167
464 2644141166
465 2644248534
466 2644274221
467 2919707859
468 8021624717
469 8021630391
470 8021648596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09917

DUF2147

Uncharacterized protein conserved in bacteria (DUF2147)

36

136

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4inn-assembly1.cif.gz_A protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family 0.6809 27 130
6jm5-assembly2.cif.gz_B crystal structure of tbc1d23 c terminal domain 0.602 95 126
8bhy-assembly1.cif.gz_D dna-pk ku80 mediated dimer bound to paxx and xlf 0.6012 100 129
6ew5-assembly4.cif.gz_D human myelin protein p2 f57a mutant, monoclinic crystal form 0.5989 25 129
7tol-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.5872 88 119
ID Description Score Start End Superfamily
af_Q9N589_34_139_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7094 83 126 2.30.29.30
4innA00 Mainly Beta;Beta Barrel;Lipocalin; 0.6929 27 130 2.40.128.520
af_F1QTP6_122_221_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6884 83 120 2.30.29.30
af_Q0DV08_215_351_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6804 96 125 2.30.29.30
af_M9PCC9_52_133_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6657 100 134 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A519DXE7-F1-model_v4 DUF2147 domain-containing protein 0.9824 20 140
AF-A0A519DXE7-F1-model_v4 DUF2147 domain-containing protein 0.9744 20 140
AF-A0A7C2FJ00-F1-model_v4 DUF2147 domain-containing protein 0.9041 83 129
AF-A0A1I6LBI8-F1-model_v4 Uncharacterized conserved protein, DUF2147 family 0.9014 3 140
AF-A0A7W5BFZ1-F1-model_v4 Uncharacterized protein (DUF2147 family) 0.9013 1 140

Map